F462566

General Info

Members Datasets Scaffolds Average Seq Length
551 199 1102 202

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10419438|Ga0070658_104194382
Length 211
Sequence MDDIETIMRTAPVIPVLVLDDPDQAVAIGTALVKGGLNVLEVTLRTRRALDVMTAMTGIEGAIVGAGTVLDEAQLDLALDAGARFIVSPGLTKRLAQAASARRACFLPGVANASDIMRGLELGLNRFKFFPAEASGGLKALKALAGPFGDVRFCPTGGITLQSAPEWLAEEAVLCVGGSWLVKPGMSMAEIEAGGRAAAGLSTSGVRSSRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2902330777 Methylobacterium sp. 2A Isolate Unclassified
199 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.18
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 4.72
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10419438 3300005327 Bacteria 1151
2 JGI24740J21852_10010595 3300001979 Bacteria 3542
3 JGI24737J22298_10000861 3300001990 Bacteria 10817
4 JGI24737J22298_10006207 3300001990 Bacteria 4093
5 JGI24737J22298_10019976 3300001990 Bacteria 2141
6 JGI24737J22298_10023861 3300001990 Bacteria 1938
7 JGI24737J22298_10051789 3300001990 Bacteria 1246
8 JGI24735J21928_10002191 3300002067 Bacteria 6864
9 Ga0055536_1001122 3300003781 Bacteria 16825
10 Ga0065707_10138414 3300005295 Bacteria 1806
11 Ga0070658_10000630 3300005327 Bacteria 30439
12 Ga0070658_10013787 3300005327 Bacteria 6486
13 Ga0070658_10047847 3300005327 Bacteria 3461
14 Ga0070658_10054550 3300005327 Bacteria 3245
15 Ga0070658_10059974 3300005327 Bacteria 3098
16 Ga0070658_10251584 3300005327 Bacteria 1499
17 Ga0070658_10300173 3300005327 Bacteria 1369
18 Ga0070658_10608677 3300005327 Bacteria 947
19 Ga0070676_10658391 3300005328 Bacteria 761
20 Ga0070683_100006835 3300005329 Bacteria 9584
21 Ga0070683_100009363 3300005329 Bacteria 8374
22 Ga0070683_100339014 3300005329 Bacteria 1431
23 Ga0070683_100636034 3300005329 Bacteria 1021
24 Ga0070690_100095076 3300005330 Bacteria 1967
25 Ga0070670_100000861 3300005331 Bacteria 23813
26 Ga0070670_100257639 3300005331 Bacteria 1520
27 Ga0070670_100479047 3300005331 Bacteria 1105
28 Ga0070666_10064436 3300005335 Bacteria 2486
29 Ga0070666_10584930 3300005335 Bacteria 814
30 Ga0070680_100041902 3300005336 Bacteria 3713
31 Ga0070680_100298258 3300005336 Bacteria 1366
32 Ga0070680_100504335 3300005336 Bacteria 1035
33 Ga0070682_100010959 3300005337 Bacteria 5166
34 Ga0070682_100057733 3300005337 Bacteria 2446
35 Ga0068868_100016853 3300005338 Bacteria 5435
36 Ga0068868_100358329 3300005338 Bacteria 1251
37 Ga0070660_100000442 3300005339 Bacteria 27575
38 Ga0070660_100015553 3300005339 Bacteria 5497
39 Ga0070660_100068476 3300005339 Bacteria 2767
40 Ga0070660_100070289 3300005339 Bacteria 2732
41 Ga0070660_100244707 3300005339 Bacteria 1461
42 Ga0070660_100256860 3300005339 Bacteria 1426
43 Ga0070660_100540861 3300005339 Bacteria 971
44 Ga0070660_100549894 3300005339 Bacteria 963
45 Ga0070691_10035540 3300005341 Bacteria 2346
46 Ga0070661_100002109 3300005344 Bacteria 13695
47 Ga0070661_100022994 3300005344 Bacteria 4465
48 Ga0070661_100088717 3300005344 Bacteria 2289
49 Ga0070661_100502087 3300005344 Bacteria 971
50 Ga0070692_10007267 3300005345 Bacteria 4871
51 Ga0070692_10018135 3300005345 Bacteria 3379
52 Ga0070669_100050325 3300005353 Bacteria 3043
53 Ga0070671_100000212 3300005355 Bacteria 38767
54 Ga0070671_100075417 3300005355 Bacteria 2817
55 Ga0070671_100687871 3300005355 Bacteria 887
56 Ga0070674_100024518 3300005356 Bacteria 3916
57 Ga0070674_100114778 3300005356 Bacteria 1984
58 Ga0070674_100874203 3300005356 Bacteria 781
59 Ga0070673_100837224 3300005364 Bacteria 851
60 Ga0070659_100000562 3300005366 Bacteria 27149
61 Ga0070659_100004102 3300005366 Bacteria 10381
62 Ga0070659_100149015 3300005366 Bacteria 1908
63 Ga0070659_100247830 3300005366 Bacteria 1476
64 Ga0070667_100061520 3300005367 Bacteria 3179
65 Ga0070714_100096464 3300005435 Bacteria 2598
66 Ga0070714_100333435 3300005435 Bacteria 1421
67 Ga0070714_100513692 3300005435 Bacteria 1144
68 Ga0070713_100005464 3300005436 Bacteria 8689
69 Ga0070694_100574149 3300005444 Bacteria 905
70 Ga0070663_100006017 3300005455 Bacteria 7261
71 Ga0070663_100022498 3300005455 Bacteria 4217
72 Ga0070663_100056429 3300005455 Bacteria 2814
73 Ga0070663_100073354 3300005455 Bacteria 2496
74 Ga0070663_100078478 3300005455 Bacteria 2420
75 Ga0070678_100060365 3300005456 Bacteria 2791
76 Ga0070678_100111919 3300005456 Bacteria 2137
77 Ga0070678_100133046 3300005456 Bacteria 1979
78 Ga0070662_100000517 3300005457 Bacteria 23238
79 Ga0070662_100081959 3300005457 Bacteria 2404
80 Ga0070662_100111692 3300005457 Bacteria 2083
81 Ga0070662_100264710 3300005457 Bacteria 1386
82 Ga0070662_100675255 3300005457 Bacteria 873
83 Ga0070681_10014477 3300005458 Bacteria 7849
84 Ga0070681_10617024 3300005458 Bacteria 999
85 Ga0070681_11007110 3300005458 Bacteria 753
86 Ga0068867_100161276 3300005459 Bacteria 1768
87 Ga0070679_100050650 3300005530 Bacteria 4136
88 Ga0070679_100060807 3300005530 Bacteria 3765
89 Ga0070684_100016193 3300005535 Bacteria 6091
90 Ga0070684_100039389 3300005535 Bacteria 4065
91 Ga0070684_100131010 3300005535 Bacteria 2262
92 Ga0070684_100325536 3300005535 Bacteria 1412
93 Ga0070684_100423805 3300005535 Bacteria 1229
94 Ga0068853_100002857 3300005539 Bacteria 13095
