F462535
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 550 | 216 | 550 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300046679|Ga0495623_0205264|Ga0495623_0205264_377_1084 |
| Length | 235 |
| Sequence | MLLLKKREKWRTPSYFGRRSKDEPALYFRRNVAQPAFGAFAEENMAALIDAIDVKRKMFFELENTPFVCLEAEVSTPTARGGQTLVRLKMRNLLTRAVFDKAFKASDRFKEPDLQTVPASYLYSDGSGFHFMDQESFETLTLSGEMIGDALDFIVEGAIIQLHKYNGNPIGLQLPAQVELNVTYTEPGVRGDTSSGSVTKPAKLETGIEIRVPLFIKEGETIKVSTETREFAGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 74 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 125 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 147 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 215 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 216 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 3.09 |
| Rhizosphere | 96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10096129 | 3300005327 | Bacteria | 2445 |
| 2 | Ga0070658_10125386 | 3300005327 | Bacteria | 2137 |
| 3 | Ga0070658_10300992 | 3300005327 | Bacteria | 1367 |
| 4 | Ga0070683_100012692 | 3300005329 | Bacteria | 7327 |
| 5 | Ga0070683_100183058 | 3300005329 | Bacteria | 1989 |
| 6 | Ga0070683_100816437 | 3300005329 | Bacteria | 894 |
| 7 | Ga0068869_100215005 | 3300005334 | Unclassified | 1521 |
| 8 | Ga0070666_10365495 | 3300005335 | Unclassified | 1034 |
| 9 | Ga0070680_100111985 | 3300005336 | Bacteria | 2272 |
| 10 | Ga0070680_100283910 | 3300005336 | Bacteria | 1403 |
| 11 | Ga0070680_100549375 | 3300005336 | Bacteria | 990 |
| 12 | Ga0070682_100192845 | 3300005337 | Bacteria | 1432 |
| 13 | Ga0070682_100350424 | 3300005337 | Bacteria | 1100 |
| 14 | Ga0070682_100718222 | 3300005337 | Bacteria | 803 |
| 15 | Ga0068868_100018305 | 3300005338 | Bacteria | 5235 |
| 16 | Ga0068868_100025433 | 3300005338 | Unclassified | 4503 |
| 17 | Ga0068868_100056939 | 3300005338 | Bacteria | 3088 |
| 18 | Ga0070660_100012352 | 3300005339 | Bacteria | 6096 |
| 19 | Ga0070660_100109015 | 3300005339 | Bacteria | 2201 |
| 20 | Ga0070660_100553669 | 3300005339 | Bacteria | 960 |
| 21 | Ga0070691_10417031 | 3300005341 | Bacteria | 760 |
| 22 | Ga0070661_100050669 | 3300005344 | Bacteria | 3038 |
| 23 | Ga0070671_100083926 | 3300005355 | Unclassified | 2664 |
| 24 | Ga0070671_100795194 | 3300005355 | Bacteria | 823 |
| 25 | Ga0070673_100415723 | 3300005364 | Bacteria | 1205 |
| 26 | Ga0070659_100123091 | 3300005366 | Bacteria | 2102 |
| 27 | Ga0070659_100171737 | 3300005366 | Bacteria | 1776 |
| 28 | Ga0070659_100264950 | 3300005366 | Bacteria | 1426 |
| 29 | Ga0070659_100667644 | 3300005366 | Bacteria | 897 |
| 30 | Ga0070659_100757832 | 3300005366 | Unclassified | 842 |
| 31 | Ga0070667_100164689 | 3300005367 | Unclassified | 1955 |
| 32 | Ga0070667_100492363 | 3300005367 | Unclassified | 1123 |
