F462535

General Info

Members Datasets Scaffolds Average Seq Length
550 216 550 192

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0205264|Ga0495623_0205264_377_1084
Length 235
Sequence MLLLKKREKWRTPSYFGRRSKDEPALYFRRNVAQPAFGAFAEENMAALIDAIDVKRKMFFELENTPFVCLEAEVSTPTARGGQTLVRLKMRNLLTRAVFDKAFKASDRFKEPDLQTVPASYLYSDGSGFHFMDQESFETLTLSGEMIGDALDFIVEGAIIQLHKYNGNPIGLQLPAQVELNVTYTEPGVRGDTSSGSVTKPAKLETGIEIRVPLFIKEGETIKVSTETREFAGRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.09
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10096129 3300005327 Bacteria 2445
2 Ga0070658_10125386 3300005327 Bacteria 2137
3 Ga0070658_10300992 3300005327 Bacteria 1367
4 Ga0070683_100012692 3300005329 Bacteria 7327
5 Ga0070683_100183058 3300005329 Bacteria 1989
6 Ga0070683_100816437 3300005329 Bacteria 894
7 Ga0068869_100215005 3300005334 Unclassified 1521
8 Ga0070666_10365495 3300005335 Unclassified 1034
9 Ga0070680_100111985 3300005336 Bacteria 2272
10 Ga0070680_100283910 3300005336 Bacteria 1403
11 Ga0070680_100549375 3300005336 Bacteria 990
12 Ga0070682_100192845 3300005337 Bacteria 1432
13 Ga0070682_100350424 3300005337 Bacteria 1100
14 Ga0070682_100718222 3300005337 Bacteria 803
15 Ga0068868_100018305 3300005338 Bacteria 5235
16 Ga0068868_100025433 3300005338 Unclassified 4503
17 Ga0068868_100056939 3300005338 Bacteria 3088
18 Ga0070660_100012352 3300005339 Bacteria 6096
19 Ga0070660_100109015 3300005339 Bacteria 2201
20 Ga0070660_100553669 3300005339 Bacteria 960
21 Ga0070691_10417031 3300005341 Bacteria 760
22 Ga0070661_100050669 3300005344 Bacteria 3038
23 Ga0070671_100083926 3300005355 Unclassified 2664
24 Ga0070671_100795194 3300005355 Bacteria 823
25 Ga0070673_100415723 3300005364 Bacteria 1205
26 Ga0070659_100123091 3300005366 Bacteria 2102
27 Ga0070659_100171737 3300005366 Bacteria 1776
28 Ga0070659_100264950 3300005366 Bacteria 1426
29 Ga0070659_100667644 3300005366 Bacteria 897
30 Ga0070659_100757832 3300005366 Unclassified 842
31 Ga0070667_100164689 3300005367 Unclassified 1955
32 Ga0070667_100492363 3300005367 Unclassified 1123
33 Ga0070709_10274811 3300005434 Bacteria 1222
34 Ga0070714_100361174 3300005435 Unclassified 1365
35 Ga0070714_100439412 3300005435 Unclassified 1238
36 Ga0070714_100455506 3300005435 Bacteria 1216
37 Ga0070713_100008610 3300005436 Bacteria 7246
38 Ga0070713_100106403 3300005436 Unclassified 2438
39 Ga0070713_100117802 3300005436 Bacteria 2324
40 Ga0070713_100263601 3300005436 Bacteria 1575
41 Ga0070710_10145406 3300005437 Bacteria 1457
42 Ga0070711_100638954 3300005439 Bacteria 891
43 Ga0070711_100742905 3300005439 Bacteria 829
44 Ga0070663_100019061 3300005455 Bacteria 4513
45 Ga0070663_100071778 3300005455 Bacteria 2520
46 Ga0070663_100111641 3300005455 Bacteria 2055
47 Ga0070663_100447996 3300005455 Bacteria 1063
48 Ga0070678_100228113 3300005456 Bacteria 1551
49 Ga0070681_10001115 3300005458 Bacteria 23009
50 Ga0070681_10046656 3300005458 Bacteria 4331
51 Ga0070681_10115114 3300005458 Bacteria 2627
52 Ga0070681_10211333 3300005458 Bacteria 1856
53 Ga0070681_10262062 3300005458 Bacteria 1640
54 Ga0070681_10348103 3300005458 Unclassified 1392
55 Ga0070681_10488115 3300005458 Unclassified 1145
56 Ga0070681_10909452 3300005458 Unclassified 798
57 Ga0070681_11054945 3300005458 Bacteria 733
58 Ga0070698_100540179 3300005471 Unclassified 1105
59 Ga0070699_100213668 3300005518 Bacteria 1718
60 Ga0070679_100076631 3300005530 Unclassified 3333
61 Ga0070679_100185260 3300005530 Bacteria 2053
62 Ga0070679_100193631 3300005530 Bacteria 2001
63 Ga0070679_100224303 3300005530 Bacteria 1840
64 Ga0070679_100517805 3300005530 Bacteria 1137
65 Ga0070684_100028880 3300005535 Bacteria 4694
66 Ga0070684_100260595 3300005535 Bacteria 1586
67 Ga0070684_101235392 3300005535 Bacteria 703
68 Ga0070697_100268373 3300005536 Bacteria 1462
69 Ga0068853_100005299 3300005539 Bacteria 10092
70 Ga0068853_100014854 3300005539 Bacteria 6394
71 Ga0068853_100306795 3300005539 Bacteria 1468
72 Ga0068853_100724190 3300005539 Unclassified 950
73 Ga0070693_100009529 3300005547 Bacteria 4830
74 Ga0070693_100481831 3300005547 Unclassified 876
75 Ga0070665_100162498 3300005548 Unclassified 2235
76 Ga0070665_100217052 3300005548 Bacteria 1913
77 Ga0070665_101055446 3300005548 Unclassified 824
78 Ga0068855_100003377 3300005563 Bacteria 19556
79 Ga0068855_100006382 3300005563 Bacteria 14369
80 Ga0068855_100008015 3300005563 Bacteria 12760
81 Ga0068855_100017513 3300005563 Bacteria 8615
82 Ga0068855_100022876 3300005563 Bacteria 7491
83 Ga0068855_100045145 3300005563 Bacteria 5212
84 Ga0068855_100049988 3300005563 Bacteria 4929
85 Ga0068855_100182493 3300005563 Unclassified 2372
86 Ga0068855_100188211 3300005563 Unclassified 2330
87 Ga0068855_100312225 3300005563 Bacteria 1739
88 Ga0068855_100369326 3300005563 Bacteria 1577
89 Ga0068855_100461176 3300005563 Unclassified 1385
90 Ga0068855_100514980 3300005563 Bacteria 1299
91 Ga0068855_100719482 3300005563 Bacteria 1067
92 Ga0070664_100057380 3300005564 Unclassified 3309
93 Ga0068857_100016775 3300005577 Bacteria 6416
94 Ga0068857_100019955 3300005577 Bacteria 5891
95 Ga0068857_100038886 3300005577 Bacteria 4212
96 Ga0068857_100367750 3300005577 Bacteria 1334
97 Ga0068854_100011918 3300005578 Bacteria 5681
98 Ga0068854_100270563 3300005578 Bacteria 1364
99 Ga0068854_100566346 3300005578 Bacteria 966
100 Ga0068854_100879883 3300005578 Bacteria 786
101 Ga0068854_101068120 3300005578 Bacteria 718
102 Ga0068856_100002791 3300005614 Bacteria 17875
103 Ga0068856_100048003 3300005614 Bacteria 4207
104 Ga0068856_100461216 3300005614 Bacteria 1291
105 Ga0068856_100934647 3300005614 Bacteria 886
106 Ga0068856_101154023 3300005614 Bacteria 791
107 Ga0068856_101171713 3300005614 Unclassified 785
108 Ga0068852_100017305 3300005616 Bacteria 5651
109 Ga0068852_100024157 3300005616 Unclassified 4908
110 Ga0068852_100057574 3300005616 Bacteria 3363
111 Ga0068852_100143069 3300005616 Bacteria 2215
112 Ga0068852_100163224 3300005616 Bacteria 2082
113 Ga0068866_10063458 3300005718 Unclassified 1926
114 Ga0068851_10011738 3300005834 Bacteria 4114
115 Ga0068851_10145946 3300005834 Bacteria 1290
116 Ga0068863_100026223 3300005841 Bacteria 5561
117 Ga0068863_100036145 3300005841 Bacteria 4705
118 Ga0068863_100162797 3300005841 Bacteria 2138
119 Ga0068863_100892650 3300005841 Bacteria 889
120 Ga0068858_100041407 3300005842 Bacteria 4271
121 Ga0068858_100178742 3300005842 Unclassified 2003
122 Ga0068858_100519795 3300005842 Unclassified 1151
123 Ga0068858_100824380 3300005842 Bacteria 905
124 Ga0068860_100317661 3300005843 Bacteria 1528
125 Ga0070717_10002732 3300006028 Bacteria 12463
126 Ga0070716_100530882 3300006173 Bacteria 874
127 Ga0070712_100152637 3300006175 Unclassified 1775
128 Ga0070712_100566923 3300006175 Unclassified 958
129 Ga0097621_100001290 3300006237 Bacteria 17232
130 Ga0097621_100053238 3300006237 Bacteria 3299
131 Ga0097621_100059655 3300006237 Unclassified 3125
132 Ga0097621_100243395 3300006237 Bacteria 1573
133 Ga0068871_100059729 3300006358 Unclassified 3108
134 Ga0068871_100189941 3300006358 Bacteria 1769
135 Ga0068871_100227941 3300006358 Bacteria 1616
136 Ga0068871_100229422 3300006358 Bacteria 1611
137 Ga0068871_100351060 3300006358 Bacteria 1305
138 Ga0075434_100957540 3300006871 Unclassified 870
139 Ga0068865_100037157 3300006881 Bacteria 3287
140 Ga0099795_10173912 3300007788 Bacteria 896
141 Ga0105240_10010798 3300009093 Bacteria 12797
142 Ga0105240_10011435 3300009093 Bacteria 12363
143 Ga0105240_10015786 3300009093 Bacteria 10248
144 Ga0105240_10026891 3300009093 Bacteria 7545
145 Ga0105240_10038651 3300009093 Bacteria 6120
146 Ga0105240_10133041 3300009093 Bacteria 2981
147 Ga0105240_10161890 3300009093 Bacteria 2657