95 Ga0068853_100041288 3300005539 Bacteria 3939
96 Ga0068853_100114769 3300005539 Bacteria 2396
97 Ga0068853_100631521 3300005539 Bacteria 1018
98 Ga0070672_100054322 3300005543 Bacteria 3135
99 Ga0070696_100030089 3300005546 Bacteria 3716
100 Ga0070696_100091154 3300005546 Bacteria 2170
101 Ga0070693_100001280 3300005547 Bacteria 11370
102 Ga0070665_100014619 3300005548 Bacteria 7877
103 Ga0068855_100001245 3300005563 Bacteria 31618
104 Ga0068855_100019215 3300005563 Bacteria 8212
105 Ga0068855_100031932 3300005563 Bacteria 6286
106 Ga0068855_100167223 3300005563 Bacteria 2492
107 Ga0068855_100200708 3300005563 Bacteria 2245
108 Ga0068855_100420416 3300005563 Bacteria 1462
109 Ga0068855_100764860 3300005563 Bacteria 1029
110 Ga0070664_100000197 3300005564 Bacteria 42730
111 Ga0070664_100000609 3300005564 Bacteria 27376
112 Ga0070664_100033595 3300005564 Bacteria 4298
113 Ga0070664_100097595 3300005564 Bacteria 2551
114 Ga0070664_101235488 3300005564 Bacteria 705
115 Ga0068857_100018305 3300005577 Bacteria 6145
116 Ga0068857_100027728 3300005577 Bacteria 4995
117 Ga0068857_100102632 3300005577 Bacteria 2567
118 Ga0068857_100189591 3300005577 Bacteria 1872
119 Ga0068854_100056776 3300005578 Bacteria 2822
120 Ga0068854_100122511 3300005578 Bacteria 1976
121 Ga0068854_100171816 3300005578 Bacteria 1687
122 Ga0068856_100001106 3300005614 Bacteria 28451
123 Ga0068856_100092782 3300005614 Bacteria 3004
124 Ga0068856_100267724 3300005614 Bacteria 1724
125 Ga0068856_100455925 3300005614 Bacteria 1299
126 Ga0068852_100005591 3300005616 Bacteria 9010
127 Ga0068852_100006342 3300005616 Bacteria 8535
128 Ga0068859_100071672 3300005617 Bacteria 3501
129 Ga0068864_100081798 3300005618 Bacteria 2832
130 Ga0068864_100089142 3300005618 Bacteria 2717
131 Ga0068864_100095906 3300005618 Bacteria 2624
132 Ga0068864_100170314 3300005618 Bacteria 1985
133 Ga0068861_100063639 3300005719 Bacteria 2836
134 Ga0068861_100412747 3300005719 Bacteria 1201
135 Ga0068851_10071754 3300005834 Bacteria 1792
136 Ga0068851_10312150 3300005834 Unclassified 906
137 Ga0068863_100005263 3300005841 Bacteria 12773
138 Ga0068863_100008167 3300005841 Bacteria 10224
139 Ga0068863_100169844 3300005841 Bacteria 2091
140 Ga0068858_100026408 3300005842 Bacteria 5396
141 Ga0068862_100014936 3300005844 Bacteria 6450
142 Ga0068862_100154546 3300005844 Bacteria 2044
143 Ga0070717_10007445 3300006028 Bacteria 8134
144 Ga0070712_100423299 3300006175 Bacteria 1104
145 Ga0075366_10088514 3300006195 Bacteria 1854
146 Ga0097621_100161867 3300006237 Bacteria 1924
147 Ga0097621_100193297 3300006237 Bacteria 1763
148 Ga0075370_10017750 3300006353 Bacteria 3848
149 Ga0068871_100386211 3300006358 Bacteria 1244
150 Ga0068871_101357684 3300006358 Bacteria 669
151 Ga0097620_100071672 3300006931 Bacteria 3501
152 Ga0105240_10047336 3300009093 Bacteria 5442
153 Ga0105243_10006820 3300009148 Bacteria 8803
154 Ga0105241_10152944 3300009174 Bacteria 1889
155 Ga0105248_10001053 3300009177 Bacteria 30546
156 Ga0105248_10004465 3300009177 Bacteria 15480
157 Ga0105248_10006788 3300009177 Bacteria 12549
158 Ga0105248_10065486 3300009177 Bacteria 4080
159 Ga0105238_10007921 3300009551 Bacteria 10632
160 Ga0105238_10576866 3300009551 Bacteria 1131
161 Ga0105238_11163269 3300009551 Bacteria 795
162 Ga0157373_10208004 3300013100 Bacteria 1380
163 Ga0157373_10240521 3300013100 Bacteria 1280
164 Ga0157373_10243336 3300013100 Bacteria 1272
165 Ga0157371_10002006 3300013102 Bacteria 20133
166 Ga0157371_10067377 3300013102 Bacteria 2534
167 Ga0157371_10141489 3300013102 Bacteria 1713
168 Ga0157371_10153376 3300013102 Bacteria 1643
169 Ga0157371_10186333 3300013102 Bacteria 1485
170 Ga0157371_10198321 3300013102 Bacteria 1438
171 Ga0157371_10591350 3300013102 Bacteria 825
172 Ga0157369_10015144 3300013105 Bacteria 8703
173 Ga0157369_10247923 3300013105 Bacteria 1859
174 Ga0157374_10043699 3300013296 Bacteria 4141
175 Ga0163162_10127043 3300013306 Bacteria 2657
176 Ga0163162_10145848 3300013306 Bacteria 2483
177 Ga0157372_10493973 3300013307 Bacteria 1427
178 Ga0157372_10746475 3300013307 Bacteria 1138
179 Ga0163163_10002818 3300014325 Bacteria 14707
180 Ga0163163_10011374 3300014325 Bacteria 8066
181 Ga0157379_10719471 3300014968 Bacteria 938
182 Ga0157376_10306596 3300014969 Bacteria 1505
183 Ga0157376_10504281 3300014969 Bacteria 1190
184 Ga0206353_11007205 3300020082 Bacteria 1092
185 Ga0209676_1000174 3300025292 Bacteria 153292
186 Ga0209050_1014337 3300025298 Bacteria 3425
187 Ga0207656_10190927 3300025321 Unclassified 986
188 Ga0207692_10066451 3300025898 Bacteria 1885
189 Ga0207680_10437897 3300025903 Bacteria 927
190 Ga0207647_10005906 3300025904 Bacteria 8926
191 Ga0207647_10020808 3300025904 Bacteria 4392
192 Ga0207647_10024623 3300025904 Bacteria 3967
193 Ga0207647_10053160 3300025904 Bacteria 2497
194 Ga0207647_10144507 3300025904 Bacteria 1393
195 Ga0207645_10023294 3300025907 Bacteria 4025
196 Ga0207705_10002158 3300025909 Bacteria 15247
197 Ga0207705_10007841 3300025909 Bacteria 7840
198 Ga0207705_10019026 3300025909 Bacteria 4912
199 Ga0207705_10020539 3300025909 Bacteria 4716
200 Ga0207705_10037185 3300025909 Bacteria 3483