| 33 | Ga0070709_10274811 | 3300005434 | Bacteria | 1222 |
| 34 | Ga0070714_100361174 | 3300005435 | Unclassified | 1365 |
| 35 | Ga0070714_100439412 | 3300005435 | Unclassified | 1238 |
| 36 | Ga0070714_100455506 | 3300005435 | Bacteria | 1216 |
| 37 | Ga0070713_100008610 | 3300005436 | Bacteria | 7246 |
| 38 | Ga0070713_100106403 | 3300005436 | Unclassified | 2438 |
| 39 | Ga0070713_100117802 | 3300005436 | Bacteria | 2324 |
| 40 | Ga0070713_100263601 | 3300005436 | Bacteria | 1575 |
| 41 | Ga0070710_10145406 | 3300005437 | Bacteria | 1457 |
| 42 | Ga0070711_100638954 | 3300005439 | Bacteria | 891 |
| 43 | Ga0070711_100742905 | 3300005439 | Bacteria | 829 |
| 44 | Ga0070663_100019061 | 3300005455 | Bacteria | 4513 |
| 45 | Ga0070663_100071778 | 3300005455 | Bacteria | 2520 |
| 46 | Ga0070663_100111641 | 3300005455 | Bacteria | 2055 |
| 47 | Ga0070663_100447996 | 3300005455 | Bacteria | 1063 |
| 48 | Ga0070678_100228113 | 3300005456 | Bacteria | 1551 |
| 49 | Ga0070681_10001115 | 3300005458 | Bacteria | 23009 |
| 50 | Ga0070681_10046656 | 3300005458 | Bacteria | 4331 |
| 51 | Ga0070681_10115114 | 3300005458 | Bacteria | 2627 |
| 52 | Ga0070681_10211333 | 3300005458 | Bacteria | 1856 |
| 53 | Ga0070681_10262062 | 3300005458 | Bacteria | 1640 |
| 54 | Ga0070681_10348103 | 3300005458 | Unclassified | 1392 |
| 55 | Ga0070681_10488115 | 3300005458 | Unclassified | 1145 |
| 56 | Ga0070681_10909452 | 3300005458 | Unclassified | 798 |
| 57 | Ga0070681_11054945 | 3300005458 | Bacteria | 733 |
| 58 | Ga0070698_100540179 | 3300005471 | Unclassified | 1105 |
| 59 | Ga0070699_100213668 | 3300005518 | Bacteria | 1718 |
| 60 | Ga0070679_100076631 | 3300005530 | Unclassified | 3333 |
| 61 | Ga0070679_100185260 | 3300005530 | Bacteria | 2053 |
| 62 | Ga0070679_100193631 | 3300005530 | Bacteria | 2001 |
| 63 | Ga0070679_100224303 | 3300005530 | Bacteria | 1840 |
| 64 | Ga0070679_100517805 | 3300005530 | Bacteria | 1137 |
| 65 | Ga0070684_100028880 | 3300005535 | Bacteria | 4694 |
| 66 | Ga0070684_100260595 | 3300005535 | Bacteria | 1586 |
| 67 | Ga0070684_101235392 | 3300005535 | Bacteria | 703 |
| 68 | Ga0070697_100268373 | 3300005536 | Bacteria | 1462 |
| 69 | Ga0068853_100005299 | 3300005539 | Bacteria | 10092 |
| 70 | Ga0068853_100014854 | 3300005539 | Bacteria | 6394 |
| 71 | Ga0068853_100306795 | 3300005539 | Bacteria | 1468 |
| 72 | Ga0068853_100724190 | 3300005539 | Unclassified | 950 |
| 73 | Ga0070693_100009529 | 3300005547 | Bacteria | 4830 |
| 74 | Ga0070693_100481831 | 3300005547 | Unclassified | 876 |
| 75 | Ga0070665_100162498 | 3300005548 | Unclassified | 2235 |
| 76 | Ga0070665_100217052 | 3300005548 | Bacteria | 1913 |
| 77 | Ga0070665_101055446 | 3300005548 | Unclassified | 824 |
| 78 | Ga0068855_100003377 | 3300005563 | Bacteria | 19556 |
| 79 | Ga0068855_100006382 | 3300005563 | Bacteria | 14369 |