148 Ga0105240_10262856 3300009093 Bacteria 1990
149 Ga0105240_10584041 3300009093 Bacteria 1232
150 Ga0105240_10609269 3300009093 Bacteria 1201
151 Ga0105240_11480975 3300009093 Unclassified 712
152 Ga0105245_10004706 3300009098 Bacteria 12061
153 Ga0105245_10031974 3300009098 Bacteria 4659
154 Ga0105245_10071470 3300009098 Bacteria 3151
155 Ga0105247_10106250 3300009101 Unclassified 1801
156 Ga0105243_10058162 3300009148 Bacteria 3080
157 Ga0105241_10000146 3300009174 Bacteria 50607
158 Ga0105241_10011226 3300009174 Bacteria 6567
159 Ga0105241_10018317 3300009174 Bacteria 5151
160 Ga0105241_10076731 3300009174 Unclassified 2607
161 Ga0105241_10094492 3300009174 Bacteria 2365
162 Ga0105241_10110363 3300009174 Bacteria 2200
163 Ga0105241_10177930 3300009174 Bacteria 1762
164 Ga0105241_10218236 3300009174 Bacteria 1601
165 Ga0105242_10014183 3300009176 Bacteria 6171
166 Ga0105242_10349732 3300009176 Unclassified 1365
167 Ga0105242_10371349 3300009176 Unclassified 1327
168 Ga0105242_10786678 3300009176 Unclassified 940
169 Ga0105242_11119857 3300009176 Unclassified 802
170 Ga0105248_10000019 3300009177 Bacteria 285766
171 Ga0105248_10002961 3300009177 Bacteria 18814
172 Ga0105248_10033566 3300009177 Bacteria 5733
173 Ga0105248_10042059 3300009177 Bacteria 5125
174 Ga0105248_10054712 3300009177 Bacteria 4476
175 Ga0105248_10237838 3300009177 Unclassified 2050
176 Ga0105248_10283413 3300009177 Bacteria 1865
177 Ga0105248_10608170 3300009177 Bacteria 1233
178 Ga0105237_10095623 3300009545 Bacteria 2960
179 Ga0105237_10111838 3300009545 Bacteria 2723
180 Ga0105237_10147252 3300009545 Bacteria 2350
181 Ga0105237_10219343 3300009545 Unclassified 1902
182 Ga0105237_10393034 3300009545 Bacteria 1391
183 Ga0105237_10438076 3300009545 Bacteria 1312
184 Ga0105237_10929626 3300009545 Bacteria 877
185 Ga0105237_11285368 3300009545 Bacteria 738
186 Ga0105237_11437937 3300009545 Unclassified 696
187 Ga0105238_10012438 3300009551 Bacteria 8584
188 Ga0105238_10027728 3300009551 Bacteria 5773
189 Ga0105238_10027782 3300009551 Bacteria 5766
190 Ga0105238_10053044 3300009551 Bacteria 4075
191 Ga0105238_10059896 3300009551 Unclassified 3813
192 Ga0105238_10088539 3300009551 Bacteria 3082
193 Ga0105238_10125337 3300009551 Bacteria 2547
194 Ga0105238_10274641 3300009551 Bacteria 1666
195 Ga0105238_10874615 3300009551 Bacteria 916
196 Ga0105238_11915993 3300009551 Bacteria 626
197 Ga0105239_10012806 3300010375 Bacteria 9331
198 Ga0105239_10031460 3300010375 Bacteria 5835
199 Ga0105239_10033892 3300010375 Bacteria 5605
200 Ga0105239_10063854 3300010375 Bacteria 4042
201 Ga0105239_10113203 3300010375 Unclassified 3009
202 Ga0105239_10147049 3300010375 Unclassified 2629
203 Ga0105239_11326304 3300010375 Bacteria 830
204 Ga0105239_11504950 3300010375 Unclassified 778
205 Ga0157373_10088355 3300013100 Bacteria 2183
206 Ga0157371_10064445 3300013102 Bacteria 2596
207 Ga0157370_10015391 3300013104 Bacteria 7774
208 Ga0157370_10036212 3300013104 Bacteria 4790
209 Ga0157370_10036704 3300013104 Bacteria 4754
210 Ga0157370_10043087 3300013104 Bacteria 4345
211 Ga0157370_10051095 3300013104 Bacteria 3949
212 Ga0157370_10071115 3300013104 Bacteria 3283
213 Ga0157370_10096055 3300013104 Bacteria 2780
214 Ga0157370_10237501 3300013104 Bacteria 1687
215 Ga0157370_10376726 3300013104 Bacteria 1307
216 Ga0157370_11012827 3300013104 Bacteria 752
217 Ga0157370_11108174 3300013104 Bacteria 715
218 Ga0157369_10001300 3300013105 Bacteria 31037
219 Ga0157369_10015873 3300013105 Bacteria 8481
220 Ga0157369_10021067 3300013105 Bacteria 7288
221 Ga0157369_10050642 3300013105 Bacteria 4496
222 Ga0157369_10085700 3300013105 Bacteria 3366
223 Ga0157369_10164312 3300013105 Bacteria 2342
224 Ga0157369_10292098 3300013105 Unclassified 1697
225 Ga0157369_10372273 3300013105 Bacteria 1483
226 Ga0157369_10379678 3300013105 Bacteria 1467
227 Ga0157369_11022876 3300013105 Bacteria 846
228 Ga0157369_11123791 3300013105 Bacteria 803
229 Ga0157369_11662532 3300013105 Bacteria 649
230 Ga0157374_10006059 3300013296 Bacteria 10235
231 Ga0157374_10014501 3300013296 Bacteria 6897
232 Ga0157374_10056732 3300013296 Unclassified 3657
233 Ga0157374_10065905 3300013296 Bacteria 3403
234 Ga0157374_10133160 3300013296 Bacteria 2407
235 Ga0157374_10984309 3300013296 Bacteria 862
236 Ga0157378_10000160 3300013297 Bacteria 63958
237 Ga0157378_10057625 3300013297 Bacteria 3463
238 Ga0157378_10082690 3300013297 Unclassified 2904
239 Ga0163162_10003329 3300013306 Bacteria 15376
240 Ga0163162_10051839 3300013306 Bacteria 4119
241 Ga0163162_10055653 3300013306 Unclassified 3984
242 Ga0163162_10086083 3300013306 Unclassified 3220
243 Ga0163162_10165216 3300013306 Unclassified 2337
244 Ga0163162_11375150 3300013306 Bacteria 803
245 Ga0157372_10003405 3300013307 Bacteria 17169
246 Ga0157372_10012941 3300013307 Bacteria 8895
247 Ga0157372_10092084 3300013307 Bacteria 3448
248 Ga0157372_10136782 3300013307 Bacteria 2822
249 Ga0157372_10167467 3300013307 Unclassified 2541
250 Ga0157372_10326891 3300013307 Bacteria 1785
251 Ga0157372_10419308 3300013307 Bacteria 1560
252 Ga0157372_10520001 3300013307 Bacteria 1387
253 Ga0157372_10605477 3300013307 Bacteria 1277
254 Ga0157372_10618022 3300013307 Unclassified 1263
255 Ga0157375_10035479 3300013308 Bacteria 4761
256 Ga0157375_10044239 3300013308 Bacteria 4324
257 Ga0157375_10231354 3300013308 Bacteria 2007
258 Ga0157375_10615922 3300013308 Unclassified 1244
259 Ga0163163_10039007 3300014325 Bacteria 4633
260 Ga0163163_10119914 3300014325 Bacteria 2664
261 Ga0157380_10602108 3300014326 Bacteria 1087
262 Ga0157379_10094376 3300014968 Bacteria 2684
263 Ga0157379_10519370 3300014968 Unclassified 1105
264 Ga0157379_11442008 3300014968 Bacteria 668
265 Ga0157376_10005077 3300014969 Bacteria 9180
266 Ga0157376_10009944 3300014969 Bacteria 6939
267 Ga0157376_10017421 3300014969 Bacteria 5480
268 Ga0157376_10071562 3300014969 Unclassified 2947
269 Ga0157376_10368740 3300014969 Bacteria 1379
270 Ga0157376_10810767 3300014969 Unclassified 949
271 Ga0224569_103564 3300022732 Bacteria 1214
272 Ga0228598_1001829 3300024227 Bacteria 4628
273 Ga0207692_10081110 3300025898 Bacteria 1735
274 Ga0207642_10054770 3300025899 Bacteria 1821
275 Ga0207710_10259056 3300025900 Bacteria 871
276 Ga0207647_10001933 3300025904 Bacteria 15834
277 Ga0207647_10006057 3300025904 Bacteria 8814
278 Ga0207685_10255223 3300025905 Bacteria 850
279 Ga0207699_10202067 3300025906 Bacteria 1347
280 Ga0207699_10305092 3300025906 Unclassified 1113
281 Ga0207699_10469559 3300025906 Bacteria 905
282 Ga0207705_10000171 3300025909 Bacteria 69439
283 Ga0207705_10000405 3300025909 Bacteria 37816
284 Ga0207705_10107734 3300025909 Bacteria 2056
285 Ga0207705_10274159 3300025909 Bacteria 1290
286 Ga0207654_10015153 3300025911 Bacteria 3994
287 Ga0207654_10015292 3300025911 Unclassified 3980
288 Ga0207654_10123633 3300025911 Bacteria 1628
289 Ga0207654_10258486 3300025911 Bacteria 1170
290 Ga0207707_10025388 3300025912 Bacteria 5184
291 Ga0207707_10050158 3300025912 Bacteria 3636
292 Ga0207707_10104691 3300025912 Bacteria 2473
293 Ga0207707_10159542 3300025912 Bacteria 1972
294 Ga0207707_10366027 3300025912 Bacteria 1241
295 Ga0207707_10810557 3300025912 Bacteria 779
296 Ga0207707_10910697 3300025912 Unclassified 726
297 Ga0207695_10000341 3300025913 Bacteria 109857
298 Ga0207695_10008580 3300025913 Bacteria 12771
299 Ga0207695_10016432 3300025913 Bacteria 8659
300 Ga0207695_10032214 3300025913 Bacteria 5739
301 Ga0207695_10115327 3300025913 Bacteria 2661
302 Ga0207695_10116452 3300025913 Bacteria 2646
303 Ga0207695_10184092 3300025913 Unclassified 2009
304 Ga0207695_10332490 3300025913 Bacteria 1408
305 Ga0207695_10456597 3300025913 Bacteria 1161