201 Ga0207705_10042632 3300025909 Bacteria 3258
202 Ga0207705_10048026 3300025909 Bacteria 3070
203 Ga0207705_10099534 3300025909 Bacteria 2138
204 Ga0207705_10112599 3300025909 Bacteria 2012
205 Ga0207705_10350821 3300025909 Bacteria 1137
206 Ga0207654_10209210 3300025911 Bacteria 1288
207 Ga0207707_10383334 3300025912 Bacteria 1208
208 Ga0207695_10089046 3300025913 Bacteria 3105
209 Ga0207693_10397316 3300025915 Bacteria 1078
210 Ga0207660_10022821 3300025917 Bacteria 4219
211 Ga0207660_10051415 3300025917 Bacteria 2929
212 Ga0207660_10069616 3300025917 Bacteria 2556
213 Ga0207660_10223404 3300025917 Bacteria 1479
214 Ga0207657_10001331 3300025919 Bacteria 26231
215 Ga0207657_10002430 3300025919 Bacteria 20114
216 Ga0207657_10006371 3300025919 Bacteria 12259
217 Ga0207657_10024154 3300025919 Bacteria 5641
218 Ga0207657_10024495 3300025919 Bacteria 5584
219 Ga0207657_10067612 3300025919 Bacteria 3038
220 Ga0207657_10136713 3300025919 Bacteria 2005
221 Ga0207657_10275888 3300025919 Bacteria 1336
222 Ga0207649_10000647 3300025920 Bacteria 23229
223 Ga0207649_10003330 3300025920 Bacteria 8793
224 Ga0207649_10069610 3300025920 Bacteria 2241
225 Ga0207649_10207110 3300025920 Bacteria 1389
226 Ga0207649_10760952 3300025920 Unclassified 754
227 Ga0207652_10080168 3300025921 Bacteria 2853
228 Ga0207652_10166008 3300025921 Bacteria 1980
229 Ga0207652_10982148 3300025921 Bacteria 743
230 Ga0207694_10536637 3300025924 Bacteria 981
231 Ga0207650_10011013 3300025925 Bacteria 6218
232 Ga0207650_10125079 3300025925 Bacteria 2006
233 Ga0207650_10634912 3300025925 Bacteria 900
234 Ga0207700_10010571 3300025928 Bacteria 5833
235 Ga0207664_10113835 3300025929 Bacteria 2253
236 Ga0207664_10272360 3300025929 Bacteria 1483
237 Ga0207664_10317733 3300025929 Bacteria 1374
238 Ga0207644_10001984 3300025931 Bacteria 13237
239 Ga0207644_10055230 3300025931 Bacteria 2862
240 Ga0207644_10069945 3300025931 Bacteria 2564
241 Ga0207644_10095664 3300025931 Bacteria 2221
242 Ga0207644_10151152 3300025931 Bacteria 1796
243 Ga0207690_10000282 3300025932 Bacteria 36071
244 Ga0207690_10006224 3300025932 Bacteria 7067
245 Ga0207690_10008641 3300025932 Bacteria 6038
246 Ga0207690_10018402 3300025932 Bacteria 4284
247 Ga0207690_10098876 3300025932 Bacteria 2079
248 Ga0207690_10123015 3300025932 Bacteria 1887
249 Ga0207690_10585213 3300025932 Bacteria 910
250 Ga0207690_10665682 3300025932 Bacteria 854
251 Ga0207706_10000862 3300025933 Bacteria 31208
252 Ga0207706_10020310 3300025933 Bacteria 5970
253 Ga0207706_10051385 3300025933 Bacteria 3640
254 Ga0207706_10076742 3300025933 Bacteria 2939
255 Ga0207706_10203132 3300025933 Bacteria 1738
256 Ga0207706_10388639 3300025933 Bacteria 1210
257 Ga0207706_10569573 3300025933 Bacteria 974
258 Ga0207709_10131159 3300025935 Bacteria 1708
259 Ga0207669_10062765 3300025937 Bacteria 2290
260 Ga0207669_10081344 3300025937 Bacteria 2075
261 Ga0207669_10249184 3300025937 Bacteria 1321
262 Ga0207669_10794421 3300025937 Bacteria 784
263 Ga0207711_10001010 3300025941 Bacteria 26975
264 Ga0207711_10017349 3300025941 Bacteria 5981
265 Ga0207661_10004412 3300025944 Bacteria 9870
266 Ga0207661_10010767 3300025944 Bacteria 6593
267 Ga0207661_10565164 3300025944 Bacteria 1042
268 Ga0207679_10000410 3300025945 Bacteria 30698
269 Ga0207679_10023099 3300025945 Bacteria 4246
270 Ga0207679_10043119 3300025945 Bacteria 3246
271 Ga0207679_10175751 3300025945 Bacteria 1767
272 Ga0207667_10010106 3300025949 Bacteria 11057
273 Ga0207667_10013753 3300025949 Bacteria 9249
274 Ga0207667_10025364 3300025949 Bacteria 6489
275 Ga0207667_10037258 3300025949 Bacteria 5200
276 Ga0207667_10070931 3300025949 Bacteria 3625
277 Ga0207667_10158388 3300025949 Bacteria 2330
278 Ga0207668_10018244 3300025972 Bacteria 4411
279 Ga0207668_10038661 3300025972 Bacteria 3205
280 Ga0207640_10003571 3300025981 Bacteria 8384
281 Ga0207640_10007889 3300025981 Bacteria 5874
282 Ga0207640_10013628 3300025981 Bacteria 4665
283 Ga0207640_10109777 3300025981 Bacteria 1952
284 Ga0207640_10522348 3300025981 Bacteria 992
285 Ga0207658_10012093 3300025986 Bacteria 5888
286 Ga0207658_10056730 3300025986 Bacteria 2908
287 Ga0207677_10016312 3300026023 Bacteria 4394
288 Ga0207677_10534274 3300026023 Bacteria 1019
289 Ga0207703_10054751 3300026035 Bacteria 3245
290 Ga0207703_10782686 3300026035 Bacteria 910
291 Ga0207639_10000559 3300026041 Bacteria 25570
292 Ga0207639_10013015 3300026041 Bacteria 5809
293 Ga0207639_10013772 3300026041 Bacteria 5671
294 Ga0207678_10001544 3300026067 Bacteria 21123
295 Ga0207678_10003972 3300026067 Bacteria 13304
296 Ga0207678_10010774 3300026067 Bacteria 8033
297 Ga0207678_10029549 3300026067 Bacteria 4784
298 Ga0207678_10061939 3300026067 Bacteria 3218
299 Ga0207702_10001481 3300026078 Bacteria 23260
300 Ga0207702_10018723 3300026078 Bacteria 5728
301 Ga0207702_10081838 3300026078 Bacteria 2805
302 Ga0207702_10291019 3300026078 Bacteria 1547
303 Ga0207641_10008619 3300026088 Bacteria 8416
304 Ga0207641_10024772 3300026088 Bacteria 4946
305 Ga0207641_10606430 3300026088 Bacteria 1072
306 Ga0207648_10088759 3300026089 Bacteria 2700
307 Ga0207676_10036654 3300026095 Bacteria 3733
308 Ga0207676_10043838 3300026095 Bacteria 3447