| 80 | Ga0068855_100008015 | 3300005563 | Bacteria | 12760 |
| 81 | Ga0068855_100017513 | 3300005563 | Bacteria | 8615 |
| 82 | Ga0068855_100022876 | 3300005563 | Bacteria | 7491 |
| 83 | Ga0068855_100045145 | 3300005563 | Bacteria | 5212 |
| 84 | Ga0068855_100049988 | 3300005563 | Bacteria | 4929 |
| 85 | Ga0068855_100182493 | 3300005563 | Unclassified | 2372 |
| 86 | Ga0068855_100188211 | 3300005563 | Unclassified | 2330 |
| 87 | Ga0068855_100312225 | 3300005563 | Bacteria | 1739 |
| 88 | Ga0068855_100369326 | 3300005563 | Bacteria | 1577 |
| 89 | Ga0068855_100461176 | 3300005563 | Unclassified | 1385 |
| 90 | Ga0068855_100514980 | 3300005563 | Bacteria | 1299 |
| 91 | Ga0068855_100719482 | 3300005563 | Bacteria | 1067 |
| 92 | Ga0070664_100057380 | 3300005564 | Unclassified | 3309 |
| 93 | Ga0068857_100016775 | 3300005577 | Bacteria | 6416 |
| 94 | Ga0068857_100019955 | 3300005577 | Bacteria | 5891 |
| 95 | Ga0068857_100038886 | 3300005577 | Bacteria | 4212 |
| 96 | Ga0068857_100367750 | 3300005577 | Bacteria | 1334 |
| 97 | Ga0068854_100011918 | 3300005578 | Bacteria | 5681 |
| 98 | Ga0068854_100270563 | 3300005578 | Bacteria | 1364 |
| 99 | Ga0068854_100566346 | 3300005578 | Bacteria | 966 |
| 100 | Ga0068854_100879883 | 3300005578 | Bacteria | 786 |
| 101 | Ga0068854_101068120 | 3300005578 | Bacteria | 718 |
| 102 | Ga0068856_100002791 | 3300005614 | Bacteria | 17875 |
| 103 | Ga0068856_100048003 | 3300005614 | Bacteria | 4207 |
| 104 | Ga0068856_100461216 | 3300005614 | Bacteria | 1291 |
| 105 | Ga0068856_100934647 | 3300005614 | Bacteria | 886 |
| 106 | Ga0068856_101154023 | 3300005614 | Bacteria | 791 |
| 107 | Ga0068856_101171713 | 3300005614 | Unclassified | 785 |
| 108 | Ga0068852_100017305 | 3300005616 | Bacteria | 5651 |
| 109 | Ga0068852_100024157 | 3300005616 | Unclassified | 4908 |
| 110 | Ga0068852_100057574 | 3300005616 | Bacteria | 3363 |
| 111 | Ga0068852_100143069 | 3300005616 | Bacteria | 2215 |
| 112 | Ga0068852_100163224 | 3300005616 | Bacteria | 2082 |
| 113 | Ga0068866_10063458 | 3300005718 | Unclassified | 1926 |
| 114 | Ga0068851_10011738 | 3300005834 | Bacteria | 4114 |
| 115 | Ga0068851_10145946 | 3300005834 | Bacteria | 1290 |
| 116 | Ga0068863_100026223 | 3300005841 | Bacteria | 5561 |
| 117 | Ga0068863_100036145 | 3300005841 | Bacteria | 4705 |
| 118 | Ga0068863_100162797 | 3300005841 | Bacteria | 2138 |
| 119 | Ga0068863_100892650 | 3300005841 | Bacteria | 889 |
| 120 | Ga0068858_100041407 | 3300005842 | Bacteria | 4271 |
| 121 | Ga0068858_100178742 | 3300005842 | Unclassified | 2003 |
| 122 | Ga0068858_100519795 | 3300005842 | Unclassified | 1151 |
| 123 | Ga0068858_100824380 | 3300005842 | Bacteria | 905 |
| 124 | Ga0068860_100317661 | 3300005843 | Bacteria | 1528 |
| 125 | Ga0070717_10002732 | 3300006028 | Bacteria | 12463 |