306 Ga0207695_10469742 3300025913 Unclassified 1140
307 Ga0207695_10605886 3300025913 Unclassified 976
308 Ga0207671_10050120 3300025914 Bacteria 3091
309 Ga0207671_10316558 3300025914 Unclassified 1234
310 Ga0207671_10368908 3300025914 Unclassified 1140
311 Ga0207693_10022454 3300025915 Bacteria 5014
312 Ga0207693_10360371 3300025915 Unclassified 1138
313 Ga0207693_10364286 3300025915 Unclassified 1131
314 Ga0207660_10128835 3300025917 Bacteria 1924
315 Ga0207660_10832319 3300025917 Bacteria 753
316 Ga0207657_10000747 3300025919 Bacteria 34417
317 Ga0207657_10001086 3300025919 Bacteria 28797
318 Ga0207652_10065014 3300025921 Unclassified 3157
319 Ga0207652_10183091 3300025921 Bacteria 1883
320 Ga0207652_10216137 3300025921 Bacteria 1727
321 Ga0207652_10429601 3300025921 Bacteria 1191
322 Ga0207694_10003332 3300025924 Bacteria 12775
323 Ga0207694_10005586 3300025924 Bacteria 9640
324 Ga0207694_10033987 3300025924 Bacteria 3908
325 Ga0207694_10080152 3300025924 Bacteria 2562
326 Ga0207694_10225722 3300025924 Bacteria 1528
327 Ga0207694_10372767 3300025924 Unclassified 1184
328 Ga0207650_10680618 3300025925 Unclassified 868
329 Ga0207659_10544789 3300025926 Bacteria 986
330 Ga0207687_10006394 3300025927 Bacteria 7786
331 Ga0207687_10014284 3300025927 Bacteria 5196
332 Ga0207687_10080839 3300025927 Bacteria 2347
333 Ga0207687_10680786 3300025927 Bacteria 872
334 Ga0207700_10012412 3300025928 Bacteria 5494
335 Ga0207700_10083160 3300025928 Bacteria 2505
336 Ga0207700_10111020 3300025928 Unclassified 2206
337 Ga0207700_10243763 3300025928 Bacteria 1533
338 Ga0207700_10383571 3300025928 Bacteria 1229
339 Ga0207700_10923409 3300025928 Bacteria 781
340 Ga0207664_10005557 3300025929 Bacteria 8631
341 Ga0207664_10744983 3300025929 Unclassified 881
342 Ga0207644_11205604 3300025931 Bacteria 636
343 Ga0207690_10388746 3300025932 Bacteria 1110
344 Ga0207704_10104688 3300025938 Bacteria 1896
345 Ga0207665_10039607 3300025939 Bacteria 3142
346 Ga0207665_10418297 3300025939 Unclassified 1023
347 Ga0207711_10000014 3300025941 Bacteria 506753
348 Ga0207711_10007356 3300025941 Bacteria 9216
349 Ga0207711_10064945 3300025941 Unclassified 3153
350 Ga0207711_10080562 3300025941 Bacteria 2844
351 Ga0207711_10133977 3300025941 Bacteria 2224
352 Ga0207711_10194195 3300025941 Bacteria 1851
353 Ga0207711_10221797 3300025941 Bacteria 1729
354 Ga0207711_10412578 3300025941 Bacteria 1255
355 Ga0207689_10235772 3300025942 Unclassified 1512
356 Ga0207661_10063760 3300025944 Bacteria 2985
357 Ga0207661_10209450 3300025944 Unclassified 1717
358 Ga0207661_10246960 3300025944 Bacteria 1585
359 Ga0207661_11212151 3300025944 Bacteria 694
360 Ga0207679_10638257 3300025945 Bacteria 962
361 Ga0207679_11099786 3300025945 Bacteria 729
362 Ga0207667_10006944 3300025949 Bacteria 13682
363 Ga0207667_10011261 3300025949 Bacteria 10405
364 Ga0207667_10016174 3300025949 Bacteria 8437
365 Ga0207667_10021169 3300025949 Bacteria 7211
366 Ga0207667_10028898 3300025949 Bacteria 6019
367 Ga0207667_10037861 3300025949 Bacteria 5155
368 Ga0207667_10090807 3300025949 Bacteria 3156
369 Ga0207667_10095983 3300025949 Bacteria 3060
370 Ga0207667_10147997 3300025949 Unclassified 2417
371 Ga0207667_11283702 3300025949 Bacteria 709
372 Ga0207640_10099216 3300025981 Bacteria 2038
373 Ga0207640_10710977 3300025981 Bacteria 862
374 Ga0207658_10492287 3300025986 Unclassified 1091
375 Ga0207677_10002246 3300026023 Bacteria 10141
376 Ga0207703_10108100 3300026035 Unclassified 2369
377 Ga0207703_10248522 3300026035 Unclassified 1602
378 Ga0207639_10160022 3300026041 Bacteria 1896
379 Ga0207639_10387347 3300026041 Bacteria 1256
380 Ga0207678_10004895 3300026067 Bacteria 12032
381 Ga0207678_10178103 3300026067 Bacteria 1815
382 Ga0207678_10230314 3300026067 Bacteria 1586
383 Ga0207702_10014192 3300026078 Bacteria 6617
384 Ga0207702_10040028 3300026078 Bacteria 3929
385 Ga0207702_10160057 3300026078 Bacteria 2055
386 Ga0207702_10241855 3300026078 Bacteria 1691
387 Ga0207702_10738561 3300026078 Bacteria 971
388 Ga0207641_10023997 3300026088 Bacteria 5026
389 Ga0207641_10996478 3300026088 Bacteria 834
390 Ga0207648_10005760 3300026089 Bacteria 12416
391 Ga0207676_10453403 3300026095 Bacteria 1209
392 Ga0207674_10004620 3300026116 Bacteria 16522
393 Ga0207674_10017687 3300026116 Bacteria 7769
394 Ga0207674_10090366 3300026116 Bacteria 3054
395 Ga0207674_10214834 3300026116 Unclassified 1872
396 Ga0207674_10439429 3300026116 Unclassified 1261
397 Ga0207674_10465681 3300026116 Bacteria 1222
398 Ga0207698_10021915 3300026142 Bacteria 4428
399 Ga0207698_10107624 3300026142 Unclassified 2328
400 Ga0207698_10465141 3300026142 Unclassified 1224
401 Ga0207698_10625926 3300026142 Bacteria 1063
402 Ga0265356_1000302 3300028017 Bacteria 9176
403 Ga0265356_1011454 3300028017 Unclassified 981
404 Ga0268266_10003436 3300028379 Bacteria 15814
405 Ga0268266_10009972 3300028379 Bacteria 8339
406 Ga0268266_10986024 3300028379 Unclassified 815
407 Ga0268264_10270230 3300028381 Bacteria 1588
408 Ga0265336_10001137 3300028666 Bacteria 12751
409 Ga0265338_10008940 3300028800 Unclassified 12047
410 Ga0265338_10092996 3300028800 Bacteria 2486
411 Ga0265338_10109318 3300028800 Bacteria 2231
412 Ga0265338_10460505 3300028800 Bacteria 899
413 Ga0265760_10000069 3300031090 Bacteria 27891
414 Ga0265330_10003141 3300031235 Bacteria 8747
415 Ga0265325_10037564 3300031241 Bacteria 2560
416 Ga0265339_10078050 3300031249 Bacteria 1754
417 Ga0265339_10092099 3300031249 Bacteria 1587
418 Ga0265339_10108942 3300031249 Bacteria 1435
419 Ga0265339_10230869 3300031249 Bacteria 902
420 Ga0265316_10003667 3300031344 Bacteria 15468
421 Ga0265316_10053544 3300031344 Bacteria 3161
422 Ga0265316_10337998 3300031344 Unclassified 1092
423 Ga0265314_10001685 3300031711 Bacteria 24061
424 Ga0265314_10128441 3300031711 Bacteria 1584
425 Ga0265342_10056368 3300031712 Bacteria 2329
426 Ga0307510_10124214 3300033180 Bacteria 2276
427 Ga0307510_10412711 3300033180 Unclassified 793
428 Ga0373926_0036389 3300035083 Bacteria 1748
429 Ga0373934_0086161 3300035086 Unclassified 1264
430 Ga0373923_0313940 3300035111 Bacteria 744
431 Ga0373936_0017444 3300035113 Bacteria 2764
432 Ga0373945_0086577 3300035116 Bacteria 1207
433 Ga0373956_0212001 3300035119 Bacteria 919
434 Ga0373943_0009262 3300035170 Bacteria 4413
435 Ga0373946_0002854 3300035171 Bacteria 6122
436 Ga0373955_0116531 3300035172 Bacteria 1549
437 Ga0373924_0000972 3300035410 Bacteria 9074
438 Ga0373924_0057884 3300035410 Bacteria 1617
439 Ga0373924_0125259 3300035410 Bacteria 1116
440 Ga0373935_0011531 3300035692 Bacteria 5306
441 Ga0373935_0023382 3300035692 Bacteria 3798
442 Ga0373935_0583670 3300035692 Bacteria 816
443 Ga0373927_0012566 3300035695 Bacteria 5637
444 Ga0373927_0055229 3300035695 Bacteria 2568
445 Ga0373947_0020567 3300035725 Bacteria 3811
446 Ga0373937_0000390 3300036401 Bacteria 40856
447 Ga0373937_0007774 3300036401 Bacteria 9297
448 Ga0373937_0035383 3300036401 Unclassified 4546
449 Ga0373937_1073251 3300036401 Unclassified 754
450 Ga0373925_0010808 3300037068 Bacteria 6619
451 Ga0373925_0067665 3300037068 Unclassified 2694
452 Ga0373925_0693500 3300037068 Unclassified 839
453 Ga0373925_0890593 3300037068 Bacteria 733
454 Ga0395898_0030053 3300037466 Bacteria 5440
455 Ga0436361_0519733 3300039447 Bacteria 1204
456 Ga0436361_0663741 3300039447 Bacteria 2173
457 Ga0436362_0554140 3300039453 Bacteria 697
458 Ga0451577_0062378 3300042876 Bacteria 3324
459 Ga0451577_0123286 3300042876 Bacteria 2321
460 Ga0453683_0055465 3300044673 Bacteria 2480
461 Ga0453683_0099833 3300044673 Bacteria 1822
462 Ga0466963_0002421 3300044694 Bacteria 10434
463 Ga0466963_0102992 3300044694 Unclassified 1955
464 Ga0453684_0410582 3300044712 Bacteria 1514