309 Ga0207676_10066220 3300026095 Bacteria 2880
310 Ga0207674_10000616 3300026116 Bacteria 46742
311 Ga0207674_10002953 3300026116 Bacteria 21115
312 Ga0207674_10008170 3300026116 Bacteria 12135
313 Ga0207674_10264773 3300026116 Bacteria 1666
314 Ga0207683_10075961 3300026121 Bacteria 2974
315 Ga0207683_10114746 3300026121 Bacteria 2414
316 Ga0207683_10138502 3300026121 Bacteria 2192
317 Ga0207683_10219426 3300026121 Bacteria 1732
318 Ga0207698_10001123 3300026142 Bacteria 15598
319 Ga0207698_10003822 3300026142 Bacteria 9113
320 Ga0207698_10006404 3300026142 Bacteria 7343
321 Ga0268266_10009063 3300028379 Bacteria 8792
322 Ga0268265_10028011 3300028380 Bacteria 4030
323 Ga0268265_10238792 3300028380 Bacteria 1602
324 Ga0307408_100133159 3300031548 Bacteria 1941
325 Ga0307408_100212336 3300031548 Bacteria 1573
326 Ga0307408_100709836 3300031548 Bacteria 905
327 Ga0307408_100737306 3300031548 Bacteria 889
328 Ga0307413_10002164 3300031824 Bacteria 7895
329 Ga0307413_10075093 3300031824 Bacteria 2144
330 Ga0307410_10035836 3300031852 Bacteria 3226
331 Ga0307410_10070123 3300031852 Bacteria 2426
332 Ga0307406_10011157 3300031901 Bacteria 5091
333 Ga0307407_10035476 3300031903 Bacteria 2740
334 Ga0307407_10213501 3300031903 Bacteria 1300
335 Ga0307407_10296352 3300031903 Bacteria 1126
336 Ga0307412_10084998 3300031911 Bacteria 2198
337 Ga0307412_10179868 3300031911 Bacteria 1589
338 Ga0307412_10325488 3300031911 Bacteria 1225
339 Ga0307409_100043909 3300031995 Bacteria 3361
340 Ga0307409_100104774 3300031995 Bacteria 2356
341 Ga0307409_100190051 3300031995 Bacteria 1827
342 Ga0307416_100015833 3300032002 Bacteria 5221
343 Ga0307416_100067074 3300032002 Bacteria 2957
344 Ga0307416_100214613 3300032002 Bacteria 1839
345 Ga0307416_100408534 3300032002 Bacteria 1398
346 Ga0307416_100508393 3300032002 Bacteria 1270
347 Ga0307414_10034970 3300032004 Bacteria 3338
348 Ga0307414_10084531 3300032004 Bacteria 2334
349 Ga0307414_10123604 3300032004 Bacteria 1994
350 Ga0307414_10238331 3300032004 Bacteria 1504
351 Ga0307414_10685095 3300032004 Bacteria 927
352 Ga0307414_10704711 3300032004 Bacteria 914
353 Ga0307411_10007090 3300032005 Bacteria 5674
354 Ga0307411_10041842 3300032005 Bacteria 2919
355 Ga0307411_10488686 3300032005 Bacteria 1038
356 Ga0307415_100007617 3300032126 Bacteria 5936
357 Ga0307415_100009638 3300032126 Bacteria 5428
358 Ga0307415_100326044 3300032126 Bacteria 1282
359 Ga0373954_0107680 3300035118 Bacteria 1347
360 Ga0373954_0161915 3300035118 Bacteria 1095
361 Ga0373956_0105817 3300035119 Bacteria 1307
362 Ga0373931_0076196 3300035691 Bacteria 1842
363 Ga0373947_0268637 3300035725 Bacteria 1132
364 Ga0395899_0004382 3300037312 Bacteria 11005
365 Ga0395899_0014222 3300037312 Bacteria 6073
366 Ga0395899_0101254 3300037312 Bacteria 2079
367 Ga0395899_0102548 3300037312 Bacteria 2064
368 Ga0395899_0121064 3300037312 Bacteria 1874
369 Ga0395899_0329462 3300037312 Bacteria 1026
370 Ga0395899_0365735 3300037312 Bacteria 961
371 Ga0395899_0535904 3300037312 Bacteria 754
372 Ga0395899_0625366 3300037312 Bacteria 683
373 Ga0395900_0000161 3300037418 Bacteria 110637
374 Ga0395900_0001248 3300037418 Bacteria 31162
375 Ga0395900_0008524 3300037418 Bacteria 10537
376 Ga0395900_0013855 3300037418 Bacteria 8227
377 Ga0395900_0017500 3300037418 Bacteria 7314
378 Ga0395900_0021157 3300037418 Bacteria 6648
379 Ga0395900_0047665 3300037418 Bacteria 4413
380 Ga0395900_0075876 3300037418 Bacteria 3455
381 Ga0395900_0112779 3300037418 Bacteria 2791
382 Ga0395900_0132434 3300037418 Bacteria 2554
383 Ga0395900_0165008 3300037418 Bacteria 2257
384 Ga0395900_0407231 3300037418 Bacteria 1323
385 Ga0395900_0491543 3300037418 Bacteria 1178
386 Ga0395900_0522629 3300037418 Bacteria 1134
387 Ga0395900_0559113 3300037418 Bacteria 1088
388 Ga0395900_0580123 3300037418 Bacteria 1063
389 Ga0395900_0649658 3300037418 Bacteria 991
390 Ga0395900_0742824 3300037418 Bacteria 912
391 Ga0395900_1051188 3300037418 Bacteria 733
392 Ga0395898_0000169 3300037466 Bacteria 168667
393 Ga0395898_0003750 3300037466 Bacteria 16844
394 Ga0395898_0025120 3300037466 Bacteria 6007
395 Ga0395898_0066575 3300037466 Bacteria 3489
396 Ga0395898_0102091 3300037466 Bacteria 2753
397 Ga0395898_0130175 3300037466 Bacteria 2410
398 Ga0395898_0158795 3300037466 Bacteria 2162
399 Ga0395898_0180229 3300037466 Bacteria 2019
400 Ga0395898_0193466 3300037466 Bacteria 1943
401 Ga0395898_0210125 3300037466 Bacteria 1856
402 Ga0395898_0366539 3300037466 Bacteria 1374
403 Ga0395898_0649949 3300037466 Bacteria 997
404 Ga0395898_0728116 3300037466 Bacteria 933
405 Ga0395898_1326591 3300037466 Bacteria 648
406 Ga0395905_0000120 3300037471 Bacteria 130865
407 Ga0395905_0003071 3300037471 Bacteria 18069
408 Ga0395905_0008645 3300037471 Bacteria 10028
409 Ga0395905_0009149 3300037471 Bacteria 9704
410 Ga0395905_0012576 3300037471 Bacteria 8141
411 Ga0395905_0016723 3300037471 Bacteria 6971
412 Ga0395905_0025491 3300037471 Bacteria 5576
413 Ga0395905_0028920 3300037471 Bacteria 5224
414 Ga0395905_0051953 3300037471 Bacteria 3839
415 Ga0395905_0378335 3300037471 Bacteria 1309
416 Ga0395905_0378369 3300037471 Bacteria 1309