| 126 | Ga0070716_100530882 | 3300006173 | Bacteria | 874 |
| 127 | Ga0070712_100152637 | 3300006175 | Unclassified | 1775 |
| 128 | Ga0070712_100566923 | 3300006175 | Unclassified | 958 |
| 129 | Ga0097621_100001290 | 3300006237 | Bacteria | 17232 |
| 130 | Ga0097621_100053238 | 3300006237 | Bacteria | 3299 |
| 131 | Ga0097621_100059655 | 3300006237 | Unclassified | 3125 |
| 132 | Ga0097621_100243395 | 3300006237 | Bacteria | 1573 |
| 133 | Ga0068871_100059729 | 3300006358 | Unclassified | 3108 |
| 134 | Ga0068871_100189941 | 3300006358 | Bacteria | 1769 |
| 135 | Ga0068871_100227941 | 3300006358 | Bacteria | 1616 |
| 136 | Ga0068871_100229422 | 3300006358 | Bacteria | 1611 |
| 137 | Ga0068871_100351060 | 3300006358 | Bacteria | 1305 |
| 138 | Ga0075434_100957540 | 3300006871 | Unclassified | 870 |
| 139 | Ga0068865_100037157 | 3300006881 | Bacteria | 3287 |
| 140 | Ga0099795_10173912 | 3300007788 | Bacteria | 896 |
| 141 | Ga0105240_10010798 | 3300009093 | Bacteria | 12797 |
| 142 | Ga0105240_10011435 | 3300009093 | Bacteria | 12363 |
| 143 | Ga0105240_10015786 | 3300009093 | Bacteria | 10248 |
| 144 | Ga0105240_10026891 | 3300009093 | Bacteria | 7545 |
| 145 | Ga0105240_10038651 | 3300009093 | Bacteria | 6120 |
| 146 | Ga0105240_10133041 | 3300009093 | Bacteria | 2981 |
| 147 | Ga0105240_10161890 | 3300009093 | Bacteria | 2657 |
| 148 | Ga0105240_10262856 | 3300009093 | Bacteria | 1990 |
| 149 | Ga0105240_10584041 | 3300009093 | Bacteria | 1232 |
| 150 | Ga0105240_10609269 | 3300009093 | Bacteria | 1201 |
| 151 | Ga0105240_11480975 | 3300009093 | Unclassified | 712 |
| 152 | Ga0105245_10004706 | 3300009098 | Bacteria | 12061 |
| 153 | Ga0105245_10031974 | 3300009098 | Bacteria | 4659 |
| 154 | Ga0105245_10071470 | 3300009098 | Bacteria | 3151 |
| 155 | Ga0105247_10106250 | 3300009101 | Unclassified | 1801 |
| 156 | Ga0105243_10058162 | 3300009148 | Bacteria | 3080 |
| 157 | Ga0105241_10000146 | 3300009174 | Bacteria | 50607 |
| 158 | Ga0105241_10011226 | 3300009174 | Bacteria | 6567 |
| 159 | Ga0105241_10018317 | 3300009174 | Bacteria | 5151 |
| 160 | Ga0105241_10076731 | 3300009174 | Unclassified | 2607 |
| 161 | Ga0105241_10094492 | 3300009174 | Bacteria | 2365 |
| 162 | Ga0105241_10110363 | 3300009174 | Bacteria | 2200 |
| 163 | Ga0105241_10177930 | 3300009174 | Bacteria | 1762 |
| 164 | Ga0105241_10218236 | 3300009174 | Bacteria | 1601 |
| 165 | Ga0105242_10014183 | 3300009176 | Bacteria | 6171 |
| 166 | Ga0105242_10349732 | 3300009176 | Unclassified | 1365 |
| 167 | Ga0105242_10371349 | 3300009176 | Unclassified | 1327 |
| 168 | Ga0105242_10786678 | 3300009176 | Unclassified | 940 |
| 169 | Ga0105242_11119857 | 3300009176 | Unclassified | 802 |
| 170 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 171 | Ga0105248_10002961 | 3300009177 | Bacteria | 18814 |