465 Ga0466957_0000242 3300044842 Bacteria 26107
466 Ga0466957_0061703 3300044842 Unclassified 2302
467 Ga0451576_0100969 3300045051 Bacteria 3000
468 Ga0451576_0504139 3300045051 Bacteria 1271
469 Ga0451576_0643324 3300045051 Bacteria 1114
470 Ga0466958_0104949 3300045836 Unclassified 1760
471 Ga0466967_0002153 3300045976 Bacteria 12094
472 Ga0466967_0312665 3300045976 Bacteria 1513
473 Ga0495592_0063194 3300046454 Bacteria 2716
474 Ga0495651_0011687 3300046462 Bacteria 6750
475 Ga0495651_0097452 3300046462 Unclassified 2196
476 Ga0495650_0003916 3300046471 Bacteria 10507
477 Ga0495580_0068474 3300046472 Bacteria 2482
478 Ga0495580_0273218 3300046472 Bacteria 1154
479 Ga0495580_0330751 3300046472 Unclassified 1035
480 Ga0495605_0201547 3300046474 Unclassified 867
481 Ga0495639_0043211 3300046475 Unclassified 2035
482 Ga0495664_0011290 3300046477 Bacteria 5033
483 Ga0495584_0258123 3300046491 Bacteria 886
484 Ga0495585_0013633 3300046492 Bacteria 4752
485 Ga0495596_0083431 3300046500 Bacteria 1241
486 Ga0495608_0148419 3300046511 Bacteria 1495
487 Ga0495620_0286697 3300046515 Bacteria 626
488 Ga0495628_0205442 3300046516 Bacteria 1483
489 Ga0495628_0298624 3300046516 Bacteria 1193
490 Ga0495630_0126059 3300046517 Bacteria 1943
491 Ga0495631_0031431 3300046518 Bacteria 2402
492 Ga0495632_0028004 3300046519 Bacteria 2944
493 Ga0495644_0000001 3300046523 Bacteria 229227
494 Ga0495648_0222508 3300046524 Unclassified 930
495 Ga0495642_0008687 3300046528 Bacteria 3882
496 Ga0495652_0095944 3300046529 Bacteria 2416
497 Ga0495587_0155009 3300046536 Bacteria 1305
498 Ga0495645_0019022 3300046543 Bacteria 4943
499 Ga0495633_0016264 3300046558 Bacteria 3842
500 Ga0495668_0005181 3300046616 Bacteria 8951
501 Ga0495634_0246115 3300046642 Bacteria 1095
502 Ga0495611_0003508 3300046648 Bacteria 6904
503 Ga0495625_0002024 3300046660 Bacteria 22832
504 Ga0495625_0026462 3300046660 Bacteria 4383
505 Ga0495625_0063401 3300046660 Unclassified 2610
506 Ga0495635_0046370 3300046663 Bacteria 2998
507 Ga0495661_0018456 3300046665 Bacteria 4587
508 Ga0495657_0367835 3300046675 Unclassified 849
509 Ga0495623_0059174 3300046679 Bacteria 2407
510 Ga0495623_0070687 3300046679 Bacteria 2174
511 Ga0495623_0205264 3300046679 Bacteria 1131
512 Ga0495646_0222642 3300046680 Bacteria 1020
513 Ga0495646_0269637 3300046680 Unclassified 907
514 Ga0495658_0685454 3300046683 Unclassified 656
515 Ga0495669_0023454 3300046684 Bacteria 2686
516 Ga0495649_0228873 3300046694 Bacteria 960
517 Ga0495600_0102928 3300046809 Bacteria 1861
518 Ga0495581_0051399 3300047315 Bacteria 2380
519 Ga0495604_0043645 3300047317 Bacteria 3509
520 Ga0495604_0365942 3300047317 Bacteria 955
521 Ga0495674_0012807 3300047319 Bacteria 7898
522 Ga0495680_0385484 3300047322 Bacteria 970
523 Ga0495683_0044994 3300047323 Bacteria 2219
524 Ga0495684_0208571 3300047471 Bacteria 1438
525 Ga0495686_0133782 3300047472 Bacteria 1468
526 Ga0495593_0180188 3300047673 Bacteria 1064
527 Ga0495593_0482212 3300047673 Unclassified 621
528 Ga0495602_0547783 3300048088 Bacteria 802
529 Ga0496101_0175838 3300048904 Unclassified 1647
530 Ga0496102_0140314 3300048905 Bacteria 2266
531 Ga0496104_0198640 3300048907 Unclassified 1917
532 Ga0496105_0012352 3300048908 Bacteria 6761
533 Ga0496105_0216322 3300048908 Bacteria 1561
534 Ga0496105_0429545 3300048908 Bacteria 1045
535 Ga0496106_0428733 3300048909 Bacteria 1063
536 Ga0496108_0608690 3300048911 Unclassified 952
537 Ga0496109_0078782 3300048912 Bacteria 3034
538 Ga0496109_0709555 3300048912 Bacteria 943
539 Ga0496111_0016723 3300048914 Bacteria 5060
540 Ga0496112_0001799 3300048915 Bacteria 16870
541 Ga0496112_0240924 3300048915 Bacteria 1761
542 Ga0496112_0377173 3300048915 Bacteria 1359
543 Ga0496112_0952765 3300048915 Bacteria 779
544 Ga0496113_0000840 3300048916 Bacteria 16082
545 Ga0496115_0069833 3300048918 Bacteria 2846
546 Ga0501037_0136096 3300049573 Bacteria 1760
547 Ga0495601_0002582 3300053077 Bacteria 10285
548 Ga0500651_0000006 3300053093 Bacteria 305844
549 Ga0500595_033982 3300053119 Unclassified 1689
550 Ga0500568_0000575 3300053139 Bacteria 26862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100667644 Ga0070659_1006676441 190
2 3300005563 Ga0068855_100514980 Ga0068855_1005149802 190
3 3300005563 Ga0068855_100719482 Ga0068855_1007194821 190
4 3300013105 Ga0157369_11022876 Ga0157369_110228761 190
5 3300013307 Ga0157372_10003405 Ga0157372_1000340514 190
6 3300014968 Ga0157379_10519370 Ga0157379_105193701 190
7 3300025911 Ga0207654_10123633 Ga0207654_101236331 190
8 3300028666 Ga0265336_10001137 Ga0265336_1000113711 190
9 3300031235 Ga0265330_10003141 Ga0265330_100031417 190
10 3300031241 Ga0265325_10037564 Ga0265325_100375642 190
11 3300031249 Ga0265339_10092099 Ga0265339_100920992 190
12 3300031344 Ga0265316_10053544 Ga0265316_100535443 190
13 3300046472 Ga0495580_0330751 Ga0495580_0330751_92_664 190
14 3300046475 Ga0495639_0043211 Ga0495639_0043211_887_1459 190
15 3300046663 Ga0495635_0046370 Ga0495635_0046370_518_1090 190
16 3300046680 Ga0495646_0269637 Ga0495646_0269637_59_655 190
17 3300047315 Ga0495581_0051399 Ga0495581_0051399_1568_2140 190
18 3300047673 Ga0495593_0482212 Ga0495593_0482212_14_586 190
19 3300005327 Ga0070658_10096129 Ga0070658_100961294 191
20 3300005327 Ga0070658_10125386 Ga0070658_101253862 191
21 3300005327 Ga0070658_10300992 Ga0070658_103009923 191
22 3300005329 Ga0070683_100012692 Ga0070683_1000126927 191
23 3300005329 Ga0070683_100183058 Ga0070683_1001830582 191
24 3300005329 Ga0070683_100816437 Ga0070683_1008164371 191
25 3300005334 Ga0068869_100215005 Ga0068869_1002150051 191
26 3300005335 Ga0070666_10365495 Ga0070666_103654952 191
27 3300005336 Ga0070680_100111985 Ga0070680_1001119853 191
28 3300005336 Ga0070680_100283910 Ga0070680_1002839101 191
29 3300005336 Ga0070680_100549375 Ga0070680_1005493751 191
30 3300005337 Ga0070682_100192845 Ga0070682_1001928452 191
31 3300005337 Ga0070682_100350424 Ga0070682_1003504242 191
32 3300005337 Ga0070682_100718222 Ga0070682_1007182221 191
33 3300005338 Ga0068868_100018305 Ga0068868_1000183052 191
34 3300005338 Ga0068868_100025433 Ga0068868_1000254333 191
35 3300005338 Ga0068868_100056939 Ga0068868_1000569391 191
36 3300005339 Ga0070660_100012352 Ga0070660_1000123521 191
37 3300005339 Ga0070660_100109015 Ga0070660_1001090152 191
38 3300005339 Ga0070660_100553669 Ga0070660_1005536691 191
39 3300005341 Ga0070691_10417031 Ga0070691_104170311 191
40 3300005344 Ga0070661_100050669 Ga0070661_1000506693 191
41 3300005355 Ga0070671_100083926 Ga0070671_1000839263 191
42 3300005355 Ga0070671_100795194 Ga0070671_1007951941 191
43 3300005364 Ga0070673_100415723 Ga0070673_1004157231 191
44 3300005366 Ga0070659_100123091 Ga0070659_1001230912 191
45 3300005366 Ga0070659_100171737 Ga0070659_1001717372 191
46 3300005366 Ga0070659_100264950 Ga0070659_1002649503 191
47 3300005366 Ga0070659_100757832 Ga0070659_1007578321 191
48 3300005367 Ga0070667_100164689 Ga0070667_1001646892 191
49 3300005367 Ga0070667_100492363 Ga0070667_1004923632 191
50 3300005434 Ga0070709_10274811 Ga0070709_102748112 191
51 3300005435 Ga0070714_100361174 Ga0070714_1003611741 191
52 3300005435 Ga0070714_100439412 Ga0070714_1004394122 191
53 3300005435 Ga0070714_100455506 Ga0070714_1004555062 191
54 3300005436 Ga0070713_100008610 Ga0070713_1000086106 191
55 3300005436 Ga0070713_100106403 Ga0070713_1001064032 191
56 3300005436 Ga0070713_100117802 Ga0070713_1001178023 191
57 3300005436 Ga0070713_100263601 Ga0070713_1002636011 191
58 3300005437 Ga0070710_10145406 Ga0070710_101454062 191
59 3300005439 Ga0070711_100638954 Ga0070711_1006389541 191
60 3300005439 Ga0070711_100742905 Ga0070711_1007429051 191
61 3300005455 Ga0070663_100019061 Ga0070663_1000190612 191