417 Ga0395905_0659220 3300037471 Bacteria 948
418 Ga0395905_0712866 3300037471 Bacteria 905
419 Ga0395905_0786328 3300037471 Bacteria 854
420 Ga0395905_0811444 3300037471 Bacteria 838
421 Ga0395905_0999666 3300037471 Bacteria 739
422 Ga0395901_0000440 3300038443 Bacteria 48641
423 Ga0395901_0000871 3300038443 Bacteria 33284
424 Ga0395901_0002925 3300038443 Bacteria 17249
425 Ga0395901_0034478 3300038443 Bacteria 5226
426 Ga0395901_0036662 3300038443 Bacteria 5069
427 Ga0395901_0050420 3300038443 Bacteria 4324
428 Ga0395901_0074231 3300038443 Bacteria 3548
429 Ga0395901_0109132 3300038443 Bacteria 2905
430 Ga0395901_0149375 3300038443 Bacteria 2455
431 Ga0395901_0194760 3300038443 Bacteria 2125
432 Ga0395901_0195174 3300038443 Bacteria 2123
433 Ga0395901_0229751 3300038443 Bacteria 1937
434 Ga0395901_0236766 3300038443 Bacteria 1905
435 Ga0395901_0407806 3300038443 Bacteria 1395
436 Ga0395901_0488434 3300038443 Bacteria 1255
437 Ga0439437_008406 3300042000 Bacteria 1161
438 Ga0439448_0002664 3300042005 Bacteria 4875
439 Ga0439448_0046894 3300042005 Bacteria 1409
440 Ga0439455_0000250 3300042012 Bacteria 6504
441 Ga0439458_0001407 3300042157 Bacteria 6069
442 Ga0466969_0006499 3300044656 Bacteria 6221
443 Ga0466969_0099555 3300044656 Bacteria 1370
444 Ga0466969_0112033 3300044656 Bacteria 1276
445 Ga0466972_0125791 3300044658 Bacteria 1208
446 Ga0466966_0000001 3300044684 Bacteria 410376
447 Ga0466966_0005635 3300044684 Bacteria 8237
448 Ga0466966_0174851 3300044684 Bacteria 1304
449 Ga0466966_0346558 3300044684 Bacteria 893
450 Ga0466961_0012811 3300044693 Bacteria 5368
451 Ga0466961_0015043 3300044693 Bacteria 4967
452 Ga0466961_0021759 3300044693 Bacteria 4126
453 Ga0466961_0027158 3300044693 Bacteria 3680
454 Ga0466961_0049891 3300044693 Bacteria 2674
455 Ga0466961_0056361 3300044693 Bacteria 2504
456 Ga0466963_0000376 3300044694 Bacteria 20368
457 Ga0466963_0015477 3300044694 Bacteria 4725
458 Ga0466963_0058835 3300044694 Bacteria 2564
459 Ga0466963_0066841 3300044694 Bacteria 2412
460 Ga0466963_0134092 3300044694 Bacteria 1712
461 Ga0466964_0009909 3300044706 Bacteria 3591
462 Ga0453684_0668777 3300044712 Bacteria 1131
463 Ga0466971_0009862 3300044719 Bacteria 4171
464 Ga0466971_0120086 3300044719 Bacteria 1216
465 Ga0466971_0135142 3300044719 Bacteria 1147
466 Ga0466968_0017985 3300044735 Bacteria 2832
467 Ga0466970_0122606 3300044765 Bacteria 1424
468 Ga0466970_0377755 3300044765 Bacteria 806
469 Ga0466957_0001292 3300044842 Bacteria 13063
470 Ga0466957_0008412 3300044842 Bacteria 5867
471 Ga0466957_0019930 3300044842 Bacteria 3947
472 Ga0466957_0113758 3300044842 Bacteria 1719
473 Ga0466957_0172004 3300044842 Bacteria 1411
474 Ga0466959_0012534 3300045049 Bacteria 6129
475 Ga0466959_0028162 3300045049 Bacteria 4166
476 Ga0466959_0091306 3300045049 Bacteria 2187
477 Ga0466959_0162486 3300045049 Unclassified 1569
478 Ga0466959_0228686 3300045049 Bacteria 1288
479 Ga0466959_0456350 3300045049 Unclassified 866
480 Ga0466959_0527517 3300045049 Bacteria 797
481 Ga0466958_0002451 3300045836 Bacteria 9315
482 Ga0466958_0012488 3300045836 Bacteria 4814
483 Ga0466958_0221678 3300045836 Bacteria 1206
484 Ga0466958_0328146 3300045836 Bacteria 984
485 Ga0466958_0459587 3300045836 Bacteria 825
486 Ga0466967_0004482 3300045976 Bacteria 9425
487 Ga0466967_0008421 3300045976 Bacteria 7554
488 Ga0466967_0024197 3300045976 Bacteria 4989
489 Ga0466967_0141788 3300045976 Bacteria 2239
490 Ga0466967_0394834 3300045976 Bacteria 1345
491 Ga0495592_0049345 3300046454 Bacteria 3129
492 Ga0495629_0122592 3300046459 Bacteria 1811
493 Ga0495642_0019120 3300046528 Bacteria 2683
494 Ga0495652_0456761 3300046529 Unclassified 893
495 Ga0495587_0398328 3300046536 Bacteria 765
496 Ga0495621_0024360 3300046539 Bacteria 2021
497 Ga0495623_0074703 3300046679 Bacteria 2106
498 Ga0495669_0082446 3300046684 Bacteria 1477
499 Ga0495675_0096961 3300047444 Bacteria 1848
500 Ga0495602_0215538 3300048088 Bacteria 1453
501 Ga0496100_0283339 3300048903 Bacteria 1236
502 Ga0496101_0036570 3300048904 Bacteria 3478
503 Ga0496104_0504276 3300048907 Unclassified 1121
504 Ga0496105_0002812 3300048908 Bacteria 12721
505 Ga0496105_0127153 3300048908 Bacteria 2101
506 Ga0496106_0002604 3300048909 Bacteria 13430
507 Ga0496107_0001029 3300048910 Bacteria 16660
508 Ga0496107_0145732 3300048910 Bacteria 1751
509 Ga0496107_0202561 3300048910 Bacteria 1475
510 Ga0496108_0012750 3300048911 Bacteria 6844
511 Ga0496108_0021183 3300048911 Bacteria 5343
512 Ga0496109_0007723 3300048912 Bacteria 9109
513 Ga0496109_0270313 3300048912 Bacteria 1601
514 Ga0496109_0580910 3300048912 Bacteria 1056
515 Ga0496110_0013374 3300048913 Bacteria 6782
516 Ga0496110_0016223 3300048913 Bacteria 6214
517 Ga0496110_0116614 3300048913 Bacteria 2404
518 Ga0496110_0267952 3300048913 Bacteria 1555
519 Ga0496111_0001644 3300048914 Bacteria 12962
520 Ga0496111_0214929 3300048914 Bacteria 1428
521 Ga0496111_0238720 3300048914 Bacteria 1350
522 Ga0496112_0006093 3300048915 Bacteria 10544
523 Ga0496112_0056417 3300048915 Bacteria 3865
524 Ga0496112_1152934 3300048915 Bacteria 693
525 Ga0496113_0003084 3300048916 Bacteria 9898
526 Ga0496113_0120650 3300048916 Bacteria 2049