| 172 | Ga0105248_10033566 | 3300009177 | Bacteria | 5733 |
| 173 | Ga0105248_10042059 | 3300009177 | Bacteria | 5125 |
| 174 | Ga0105248_10054712 | 3300009177 | Bacteria | 4476 |
| 175 | Ga0105248_10237838 | 3300009177 | Unclassified | 2050 |
| 176 | Ga0105248_10283413 | 3300009177 | Bacteria | 1865 |
| 177 | Ga0105248_10608170 | 3300009177 | Bacteria | 1233 |
| 178 | Ga0105237_10095623 | 3300009545 | Bacteria | 2960 |
| 179 | Ga0105237_10111838 | 3300009545 | Bacteria | 2723 |
| 180 | Ga0105237_10147252 | 3300009545 | Bacteria | 2350 |
| 181 | Ga0105237_10219343 | 3300009545 | Unclassified | 1902 |
| 182 | Ga0105237_10393034 | 3300009545 | Bacteria | 1391 |
| 183 | Ga0105237_10438076 | 3300009545 | Bacteria | 1312 |
| 184 | Ga0105237_10929626 | 3300009545 | Bacteria | 877 |
| 185 | Ga0105237_11285368 | 3300009545 | Bacteria | 738 |
| 186 | Ga0105237_11437937 | 3300009545 | Unclassified | 696 |
| 187 | Ga0105238_10012438 | 3300009551 | Bacteria | 8584 |
| 188 | Ga0105238_10027728 | 3300009551 | Bacteria | 5773 |
| 189 | Ga0105238_10027782 | 3300009551 | Bacteria | 5766 |
| 190 | Ga0105238_10053044 | 3300009551 | Bacteria | 4075 |
| 191 | Ga0105238_10059896 | 3300009551 | Unclassified | 3813 |
| 192 | Ga0105238_10088539 | 3300009551 | Bacteria | 3082 |
| 193 | Ga0105238_10125337 | 3300009551 | Bacteria | 2547 |
| 194 | Ga0105238_10274641 | 3300009551 | Bacteria | 1666 |
| 195 | Ga0105238_10874615 | 3300009551 | Bacteria | 916 |
| 196 | Ga0105238_11915993 | 3300009551 | Bacteria | 626 |
| 197 | Ga0105239_10012806 | 3300010375 | Bacteria | 9331 |
| 198 | Ga0105239_10031460 | 3300010375 | Bacteria | 5835 |
| 199 | Ga0105239_10033892 | 3300010375 | Bacteria | 5605 |
| 200 | Ga0105239_10063854 | 3300010375 | Bacteria | 4042 |
| 201 | Ga0105239_10113203 | 3300010375 | Unclassified | 3009 |
| 202 | Ga0105239_10147049 | 3300010375 | Unclassified | 2629 |
| 203 | Ga0105239_11326304 | 3300010375 | Bacteria | 830 |
| 204 | Ga0105239_11504950 | 3300010375 | Unclassified | 778 |
| 205 | Ga0157373_10088355 | 3300013100 | Bacteria | 2183 |
| 206 | Ga0157371_10064445 | 3300013102 | Bacteria | 2596 |
| 207 | Ga0157370_10015391 | 3300013104 | Bacteria | 7774 |
| 208 | Ga0157370_10036212 | 3300013104 | Bacteria | 4790 |
| 209 | Ga0157370_10036704 | 3300013104 | Bacteria | 4754 |
| 210 | Ga0157370_10043087 | 3300013104 | Bacteria | 4345 |
| 211 | Ga0157370_10051095 | 3300013104 | Bacteria | 3949 |
| 212 | Ga0157370_10071115 | 3300013104 | Bacteria | 3283 |
| 213 | Ga0157370_10096055 | 3300013104 | Bacteria | 2780 |
| 214 | Ga0157370_10237501 | 3300013104 | Bacteria | 1687 |
| 215 | Ga0157370_10376726 | 3300013104 | Bacteria | 1307 |
| 216 | Ga0157370_11012827 | 3300013104 | Bacteria | 752 |
| 217 | Ga0157370_11108174 | 3300013104 | Bacteria | 715 |