62 3300005455 Ga0070663_100071778 Ga0070663_1000717782 191
63 3300005455 Ga0070663_100111641 Ga0070663_1001116412 191
64 3300005455 Ga0070663_100447996 Ga0070663_1004479962 191
65 3300005456 Ga0070678_100228113 Ga0070678_1002281132 191
66 3300005458 Ga0070681_10001115 Ga0070681_100011152 191
67 3300005458 Ga0070681_10046656 Ga0070681_100466562 191
68 3300005458 Ga0070681_10115114 Ga0070681_101151142 191
69 3300005458 Ga0070681_10211333 Ga0070681_102113332 191
70 3300005458 Ga0070681_10262062 Ga0070681_102620621 191
71 3300005458 Ga0070681_10348103 Ga0070681_103481033 191
72 3300005458 Ga0070681_10488115 Ga0070681_104881151 191
73 3300005458 Ga0070681_10909452 Ga0070681_109094521 191
74 3300005458 Ga0070681_11054945 Ga0070681_110549451 191
75 3300005471 Ga0070698_100540179 Ga0070698_1005401792 191
76 3300005518 Ga0070699_100213668 Ga0070699_1002136683 191
77 3300005530 Ga0070679_100076631 Ga0070679_1000766311 191
78 3300005530 Ga0070679_100185260 Ga0070679_1001852602 191
79 3300005530 Ga0070679_100193631 Ga0070679_1001936312 191
80 3300005530 Ga0070679_100224303 Ga0070679_1002243032 191
81 3300005530 Ga0070679_100517805 Ga0070679_1005178052 191
82 3300005535 Ga0070684_100028880 Ga0070684_1000288804 191
83 3300005535 Ga0070684_100260595 Ga0070684_1002605952 191
84 3300005535 Ga0070684_101235392 Ga0070684_1012353921 191
85 3300005536 Ga0070697_100268373 Ga0070697_1002683732 191
86 3300005539 Ga0068853_100005299 Ga0068853_1000052997 191
87 3300005539 Ga0068853_100014854 Ga0068853_1000148547 191
88 3300005539 Ga0068853_100306795 Ga0068853_1003067951 191
89 3300005539 Ga0068853_100724190 Ga0068853_1007241902 191
90 3300005547 Ga0070693_100009529 Ga0070693_1000095293 191
91 3300005547 Ga0070693_100481831 Ga0070693_1004818311 191
92 3300005548 Ga0070665_100162498 Ga0070665_1001624982 191
93 3300005548 Ga0070665_100217052 Ga0070665_1002170522 191
94 3300005548 Ga0070665_101055446 Ga0070665_1010554461 191
95 3300005563 Ga0068855_100003377 Ga0068855_1000033772 191
96 3300005563 Ga0068855_100006382 Ga0068855_1000063829 191
97 3300005563 Ga0068855_100008015 Ga0068855_1000080157 191
98 3300005563 Ga0068855_100017513 Ga0068855_1000175134 191
99 3300005563 Ga0068855_100022876 Ga0068855_1000228762 191
100 3300005563 Ga0068855_100045145 Ga0068855_1000451452 191
101 3300005563 Ga0068855_100049988 Ga0068855_1000499885 191
102 3300005563 Ga0068855_100182493 Ga0068855_1001824933 191
103 3300005563 Ga0068855_100188211 Ga0068855_1001882113 191
104 3300005563 Ga0068855_100312225 Ga0068855_1003122252 191
105 3300005563 Ga0068855_100369326 Ga0068855_1003693262 191
106 3300005563 Ga0068855_100461176 Ga0068855_1004611761 191
107 3300005564 Ga0070664_100057380 Ga0070664_1000573801 191
108 3300005577 Ga0068857_100016775 Ga0068857_1000167753 191
109 3300005577 Ga0068857_100019955 Ga0068857_1000199555 191
110 3300005577 Ga0068857_100038886 Ga0068857_1000388863 191
111 3300005577 Ga0068857_100367750 Ga0068857_1003677502 191
112 3300005578 Ga0068854_100011918 Ga0068854_1000119185 191
113 3300005578 Ga0068854_100270563 Ga0068854_1002705632 191
114 3300005578 Ga0068854_100566346 Ga0068854_1005663461 191
115 3300005578 Ga0068854_100879883 Ga0068854_1008798831 191
116 3300005578 Ga0068854_101068120 Ga0068854_1010681201 191
117 3300005614 Ga0068856_100002791 Ga0068856_10000279115 191
118 3300005614 Ga0068856_100048003 Ga0068856_1000480032 191
119 3300005614 Ga0068856_100461216 Ga0068856_1004612162 191
120 3300005614 Ga0068856_100934647 Ga0068856_1009346472 191
121 3300005614 Ga0068856_101154023 Ga0068856_1011540231 191
122 3300005614 Ga0068856_101171713 Ga0068856_1011717132 191
123 3300005616 Ga0068852_100017305 Ga0068852_1000173056 191
124 3300005616 Ga0068852_100024157 Ga0068852_1000241573 191
125 3300005616 Ga0068852_100057574 Ga0068852_1000575743 191
126 3300005616 Ga0068852_100143069 Ga0068852_1001430692 191
127 3300005616 Ga0068852_100163224 Ga0068852_1001632242 191
128 3300005718 Ga0068866_10063458 Ga0068866_100634581 191
129 3300005834 Ga0068851_10011738 Ga0068851_100117384 191
130 3300005834 Ga0068851_10145946 Ga0068851_101459461 191
131 3300005841 Ga0068863_100026223 Ga0068863_1000262236 191
132 3300005841 Ga0068863_100036145 Ga0068863_1000361454 191
133 3300005841 Ga0068863_100162797 Ga0068863_1001627973 191
134 3300005841 Ga0068863_100892650 Ga0068863_1008926501 191
135 3300005842 Ga0068858_100041407 Ga0068858_1000414071 191
136 3300005842 Ga0068858_100178742 Ga0068858_1001787422 191
137 3300005842 Ga0068858_100519795 Ga0068858_1005197952 191
138 3300005842 Ga0068858_100824380 Ga0068858_1008243802 191
139 3300005843 Ga0068860_100317661 Ga0068860_1003176612 191
140 3300006028 Ga0070717_10002732 Ga0070717_100027328 191
141 3300006173 Ga0070716_100530882 Ga0070716_1005308821 191
142 3300006175 Ga0070712_100152637 Ga0070712_1001526372 191
143 3300006175 Ga0070712_100566923 Ga0070712_1005669231 191
144 3300006237 Ga0097621_100001290 Ga0097621_10000129014 191
145 3300006237 Ga0097621_100053238 Ga0097621_1000532382 191
146 3300006237 Ga0097621_100059655 Ga0097621_1000596553 191
147 3300006237 Ga0097621_100243395 Ga0097621_1002433952 191
148 3300006358 Ga0068871_100059729 Ga0068871_1000597291 191
149 3300006358 Ga0068871_100189941 Ga0068871_1001899412 191
150 3300006358 Ga0068871_100227941 Ga0068871_1002279411 191
151 3300006358 Ga0068871_100229422 Ga0068871_1002294222 191
152 3300006358 Ga0068871_100351060 Ga0068871_1003510602 191
153 3300006871 Ga0075434_100957540 Ga0075434_1009575402 191
154 3300006881 Ga0068865_100037157 Ga0068865_1000371572 191
155 3300007788 Ga0099795_10173912 Ga0099795_101739121 191
156 3300009093 Ga0105240_10010798 Ga0105240_100107987 191
157 3300009093 Ga0105240_10011435 Ga0105240_100114358 191
158 3300009093 Ga0105240_10015786 Ga0105240_100157869 191
159 3300009093 Ga0105240_10026891 Ga0105240_100268918 191
160 3300009093 Ga0105240_10038651 Ga0105240_100386512 191
161 3300009093 Ga0105240_10133041 Ga0105240_101330413 191
162 3300009093 Ga0105240_10161890 Ga0105240_101618902 191
163 3300009093 Ga0105240_10262856 Ga0105240_102628562 191
164 3300009093 Ga0105240_10584041 Ga0105240_105840411 191
165 3300009093 Ga0105240_10609269 Ga0105240_106092692 191
166 3300009093 Ga0105240_11480975 Ga0105240_114809751 191
167 3300009098 Ga0105245_10004706 Ga0105245_1000470611 191
168 3300009098 Ga0105245_10031974 Ga0105245_100319743 191
169 3300009098 Ga0105245_10071470 Ga0105245_100714702 191
170 3300009101 Ga0105247_10106250 Ga0105247_101062502 191
171 3300009148 Ga0105243_10058162 Ga0105243_100581622 191
172 3300009174 Ga0105241_10000146 Ga0105241_1000014642 191
173 3300009174 Ga0105241_10011226 Ga0105241_100112263 191
174 3300009174 Ga0105241_10018317 Ga0105241_100183173 191
175 3300009174 Ga0105241_10076731 Ga0105241_100767312 191
176 3300009174 Ga0105241_10094492 Ga0105241_100944923 191
177 3300009174 Ga0105241_10110363 Ga0105241_101103632 191
178 3300009174 Ga0105241_10177930 Ga0105241_101779302 191
179 3300009174 Ga0105241_10218236 Ga0105241_102182361 191
180 3300009176 Ga0105242_10014183 Ga0105242_100141836 191
181 3300009176 Ga0105242_10349732 Ga0105242_103497322 191
182 3300009176 Ga0105242_10371349 Ga0105242_103713492 191
183 3300009176 Ga0105242_10786678 Ga0105242_107866781 191
184 3300009176 Ga0105242_11119857 Ga0105242_111198571 191
185 3300009177 Ga0105248_10000019 Ga0105248_1000001943 191
186 3300009177 Ga0105248_10002961 Ga0105248_100029619 191
187 3300009177 Ga0105248_10033566 Ga0105248_100335667 191
188 3300009177 Ga0105248_10042059 Ga0105248_100420593 191
189 3300009177 Ga0105248_10054712 Ga0105248_100547125 191
190 3300009177 Ga0105248_10237838 Ga0105248_102378383 191
191 3300009177 Ga0105248_10283413 Ga0105248_102834132 191
192 3300009177 Ga0105248_10608170 Ga0105248_106081701 191