527 Ga0496121_0197650 3300048924 Bacteria 1436
528 Ga0501033_0327549 3300049570 Bacteria 1075
529 Ga0501034_0234352 3300049571 Bacteria 1784
530 Ga0501036_0512307 3300049572 Bacteria 998
531 Ga0501037_0108126 3300049573 Bacteria 2004
532 Ga0501038_0149707 3300049574 Bacteria 1903
533 Ga0501043_0295368 3300049579 Bacteria 1239
534 Ga0501047_0007503 3300049581 Bacteria 10264
535 Ga0501047_0220446 3300049581 Bacteria 1753
536 Ga0501073_0011615 3300049589 Bacteria 6435
537 Ga0501074_0308290 3300049590 Bacteria 1124
538 Ga0501207_076968 3300049654 Bacteria 636
539 Ga0501233_086595 3300049668 Bacteria 813
540 Ga0501080_0002552 3300049742 Bacteria 15938
541 Ga0501080_0075326 3300049742 Bacteria 3139
542 Ga0501262_015861 3300049759 Bacteria 993
543 Ga0501035_0009425 3300049822 Bacteria 9077
544 Ga0501044_0072181 3300049823 Bacteria 3510
545 Ga0501044_0363529 3300049823 Bacteria 1365
546 Ga0501082_0059056 3300060353 Bacteria 3305
547 Ga0466962_0004943 3300061719 Bacteria 6411
548 Ga0466962_0066401 3300061719 Bacteria 1722
549 Ga0466962_0138772 3300061719 Bacteria 1177
550 2902334745 2902330777 Bacteria 6395352
551 2919139238 2919138771 Bacteria 5281312
552 Ga0070658_10419438
553 JGI24740J21852_10010595
554 JGI24737J22298_10000861
555 JGI24737J22298_10006207
556 JGI24737J22298_10019976
557 JGI24737J22298_10023861
558 JGI24737J22298_10051789
559 JGI24735J21928_10002191
560 Ga0055536_1001122
561 Ga0065707_10138414
562 Ga0070658_10000630
563 Ga0070658_10013787
564 Ga0070658_10047847
565 Ga0070658_10054550
566 Ga0070658_10059974
567 Ga0070658_10251584
568 Ga0070658_10300173
569 Ga0070658_10608677
570 Ga0070676_10658391
571 Ga0070683_100006835
572 Ga0070683_100009363
573 Ga0070683_100339014
574 Ga0070683_100636034
575 Ga0070690_100095076
576 Ga0070670_100000861
577 Ga0070670_100257639
578 Ga0070670_100479047
579 Ga0070666_10064436
580 Ga0070666_10584930
581 Ga0070680_100041902
582 Ga0070680_100298258
583 Ga0070680_100504335
584 Ga0070682_100010959
585 Ga0070682_100057733
586 Ga0068868_100016853
587 Ga0068868_100358329
588 Ga0070660_100000442
589 Ga0070660_100015553
590 Ga0070660_100068476
591 Ga0070660_100070289
592 Ga0070660_100244707
593 Ga0070660_100256860
594 Ga0070660_100540861
595 Ga0070660_100549894
596 Ga0070691_10035540
597 Ga0070661_100002109
598 Ga0070661_100022994
599 Ga0070661_100088717
600 Ga0070661_100502087
601 Ga0070692_10007267
602 Ga0070692_10018135
603 Ga0070669_100050325
604 Ga0070671_100000212
605 Ga0070671_100075417
606 Ga0070671_100687871
607 Ga0070674_100024518
608 Ga0070674_100114778
609 Ga0070674_100874203
610 Ga0070673_100837224
611 Ga0070659_100000562
612 Ga0070659_100004102
613 Ga0070659_100149015
614 Ga0070659_100247830
615 Ga0070667_100061520
616 Ga0070714_100096464
617 Ga0070714_100333435
618 Ga0070714_100513692
619 Ga0070713_100005464
620 Ga0070694_100574149
621 Ga0070663_100006017
622 Ga0070663_100022498
623 Ga0070663_100056429
624 Ga0070663_100073354
625 Ga0070663_100078478
626 Ga0070678_100060365
627 Ga0070678_100111919
628 Ga0070678_100133046
629 Ga0070662_100000517
630 Ga0070662_100081959
631 Ga0070662_100111692
632 Ga0070662_100264710
633 Ga0070662_100675255
634 Ga0070681_10014477
635 Ga0070681_10617024
636 Ga0070681_11007110
637 Ga0068867_100161276
638 Ga0070679_100050650
639 Ga0070679_100060807
640 Ga0070684_100016193
641 Ga0070684_100039389
642 Ga0070684_100131010
643 Ga0070684_100325536
644 Ga0070684_100423805
645 Ga0068853_100002857
646 Ga0068853_100041288
647 Ga0068853_100114769
648 Ga0068853_100631521
649 Ga0070672_100054322
650 Ga0070696_100030089
651 Ga0070696_100091154
652 Ga0070693_100001280
653 Ga0070665_100014619
654 Ga0068855_100001245
655 Ga0068855_100019215
656 Ga0068855_100031932
657 Ga0068855_100167223
658 Ga0068855_100200708
659 Ga0068855_100420416
660 Ga0068855_100764860
661 Ga0070664_100000197
662 Ga0070664_100000609
663 Ga0070664_100033595
664 Ga0070664_100097595
665 Ga0070664_101235488
666 Ga0068857_100018305
667 Ga0068857_100027728
668 Ga0068857_100102632
669 Ga0068857_100189591
670 Ga0068854_100056776
671 Ga0068854_100122511
672 Ga0068854_100171816
673 Ga0068856_100001106
674 Ga0068856_100092782
675 Ga0068856_100267724
676 Ga0068856_100455925
677 Ga0068852_100005591
678 Ga0068852_100006342
679 Ga0068859_100071672
680 Ga0068864_100081798
681 Ga0068864_100089142
682 Ga0068864_100095906
683 Ga0068864_100170314
684 Ga0068861_100063639
685 Ga0068861_100412747
686 Ga0068851_10071754
687 Ga0068851_10312150
688 Ga0068863_100005263
689 Ga0068863_100008167
690 Ga0068863_100169844
691 Ga0068858_100026408
692 Ga0068862_100014936
693 Ga0068862_100154546
694 Ga0070717_10007445
695 Ga0070712_100423299
696 Ga0075366_10088514
697 Ga0097621_100161867
698 Ga0097621_100193297
699 Ga0075370_10017750
700 Ga0068871_100386211
701 Ga0068871_101357684
702 Ga0097620_100071672
703 Ga0105240_10047336
704 Ga0105243_10006820
705 Ga0105241_10152944
706 Ga0105248_10001053
707 Ga0105248_10004465
708 Ga0105248_10006788
709 Ga0105248_10065486
710 Ga0105238_10007921
711 Ga0105238_10576866
712 Ga0105238_11163269
713 Ga0157373_10208004
714 Ga0157373_10240521
715 Ga0157373_10243336
716 Ga0157371_10002006
717 Ga0157371_10067377
718 Ga0157371_10141489
719 Ga0157371_10153376
720 Ga0157371_10186333
721 Ga0157371_10198321
722 Ga0157371_10591350
723 Ga0157369_10015144
724 Ga0157369_10247923
725 Ga0157374_10043699
726 Ga0163162_10127043
727 Ga0163162_10145848
728 Ga0157372_10493973
729 Ga0157372_10746475
730 Ga0163163_10002818
731 Ga0163163_10011374
732 Ga0157379_10719471
733 Ga0157376_10306596
734 Ga0157376_10504281
735 Ga0206353_11007205
736 Ga0209676_1000174
737 Ga0209050_1014337
738 Ga0207656_10190927
739 Ga0207692_10066451
740 Ga0207680_10437897
741 Ga0207647_10005906
742 Ga0207647_10020808
743 Ga0207647_10024623
744 Ga0207647_10053160
745 Ga0207647_10144507
746 Ga0207645_10023294
747 Ga0207705_10002158
748 Ga0207705_10007841
749 Ga0207705_10019026
750 Ga0207705_10020539
751 Ga0207705_10037185
752 Ga0207705_10042632
753 Ga0207705_10048026
754 Ga0207705_10099534
755 Ga0207705_10112599
756 Ga0207705_10350821
757 Ga0207654_10209210
758 Ga0207707_10383334
759 Ga0207695_10089046
760 Ga0207693_10397316
761 Ga0207660_10022821
762 Ga0207660_10051415
763 Ga0207660_10069616
764 Ga0207660_10223404
765 Ga0207657_10001331
766 Ga0207657_10002430
767 Ga0207657_10006371
768 Ga0207657_10024154
769 Ga0207657_10024495
770 Ga0207657_10067612
771 Ga0207657_10136713
772 Ga0207657_10275888
773 Ga0207649_10000647
774 Ga0207649_10003330
775 Ga0207649_10069610
776 Ga0207649_10207110
777 Ga0207649_10760952
778 Ga0207652_10080168
779 Ga0207652_10166008
780 Ga0207652_10982148
781 Ga0207694_10536637
782 Ga0207650_10011013
783 Ga0207650_10125079
784 Ga0207650_10634912
785 Ga0207700_10010571
786 Ga0207664_10113835
787 Ga0207664_10272360
788 Ga0207664_10317733
789 Ga0207644_10001984
790 Ga0207644_10055230
791 Ga0207644_10069945
792 Ga0207644_10095664
793 Ga0207644_10151152
794 Ga0207690_10000282
795 Ga0207690_10006224
796 Ga0207690_10008641
797 Ga0207690_10018402
798 Ga0207690_10098876
799 Ga0207690_10123015
800 Ga0207690_10585213
801 Ga0207690_10665682
802 Ga0207706_10000862
803 Ga0207706_10020310
804 Ga0207706_10051385
805 Ga0207706_10076742
806 Ga0207706_10203132
807 Ga0207706_10388639
808 Ga0207706_10569573
809 Ga0207709_10131159
810 Ga0207669_10062765
811 Ga0207669_10081344
812 Ga0207669_10249184
813 Ga0207669_10794421
814 Ga0207711_10001010
815 Ga0207711_10017349
816 Ga0207661_10004412
817 Ga0207661_10010767
818 Ga0207661_10565164
819 Ga0207679_10000410
820 Ga0207679_10023099
821 Ga0207679_10043119
822 Ga0207679_10175751
823 Ga0207667_10010106
824 Ga0207667_10013753
825 Ga0207667_10025364
826 Ga0207667_10037258
827 Ga0207667_10070931
828 Ga0207667_10158388
829 Ga0207668_10018244
830 Ga0207668_10038661
831 Ga0207640_10003571
832 Ga0207640_10007889
833 Ga0207640_10013628
834 Ga0207640_10109777
835 Ga0207640_10522348
836 Ga0207658_10012093
837 Ga0207658_10056730
838 Ga0207677_10016312
839 Ga0207677_10534274
840 Ga0207703_10054751
841 Ga0207703_10782686
842 Ga0207639_10000559
843 Ga0207639_10013015
844 Ga0207639_10013772
845 Ga0207678_10001544
846 Ga0207678_10003972
847 Ga0207678_10010774
848 Ga0207678_10029549
849 Ga0207678_10061939
850 Ga0207702_10001481
851 Ga0207702_10018723
852 Ga0207702_10081838
853 Ga0207702_10291019
854 Ga0207641_10008619
855 Ga0207641_10024772
856 Ga0207641_10606430
857 Ga0207648_10088759
858 Ga0207676_10036654
859 Ga0207676_10043838
860 Ga0207676_10066220
861 Ga0207674_10000616
862 Ga0207674_10002953
863 Ga0207674_10008170
864 Ga0207674_10264773
865 Ga0207683_10075961
866 Ga0207683_10114746
867 Ga0207683_10138502
868 Ga0207683_10219426
869 Ga0207698_10001123
870 Ga0207698_10003822
871 Ga0207698_10006404
872 Ga0268266_10009063
873 Ga0268265_10028011
874 Ga0268265_10238792
875 Ga0307408_100133159
876 Ga0307408_100212336
877 Ga0307408_100709836
878 Ga0307408_100737306
879 Ga0307413_10002164
880 Ga0307413_10075093
881 Ga0307410_10035836
882 Ga0307410_10070123
883 Ga0307406_10011157
884 Ga0307407_10035476
885 Ga0307407_10213501
886 Ga0307407_10296352
887 Ga0307412_10084998
888 Ga0307412_10179868
889 Ga0307412_10325488
890 Ga0307409_100043909
891 Ga0307409_100104774
892 Ga0307409_100190051
893 Ga0307416_100015833
894 Ga0307416_100067074
895 Ga0307416_100214613
896 Ga0307416_100408534
897 Ga0307416_100508393
898 Ga0307414_10034970
899 Ga0307414_10084531
900 Ga0307414_10123604
901 Ga0307414_10238331
902 Ga0307414_10685095
903 Ga0307414_10704711
904 Ga0307411_10007090
905 Ga0307411_10041842
906 Ga0307411_10488686
907 Ga0307415_100007617
908 Ga0307415_100009638
909 Ga0307415_100326044
910 Ga0373954_0107680
911 Ga0373954_0161915
912 Ga0373956_0105817
913 Ga0373931_0076196
914 Ga0373947_0268637
915 Ga0395899_0004382
916 Ga0395899_0014222
917 Ga0395899_0101254
918 Ga0395899_0102548
919 Ga0395899_0121064
920 Ga0395899_0329462
921 Ga0395899_0365735
922 Ga0395899_0535904
923 Ga0395899_0625366
924 Ga0395900_0000161
925 Ga0395900_0001248
926 Ga0395900_0008524
927 Ga0395900_0013855
928 Ga0395900_0017500
929 Ga0395900_0021157
930 Ga0395900_0047665
931 Ga0395900_0075876
932 Ga0395900_0112779
933 Ga0395900_0132434
934 Ga0395900_0165008
935 Ga0395900_0407231
936 Ga0395900_0491543
937 Ga0395900_0522629
938 Ga0395900_0559113
939 Ga0395900_0580123
940 Ga0395900_0649658
941 Ga0395900_0742824
942 Ga0395900_1051188
943 Ga0395898_0000169
944 Ga0395898_0003750