193 3300009545 Ga0105237_10095623 Ga0105237_100956233 191
194 3300009545 Ga0105237_10111838 Ga0105237_101118382 191
195 3300009545 Ga0105237_10147252 Ga0105237_101472523 191
196 3300009545 Ga0105237_10219343 Ga0105237_102193432 191
197 3300009545 Ga0105237_10393034 Ga0105237_103930341 191
198 3300009545 Ga0105237_10438076 Ga0105237_104380761 191
199 3300009545 Ga0105237_10929626 Ga0105237_109296261 191
200 3300009545 Ga0105237_11285368 Ga0105237_112853681 191
201 3300009545 Ga0105237_11437937 Ga0105237_114379371 191
202 3300009551 Ga0105238_10012438 Ga0105238_100124382 191
203 3300009551 Ga0105238_10027728 Ga0105238_100277287 191
204 3300009551 Ga0105238_10027782 Ga0105238_100277826 191
205 3300009551 Ga0105238_10053044 Ga0105238_100530445 191
206 3300009551 Ga0105238_10059896 Ga0105238_100598962 191
207 3300009551 Ga0105238_10088539 Ga0105238_100885392 191
208 3300009551 Ga0105238_10125337 Ga0105238_101253372 191
209 3300009551 Ga0105238_10274641 Ga0105238_102746413 191
210 3300009551 Ga0105238_10874615 Ga0105238_108746151 191
211 3300009551 Ga0105238_11915993 Ga0105238_119159931 191
212 3300010375 Ga0105239_10012806 Ga0105239_100128064 191
213 3300010375 Ga0105239_10031460 Ga0105239_100314605 191
214 3300010375 Ga0105239_10033892 Ga0105239_100338926 191
215 3300010375 Ga0105239_10063854 Ga0105239_100638542 191
216 3300010375 Ga0105239_10113203 Ga0105239_101132034 191
217 3300010375 Ga0105239_10147049 Ga0105239_101470492 191
218 3300010375 Ga0105239_11326304 Ga0105239_113263041 191
219 3300010375 Ga0105239_11504950 Ga0105239_115049502 191
220 3300013100 Ga0157373_10088355 Ga0157373_100883553 191
221 3300013102 Ga0157371_10064445 Ga0157371_100644453 191
222 3300013104 Ga0157370_10015391 Ga0157370_100153911 191
223 3300013104 Ga0157370_10036212 Ga0157370_100362122 191
224 3300013104 Ga0157370_10036704 Ga0157370_100367045 191
225 3300013104 Ga0157370_10043087 Ga0157370_100430873 191
226 3300013104 Ga0157370_10051095 Ga0157370_100510953 191
227 3300013104 Ga0157370_10071115 Ga0157370_100711153 191
228 3300013104 Ga0157370_10096055 Ga0157370_100960552 191
229 3300013104 Ga0157370_10237501 Ga0157370_102375012 191
230 3300013104 Ga0157370_10376726 Ga0157370_103767262 191
231 3300013104 Ga0157370_11012827 Ga0157370_110128271 191
232 3300013104 Ga0157370_11108174 Ga0157370_111081741 191
233 3300013105 Ga0157369_10001300 Ga0157369_1000130012 191
234 3300013105 Ga0157369_10015873 Ga0157369_100158737 191
235 3300013105 Ga0157369_10021067 Ga0157369_100210674 191
236 3300013105 Ga0157369_10050642 Ga0157369_100506422 191
237 3300013105 Ga0157369_10085700 Ga0157369_100857003 191
238 3300013105 Ga0157369_10164312 Ga0157369_101643122 191
239 3300013105 Ga0157369_10292098 Ga0157369_102920983 191
240 3300013105 Ga0157369_10372273 Ga0157369_103722732 191
241 3300013105 Ga0157369_10379678 Ga0157369_103796781 191
242 3300013105 Ga0157369_11123791 Ga0157369_111237911 191
243 3300013105 Ga0157369_11662532 Ga0157369_116625321 191
244 3300013296 Ga0157374_10006059 Ga0157374_100060594 191
245 3300013296 Ga0157374_10014501 Ga0157374_100145018 191
246 3300013296 Ga0157374_10056732 Ga0157374_100567322 191
247 3300013296 Ga0157374_10065905 Ga0157374_100659053 191
248 3300013296 Ga0157374_10133160 Ga0157374_101331602 191
249 3300013296 Ga0157374_10984309 Ga0157374_109843092 191
250 3300013297 Ga0157378_10000160 Ga0157378_1000016028 191
251 3300013297 Ga0157378_10057625 Ga0157378_100576251 191
252 3300013297 Ga0157378_10082690 Ga0157378_100826902 191
253 3300013306 Ga0163162_10003329 Ga0163162_100033297 191
254 3300013306 Ga0163162_10051839 Ga0163162_100518394 191
255 3300013306 Ga0163162_10055653 Ga0163162_100556535 191
256 3300013306 Ga0163162_10086083 Ga0163162_100860832 191
257 3300013306 Ga0163162_10165216 Ga0163162_101652161 191
258 3300013306 Ga0163162_11375150 Ga0163162_113751501 191
259 3300013307 Ga0157372_10012941 Ga0157372_100129418 191
260 3300013307 Ga0157372_10092084 Ga0157372_100920843 191
261 3300013307 Ga0157372_10136782 Ga0157372_101367822 191
262 3300013307 Ga0157372_10167467 Ga0157372_101674673 191
263 3300013307 Ga0157372_10326891 Ga0157372_103268911 191
264 3300013307 Ga0157372_10419308 Ga0157372_104193082 191
265 3300013307 Ga0157372_10520001 Ga0157372_105200011 191
266 3300013307 Ga0157372_10605477 Ga0157372_106054771 191
267 3300013307 Ga0157372_10618022 Ga0157372_106180222 191
268 3300013308 Ga0157375_10035479 Ga0157375_100354795 191
269 3300013308 Ga0157375_10044239 Ga0157375_100442395 191
270 3300013308 Ga0157375_10231354 Ga0157375_102313542 191
271 3300013308 Ga0157375_10615922 Ga0157375_106159222 191
272 3300014325 Ga0163163_10039007 Ga0163163_100390071 191
273 3300014325 Ga0163163_10119914 Ga0163163_101199142 191
274 3300014326 Ga0157380_10602108 Ga0157380_106021082 191
275 3300014968 Ga0157379_10094376 Ga0157379_100943762 191
276 3300014968 Ga0157379_11442008 Ga0157379_114420081 191
277 3300014969 Ga0157376_10005077 Ga0157376_100050777 191
278 3300014969 Ga0157376_10009944 Ga0157376_100099444 191
279 3300014969 Ga0157376_10017421 Ga0157376_100174212 191
280 3300014969 Ga0157376_10071562 Ga0157376_100715623 191
281 3300014969 Ga0157376_10368740 Ga0157376_103687403 191
282 3300014969 Ga0157376_10810767 Ga0157376_108107671 191
283 3300022732 Ga0224569_103564 Ga0224569_1035642 191
284 3300024227 Ga0228598_1001829 Ga0228598_10018295 191
285 3300025898 Ga0207692_10081110 Ga0207692_100811102 191
286 3300025899 Ga0207642_10054770 Ga0207642_100547702 191
287 3300025900 Ga0207710_10259056 Ga0207710_102590561 191
288 3300025904 Ga0207647_10001933 Ga0207647_1000193314 191
289 3300025904 Ga0207647_10006057 Ga0207647_100060577 191
290 3300025905 Ga0207685_10255223 Ga0207685_102552231 191
291 3300025906 Ga0207699_10202067 Ga0207699_102020672 191
292 3300025906 Ga0207699_10305092 Ga0207699_103050921 191
293 3300025906 Ga0207699_10469559 Ga0207699_104695592 191
294 3300025909 Ga0207705_10000171 Ga0207705_1000017149 191
295 3300025909 Ga0207705_10000405 Ga0207705_1000040531 191
296 3300025909 Ga0207705_10107734 Ga0207705_101077341 191
297 3300025909 Ga0207705_10274159 Ga0207705_102741592 191
298 3300025911 Ga0207654_10015153 Ga0207654_100151533 191
299 3300025911 Ga0207654_10015292 Ga0207654_100152923 191
300 3300025911 Ga0207654_10258486 Ga0207654_102584861 191
301 3300025912 Ga0207707_10025388 Ga0207707_100253886 191
302 3300025912 Ga0207707_10050158 Ga0207707_100501584 191
303 3300025912 Ga0207707_10104691 Ga0207707_101046911 191
304 3300025912 Ga0207707_10159542 Ga0207707_101595422 191
305 3300025912 Ga0207707_10366027 Ga0207707_103660271 191
306 3300025912 Ga0207707_10810557 Ga0207707_108105571 191
307 3300025912 Ga0207707_10910697 Ga0207707_109106971 191
308 3300025913 Ga0207695_10000341 Ga0207695_1000034192 191
309 3300025913 Ga0207695_10008580 Ga0207695_1000858010 191
310 3300025913 Ga0207695_10016432 Ga0207695_100164322 191
311 3300025913 Ga0207695_10032214 Ga0207695_100322143 191
312 3300025913 Ga0207695_10115327 Ga0207695_101153272 191
313 3300025913 Ga0207695_10116452 Ga0207695_101164522 191
314 3300025913 Ga0207695_10184092 Ga0207695_101840922 191
315 3300025913 Ga0207695_10332490 Ga0207695_103324902 191
316 3300025913 Ga0207695_10456597 Ga0207695_104565972 191
317 3300025913 Ga0207695_10469742 Ga0207695_104697422 191
318 3300025913 Ga0207695_10605886 Ga0207695_106058861 191
319 3300025914 Ga0207671_10050120 Ga0207671_100501202 191
320 3300025914 Ga0207671_10316558 Ga0207671_103165581 191
321 3300025914 Ga0207671_10368908 Ga0207671_103689082 191
322 3300025915 Ga0207693_10022454 Ga0207693_100224545 191
323 3300025915 Ga0207693_10360371 Ga0207693_103603711 191
324 3300025915 Ga0207693_10364286 Ga0207693_103642861 191
325 3300025917 Ga0207660_10128835 Ga0207660_101288353 191
326 3300025917 Ga0207660_10832319 Ga0207660_108323191 191
327 3300025919 Ga0207657_10000747 Ga0207657_1000074714 191
328 3300025919 Ga0207657_10001086 Ga0207657_1000108630 191
329 3300025921 Ga0207652_10065014 Ga0207652_100650142 191
330 3300025921 Ga0207652_10183091 Ga0207652_101830911 191
331 3300025921 Ga0207652_10216137 Ga0207652_102161372 191
332 3300025921 Ga0207652_10429601 Ga0207652_104296011 191
333 3300025924 Ga0207694_10003332 Ga0207694_100033322 191
334 3300025924 Ga0207694_10005586 Ga0207694_100055868 191
335 3300025924 Ga0207694_10033987 Ga0207694_100339871 191
336 3300025924 Ga0207694_10080152 Ga0207694_100801522 191
337 3300025924 Ga0207694_10225722 Ga0207694_102257221 191
338 3300025924 Ga0207694_10372767 Ga0207694_103727672 191
339 3300025925 Ga0207650_10680618 Ga0207650_106806181 191
340 3300025926 Ga0207659_10544789 Ga0207659_105447892 191
341 3300025927 Ga0207687_10006394 Ga0207687_100063945 191
342 3300025927 Ga0207687_10014284 Ga0207687_100142842 191
343 3300025927 Ga0207687_10080839 Ga0207687_100808392 191
344 3300025927 Ga0207687_10680786 Ga0207687_106807862 191
345 3300025928 Ga0207700_10012412 Ga0207700_100124122 191
346 3300025928 Ga0207700_10083160 Ga0207700_100831603 191
347 3300025928 Ga0207700_10111020 Ga0207700_101110202 191
348 3300025928 Ga0207700_10243763 Ga0207700_102437633 191
349 3300025928 Ga0207700_10383571 Ga0207700_103835711 191
350 3300025928 Ga0207700_10923409 Ga0207700_109234092 191
351 3300025929 Ga0207664_10005557 Ga0207664_100055577 191
352 3300025929 Ga0207664_10744983 Ga0207664_107449831 191
353 3300025931 Ga0207644_11205604 Ga0207644_112056041 191
354 3300025932 Ga0207690_10388746 Ga0207690_103887461 191
355 3300025938 Ga0207704_10104688 Ga0207704_101046882 191
356 3300025939 Ga0207665_10039607 Ga0207665_100396071 191
357 3300025939 Ga0207665_10418297 Ga0207665_104182972 191
358 3300025941 Ga0207711_10000014 Ga0207711_10000014457 191
359 3300025941 Ga0207711_10007356 Ga0207711_100073562 191
360 3300025941 Ga0207711_10064945 Ga0207711_100649452 191
361 3300025941 Ga0207711_10080562 Ga0207711_100805622 191
362 3300025941 Ga0207711_10133977 Ga0207711_101339773 191
363 3300025941 Ga0207711_10194195 Ga0207711_101941953 191
364 3300025941 Ga0207711_10221797 Ga0207711_102217972 191
365 3300025941 Ga0207711_10412578 Ga0207711_104125781 191
366 3300025942 Ga0207689_10235772 Ga0207689_102357721 191
367 3300025944 Ga0207661_10063760 Ga0207661_100637604 191
368 3300025944 Ga0207661_10209450 Ga0207661_102094503 191
369 3300025944 Ga0207661_10246960 Ga0207661_102469602 191
370 3300025944 Ga0207661_11212151 Ga0207661_112121511 191
371 3300025945 Ga0207679_10638257 Ga0207679_106382572 191
372 3300025945 Ga0207679_11099786 Ga0207679_110997861 191
373 3300025949 Ga0207667_10006944 Ga0207667_1000694410 191
374 3300025949 Ga0207667_10011261 Ga0207667_100112617 191
375 3300025949 Ga0207667_10016174 Ga0207667_100161747 191
376 3300025949 Ga0207667_10021169 Ga0207667_100211695 191
377 3300025949 Ga0207667_10028898 Ga0207667_100288987 191
378 3300025949 Ga0207667_10037861 Ga0207667_100378615 191
379 3300025949 Ga0207667_10090807 Ga0207667_100908073 191
380 3300025949 Ga0207667_10095983 Ga0207667_100959832 191
381 3300025949 Ga0207667_10147997 Ga0207667_101479973 191
382 3300025949 Ga0207667_11283702 Ga0207667_112837021 191
383 3300025981 Ga0207640_10099216 Ga0207640_100992162 191
384 3300025981 Ga0207640_10710977 Ga0207640_107109771 191
385 3300025986 Ga0207658_10492287 Ga0207658_104922872 191
386 3300026023 Ga0207677_10002246 Ga0207677_100022465 191
387 3300026035 Ga0207703_10108100 Ga0207703_101081003 191
388 3300026035 Ga0207703_10248522 Ga0207703_102485222 191
389 3300026041 Ga0207639_10160022 Ga0207639_101600222 191
390 3300026041 Ga0207639_10387347 Ga0207639_103873471 191
391 3300026067 Ga0207678_10004895 Ga0207678_100048958 191
392 3300026067 Ga0207678_10178103 Ga0207678_101781032 191
393 3300026067 Ga0207678_10230314 Ga0207678_102303142 191
394 3300026078 Ga0207702_10014192 Ga0207702_100141922 191
395 3300026078 Ga0207702_10040028 Ga0207702_100400282 191
396 3300026078 Ga0207702_10160057 Ga0207702_101600572 191
397 3300026078 Ga0207702_10241855 Ga0207702_102418553 191
398 3300026078 Ga0207702_10738561 Ga0207702_107385612 191
399 3300026088 Ga0207641_10023997 Ga0207641_100239972 191
400 3300026088 Ga0207641_10996478 Ga0207641_109964781 191
401 3300026089 Ga0207648_10005760 Ga0207648_1000576010 191
402 3300026095 Ga0207676_10453403 Ga0207676_104534031 191
403 3300026116 Ga0207674_10004620 Ga0207674_100046207 191
404 3300026116 Ga0207674_10017687 Ga0207674_100176878 191
405 3300026116 Ga0207674_10090366 Ga0207674_100903664 191
406 3300026116 Ga0207674_10214834 Ga0207674_102148342 191
407 3300026116 Ga0207674_10439429 Ga0207674_104394293 191
408 3300026116 Ga0207674_10465681 Ga0207674_104656812 191
409 3300026142 Ga0207698_10021915 Ga0207698_100219152 191
410 3300026142 Ga0207698_10107624 Ga0207698_101076243 191
411 3300026142 Ga0207698_10465141 Ga0207698_104651411 191
412 3300026142 Ga0207698_10625926 Ga0207698_106259262 191
413 3300028017 Ga0265356_1000302 Ga0265356_10003025 191
414 3300028017 Ga0265356_1011454 Ga0265356_10114542 191
415 3300028379 Ga0268266_10003436 Ga0268266_1000343611 191
416 3300028379 Ga0268266_10009972 Ga0268266_100099728 191
417 3300028379 Ga0268266_10986024 Ga0268266_109860241 191
418 3300028381 Ga0268264_10270230 Ga0268264_102702302 191
419 3300028800 Ga0265338_10008940 Ga0265338_100089402 191
420 3300028800 Ga0265338_10092996 Ga0265338_100929962 191
421 3300028800 Ga0265338_10109318 Ga0265338_101093181 191
422 3300028800 Ga0265338_10460505 Ga0265338_104605052 191
423 3300031090 Ga0265760_10000069 Ga0265760_1000006917 191
424 3300031249 Ga0265339_10078050 Ga0265339_100780502 191
425 3300031249 Ga0265339_10108942 Ga0265339_101089421 191
426 3300031249 Ga0265339_10230869 Ga0265339_102308691 191
427 3300031344 Ga0265316_10003667 Ga0265316_100036671 191
428 3300031344 Ga0265316_10337998 Ga0265316_103379982 191
429 3300031711 Ga0265314_10001685 Ga0265314_1000168512 191
430 3300031711 Ga0265314_10128441 Ga0265314_101284411 191
431 3300031712 Ga0265342_10056368 Ga0265342_100563682 191
432 3300033180 Ga0307510_10124214 Ga0307510_101242143 191
433 3300033180 Ga0307510_10412711 Ga0307510_104127111 191
434 3300035083 Ga0373926_0036389 Ga0373926_0036389_312_887 191
435 3300035086 Ga0373934_0086161 Ga0373934_0086161_483_1058 191
436 3300035111 Ga0373923_0313940 Ga0373923_0313940_86_661 191
437 3300035113 Ga0373936_0017444 Ga0373936_0017444_667_1242 191
438 3300035116 Ga0373945_0086577 Ga0373945_0086577_314_889 191
439 3300035119 Ga0373956_0212001 Ga0373956_0212001_287_862 191
440 3300035170 Ga0373943_0009262 Ga0373943_0009262_1273_1848 191
441 3300035171 Ga0373946_0002854 Ga0373946_0002854_1659_2234 191
442 3300035172 Ga0373955_0116531 Ga0373955_0116531_815_1390 191
443 3300035410 Ga0373924_0000972 Ga0373924_0000972_27_602 191
444 3300035410 Ga0373924_0057884 Ga0373924_0057884_342_917 191
445 3300035410 Ga0373924_0125259 Ga0373924_0125259_27_602 191
446 3300035692 Ga0373935_0011531 Ga0373935_0011531_4604_5179 191
447 3300035692 Ga0373935_0023382 Ga0373935_0023382_2211_2786 191
448 3300035692 Ga0373935_0583670 Ga0373935_0583670_228_803 191
449 3300035695 Ga0373927_0012566 Ga0373927_0012566_1024_1599 191
450 3300035695 Ga0373927_0055229 Ga0373927_0055229_1722_2297 191
451 3300035725 Ga0373947_0020567 Ga0373947_0020567_1155_1730 191
452 3300036401 Ga0373937_0000390 Ga0373937_0000390_29624_30199 191
453 3300036401 Ga0373937_0007774 Ga0373937_0007774_2157_2732 191
454 3300036401 Ga0373937_0035383 Ga0373937_0035383_2246_2821 191
455 3300036401 Ga0373937_1073251 Ga0373937_1073251_21_596 191