945 Ga0395898_0025120
946 Ga0395898_0066575
947 Ga0395898_0102091
948 Ga0395898_0130175
949 Ga0395898_0158795
950 Ga0395898_0180229
951 Ga0395898_0193466
952 Ga0395898_0210125
953 Ga0395898_0366539
954 Ga0395898_0649949
955 Ga0395898_0728116
956 Ga0395898_1326591
957 Ga0395905_0000120
958 Ga0395905_0003071
959 Ga0395905_0008645
960 Ga0395905_0009149
961 Ga0395905_0012576
962 Ga0395905_0016723
963 Ga0395905_0025491
964 Ga0395905_0028920
965 Ga0395905_0051953
966 Ga0395905_0378335
967 Ga0395905_0378369
968 Ga0395905_0659220
969 Ga0395905_0712866
970 Ga0395905_0786328
971 Ga0395905_0811444
972 Ga0395905_0999666
973 Ga0395901_0000440
974 Ga0395901_0000871
975 Ga0395901_0002925
976 Ga0395901_0034478
977 Ga0395901_0036662
978 Ga0395901_0050420
979 Ga0395901_0074231
980 Ga0395901_0109132
981 Ga0395901_0149375
982 Ga0395901_0194760
983 Ga0395901_0195174
984 Ga0395901_0229751
985 Ga0395901_0236766
986 Ga0395901_0407806
987 Ga0395901_0488434
988 Ga0439437_008406
989 Ga0439448_0002664
990 Ga0439448_0046894
991 Ga0439455_0000250
992 Ga0439458_0001407
993 Ga0466969_0006499
994 Ga0466969_0099555
995 Ga0466969_0112033
996 Ga0466972_0125791
997 Ga0466966_0000001
998 Ga0466966_0005635
999 Ga0466966_0174851
1000 Ga0466966_0346558
1001 Ga0466961_0012811
1002 Ga0466961_0015043
1003 Ga0466961_0021759
1004 Ga0466961_0027158
1005 Ga0466961_0049891
1006 Ga0466961_0056361
1007 Ga0466963_0000376
1008 Ga0466963_0015477
1009 Ga0466963_0058835
1010 Ga0466963_0066841
1011 Ga0466963_0134092
1012 Ga0466964_0009909
1013 Ga0453684_0668777
1014 Ga0466971_0009862
1015 Ga0466971_0120086
1016 Ga0466971_0135142
1017 Ga0466968_0017985
1018 Ga0466970_0122606
1019 Ga0466970_0377755
1020 Ga0466957_0001292
1021 Ga0466957_0008412
1022 Ga0466957_0019930
1023 Ga0466957_0113758
1024 Ga0466957_0172004
1025 Ga0466959_0012534
1026 Ga0466959_0028162
1027 Ga0466959_0091306
1028 Ga0466959_0162486
1029 Ga0466959_0228686
1030 Ga0466959_0456350
1031 Ga0466959_0527517
1032 Ga0466958_0002451
1033 Ga0466958_0012488
1034 Ga0466958_0221678
1035 Ga0466958_0328146
1036 Ga0466958_0459587
1037 Ga0466967_0004482
1038 Ga0466967_0008421
1039 Ga0466967_0024197
1040 Ga0466967_0141788
1041 Ga0466967_0394834
1042 Ga0495592_0049345
1043 Ga0495629_0122592
1044 Ga0495642_0019120
1045 Ga0495652_0456761
1046 Ga0495587_0398328
1047 Ga0495621_0024360
1048 Ga0495623_0074703
1049 Ga0495669_0082446
1050 Ga0495675_0096961
1051 Ga0495602_0215538
1052 Ga0496100_0283339
1053 Ga0496101_0036570
1054 Ga0496104_0504276
1055 Ga0496105_0002812
1056 Ga0496105_0127153
1057 Ga0496106_0002604
1058 Ga0496107_0001029
1059 Ga0496107_0145732
1060 Ga0496107_0202561
1061 Ga0496108_0012750
1062 Ga0496108_0021183
1063 Ga0496109_0007723
1064 Ga0496109_0270313
1065 Ga0496109_0580910
1066 Ga0496110_0013374
1067 Ga0496110_0016223
1068 Ga0496110_0116614
1069 Ga0496110_0267952
1070 Ga0496111_0001644
1071 Ga0496111_0214929
1072 Ga0496111_0238720
1073 Ga0496112_0006093
1074 Ga0496112_0056417
1075 Ga0496112_1152934
1076 Ga0496113_0003084
1077 Ga0496113_0120650
1078 Ga0496121_0197650
1079 Ga0501033_0327549
1080 Ga0501034_0234352
1081 Ga0501036_0512307
1082 Ga0501037_0108126
1083 Ga0501038_0149707
1084 Ga0501043_0295368
1085 Ga0501047_0007503
1086 Ga0501047_0220446
1087 Ga0501073_0011615
1088 Ga0501074_0308290
1089 Ga0501207_076968
1090 Ga0501233_086595
1091 Ga0501080_0002552
1092 Ga0501080_0075326
1093 Ga0501262_015861
1094 Ga0501035_0009425
1095 Ga0501044_0072181
1096 Ga0501044_0363529
1097 Ga0501082_0059056
1098 Ga0466962_0004943
1099 Ga0466962_0066401
1100 Ga0466962_0138772
1101 2902334745
1102 2919139238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

4

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bk9-assembly1.cif.gz_C crystal structure of 2-keto-3-deoxy-6-phospho-gluconate aldolase from zymomonas mobilis atcc 29191 0.9767 1 200
5xsf-assembly1.cif.gz_A crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate 0.9762 3 200
1fwr-assembly1.cif.gz_C crystal structure of kdpg aldolase double mutant k133q/t161k 0.9733 1 202
1fwr-assembly1.cif.gz_C crystal structure of kdpg aldolase double mutant k133q/t161k 0.9686 1 202
1eua-assembly1.cif.gz_B schiff base intermediate in kdpg aldolase from escherichia coli 0.964 1 202
ID Description Score Start End Superfamily
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9801 1 200 3.20.20.70
4bk9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9658 1 200 3.20.20.70
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.948 3 202 3.20.20.70
2yw3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9402 5 200 3.20.20.70
1mxsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9345 3 202 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A838VFU6-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9915 1 176 GO:0016829
AF-A0A5D9CB26-F1-model_v4 Bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14, EC 4.1.3.16) 0.9914 1 180 GO:0008675
GO:0008700
AF-B9TC23-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9904 3 201 GO:0008675
AF-A0A7S1E6F6-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9879 26 159 GO:0016829
AF-M2U8X9-F1-model_v4 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) 0.9869 34 200 GO:0008675

Map