456 3300037068 Ga0373925_0010808 Ga0373925_0010808_2619_3194 191
457 3300037068 Ga0373925_0067665 Ga0373925_0067665_2088_2663 191
458 3300037068 Ga0373925_0693500 Ga0373925_0693500_74_649 191
459 3300037068 Ga0373925_0890593 Ga0373925_0890593_135_710 191
460 3300037466 Ga0395898_0030053 Ga0395898_0030053_1287_1862 191
461 3300039447 Ga0436361_0519733 Ga0436361_0519733_302_877 191
462 3300039447 Ga0436361_0663741 Ga0436361_0663741_1486_2061 191
463 3300039453 Ga0436362_0554140 Ga0436362_0554140_97_672 191
464 3300042876 Ga0451577_0062378 Ga0451577_0062378_2612_3187 191
465 3300042876 Ga0451577_0123286 Ga0451577_0123286_763_1338 191
466 3300044673 Ga0453683_0055465 Ga0453683_0055465_723_1298 191
467 3300044673 Ga0453683_0099833 Ga0453683_0099833_510_1085 191
468 3300044694 Ga0466963_0002421 Ga0466963_0002421_3326_3901 191
469 3300044694 Ga0466963_0102992 Ga0466963_0102992_767_1342 191
470 3300044712 Ga0453684_0410582 Ga0453684_0410582_884_1459 191
471 3300044842 Ga0466957_0000242 Ga0466957_0000242_20323_20898 191
472 3300044842 Ga0466957_0061703 Ga0466957_0061703_1263_1838 191
473 3300045051 Ga0451576_0100969 Ga0451576_0100969_1426_2001 191
474 3300045051 Ga0451576_0504139 Ga0451576_0504139_246_821 191
475 3300045051 Ga0451576_0643324 Ga0451576_0643324_213_788 191
476 3300045836 Ga0466958_0104949 Ga0466958_0104949_680_1255 191
477 3300045976 Ga0466967_0002153 Ga0466967_0002153_886_1461 191
478 3300045976 Ga0466967_0312665 Ga0466967_0312665_674_1249 191
479 3300046454 Ga0495592_0063194 Ga0495592_0063194_1161_1736 191
480 3300046462 Ga0495651_0011687 Ga0495651_0011687_688_1263 191
481 3300046462 Ga0495651_0097452 Ga0495651_0097452_781_1356 191
482 3300046471 Ga0495650_0003916 Ga0495650_0003916_6505_7080 191
483 3300046472 Ga0495580_0068474 Ga0495580_0068474_856_1431 191
484 3300046472 Ga0495580_0273218 Ga0495580_0273218_343_918 191
485 3300046474 Ga0495605_0201547 Ga0495605_0201547_25_600 191
486 3300046477 Ga0495664_0011290 Ga0495664_0011290_3107_3682 191
487 3300046491 Ga0495584_0258123 Ga0495584_0258123_251_826 191
488 3300046492 Ga0495585_0013633 Ga0495585_0013633_1725_2300 191
489 3300046500 Ga0495596_0083431 Ga0495596_0083431_253_828 191
490 3300046511 Ga0495608_0148419 Ga0495608_0148419_339_914 191
491 3300046515 Ga0495620_0286697 Ga0495620_0286697_37_612 191
492 3300046516 Ga0495628_0205442 Ga0495628_0205442_497_1072 191
493 3300046516 Ga0495628_0298624 Ga0495628_0298624_203_778 191
494 3300046517 Ga0495630_0126059 Ga0495630_0126059_871_1446 191
495 3300046518 Ga0495631_0031431 Ga0495631_0031431_1227_1802 191
496 3300046519 Ga0495632_0028004 Ga0495632_0028004_527_1102 191
497 3300046523 Ga0495644_0000001 Ga0495644_0000001_165791_166366 191
498 3300046524 Ga0495648_0222508 Ga0495648_0222508_21_596 191
499 3300046528 Ga0495642_0008687 Ga0495642_0008687_1718_2293 191
500 3300046529 Ga0495652_0095944 Ga0495652_0095944_1122_1697 191
501 3300046536 Ga0495587_0155009 Ga0495587_0155009_486_1061 191
502 3300046543 Ga0495645_0019022 Ga0495645_0019022_242_817 191
503 3300046558 Ga0495633_0016264 Ga0495633_0016264_2541_3116 191
504 3300046616 Ga0495668_0005181 Ga0495668_0005181_209_784 191
505 3300046642 Ga0495634_0246115 Ga0495634_0246115_439_1014 191
506 3300046648 Ga0495611_0003508 Ga0495611_0003508_1309_1884 191
507 3300046660 Ga0495625_0002024 Ga0495625_0002024_16555_17130 191
508 3300046660 Ga0495625_0026462 Ga0495625_0026462_2766_3341 191
509 3300046660 Ga0495625_0063401 Ga0495625_0063401_487_1062 191
510 3300046665 Ga0495661_0018456 Ga0495661_0018456_219_794 191
511 3300046675 Ga0495657_0367835 Ga0495657_0367835_80_655 191
512 3300046679 Ga0495623_0059174 Ga0495623_0059174_568_1143 191
513 3300046679 Ga0495623_0070687 Ga0495623_0070687_1533_2108 191
514 3300046679 Ga0495623_0205264 Ga0495623_0205264_377_1084 191
515 3300046680 Ga0495646_0222642 Ga0495646_0222642_218_793 191
516 3300046683 Ga0495658_0685454 Ga0495658_0685454_19_594 191
517 3300046684 Ga0495669_0023454 Ga0495669_0023454_25_600 191
518 3300046694 Ga0495649_0228873 Ga0495649_0228873_157_732 191
519 3300046809 Ga0495600_0102928 Ga0495600_0102928_715_1290 191
520 3300047317 Ga0495604_0043645 Ga0495604_0043645_2908_3483 191
521 3300047317 Ga0495604_0365942 Ga0495604_0365942_45_620 191
522 3300047319 Ga0495674_0012807 Ga0495674_0012807_3454_4029 191
523 3300047322 Ga0495680_0385484 Ga0495680_0385484_268_843 191
524 3300047323 Ga0495683_0044994 Ga0495683_0044994_1448_2023 191
525 3300047471 Ga0495684_0208571 Ga0495684_0208571_752_1327 191
526 3300047472 Ga0495686_0133782 Ga0495686_0133782_402_977 191
527 3300047673 Ga0495593_0180188 Ga0495593_0180188_459_1034 191
528 3300048088 Ga0495602_0547783 Ga0495602_0547783_31_606 191
529 3300048904 Ga0496101_0175838 Ga0496101_0175838_493_1068 191
530 3300048905 Ga0496102_0140314 Ga0496102_0140314_1638_2213 191
531 3300048907 Ga0496104_0198640 Ga0496104_0198640_436_1011 191
532 3300048908 Ga0496105_0012352 Ga0496105_0012352_2181_2756 191
533 3300048908 Ga0496105_0216322 Ga0496105_0216322_552_1127 191
534 3300048908 Ga0496105_0429545 Ga0496105_0429545_91_666 191
535 3300048909 Ga0496106_0428733 Ga0496106_0428733_474_1049 191
536 3300048911 Ga0496108_0608690 Ga0496108_0608690_293_868 191
537 3300048912 Ga0496109_0078782 Ga0496109_0078782_521_1096 191
538 3300048912 Ga0496109_0709555 Ga0496109_0709555_107_682 191
539 3300048914 Ga0496111_0016723 Ga0496111_0016723_3026_3601 191
540 3300048915 Ga0496112_0001799 Ga0496112_0001799_15492_16067 191
541 3300048915 Ga0496112_0240924 Ga0496112_0240924_944_1519 191
542 3300048915 Ga0496112_0377173 Ga0496112_0377173_450_1025 191
543 3300048915 Ga0496112_0952765 Ga0496112_0952765_121_696 191
544 3300048916 Ga0496113_0000840 Ga0496113_0000840_811_1386 191
545 3300048918 Ga0496115_0069833 Ga0496115_0069833_1172_1765 191
546 3300049573 Ga0501037_0136096 Ga0501037_0136096_680_1255 191
547 3300053077 Ga0495601_0002582 Ga0495601_0002582_7859_8434 191
548 3300053093 Ga0500651_0000006 Ga0500651_0000006_137222_137797 191
549 3300053119 Ga0500595_033982 Ga0500595_033982_522_1127 191
550 3300053139 Ga0500568_0000575 Ga0500568_0000575_19729_20304 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

178

234

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

117

170

0.97

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

50

109

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.8569 7 64
1yby-assembly1.cif.gz_A conserved hypothetical protein cth-95 from clostridium thermocellum 0.8498 7 191
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8451 15 65
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.8337 7 139
1yby-assembly1.cif.gz_A conserved hypothetical protein cth-95 from clostridium thermocellum 0.8326 7 191
ID Description Score Start End Superfamily
3huyV03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9605 134 191 2.40.50.140
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9558 14 67 2.30.30.30
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9536 134 191 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9418 70 131 2.40.50.140
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9294 15 67 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2V8NME1-F1-model_v4 Elongation factor P 0.9666 73 191 GO:0003746
GO:0005737
GO:0043043
AF-K2EBP1-F1-model_v4 Elongation factor P 0.9519 69 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A2V8NME1-F1-model_v4 Elongation factor P 0.9511 73 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A1F7VGA1-F1-model_v4 Elongation factor P 0.9425 63 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A6G4ZQB9-F1-model_v4 Elongation factor P 0.9298 15 191 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
90.98 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map