| 218 | Ga0157369_10001300 | 3300013105 | Bacteria | 31037 |
| 219 | Ga0157369_10015873 | 3300013105 | Bacteria | 8481 |
| 220 | Ga0157369_10021067 | 3300013105 | Bacteria | 7288 |
| 221 | Ga0157369_10050642 | 3300013105 | Bacteria | 4496 |
| 222 | Ga0157369_10085700 | 3300013105 | Bacteria | 3366 |
| 223 | Ga0157369_10164312 | 3300013105 | Bacteria | 2342 |
| 224 | Ga0157369_10292098 | 3300013105 | Unclassified | 1697 |
| 225 | Ga0157369_10372273 | 3300013105 | Bacteria | 1483 |
| 226 | Ga0157369_10379678 | 3300013105 | Bacteria | 1467 |
| 227 | Ga0157369_11022876 | 3300013105 | Bacteria | 846 |
| 228 | Ga0157369_11123791 | 3300013105 | Bacteria | 803 |
| 229 | Ga0157369_11662532 | 3300013105 | Bacteria | 649 |
| 230 | Ga0157374_10006059 | 3300013296 | Bacteria | 10235 |
| 231 | Ga0157374_10014501 | 3300013296 | Bacteria | 6897 |
| 232 | Ga0157374_10056732 | 3300013296 | Unclassified | 3657 |
| 233 | Ga0157374_10065905 | 3300013296 | Bacteria | 3403 |
| 234 | Ga0157374_10133160 | 3300013296 | Bacteria | 2407 |
| 235 | Ga0157374_10984309 | 3300013296 | Bacteria | 862 |
| 236 | Ga0157378_10000160 | 3300013297 | Bacteria | 63958 |
| 237 | Ga0157378_10057625 | 3300013297 | Bacteria | 3463 |
| 238 | Ga0157378_10082690 | 3300013297 | Unclassified | 2904 |
| 239 | Ga0163162_10003329 | 3300013306 | Bacteria | 15376 |
| 240 | Ga0163162_10051839 | 3300013306 | Bacteria | 4119 |
| 241 | Ga0163162_10055653 | 3300013306 | Unclassified | 3984 |
| 242 | Ga0163162_10086083 | 3300013306 | Unclassified | 3220 |
| 243 | Ga0163162_10165216 | 3300013306 | Unclassified | 2337 |
| 244 | Ga0163162_11375150 | 3300013306 | Bacteria | 803 |
| 245 | Ga0157372_10003405 | 3300013307 | Bacteria | 17169 |
| 246 | Ga0157372_10012941 | 3300013307 | Bacteria | 8895 |
| 247 | Ga0157372_10092084 | 3300013307 | Bacteria | 3448 |
| 248 | Ga0157372_10136782 | 3300013307 | Bacteria | 2822 |
| 249 | Ga0157372_10167467 | 3300013307 | Unclassified | 2541 |
| 250 | Ga0157372_10326891 | 3300013307 | Bacteria | 1785 |
| 251 | Ga0157372_10419308 | 3300013307 | Bacteria | 1560 |
| 252 | Ga0157372_10520001 | 3300013307 | Bacteria | 1387 |
| 253 | Ga0157372_10605477 | 3300013307 | Bacteria | 1277 |
| 254 | Ga0157372_10618022 | 3300013307 | Unclassified | 1263 |
| 255 | Ga0157375_10035479 | 3300013308 | Bacteria | 4761 |
| 256 | Ga0157375_10044239 | 3300013308 | Bacteria | 4324 |
| 257 | Ga0157375_10231354 | 3300013308 | Bacteria | 2007 |
| 258 | Ga0157375_10615922 | 3300013308 | Unclassified | 1244 |
| 259 | Ga0163163_10039007 | 3300014325 | Bacteria | 4633 |
| 260 | Ga0163163_10119914 | 3300014325 | Bacteria | 2664 |
| 261 | Ga0157380_10602108 | 3300014326 | Bacteria | 1087 |
| 262 | Ga0157379_10094376 | 3300014968 | Bacteria | 2684 |
| 263 | Ga0157379_10519370 | 3300014968 | Unclassified | 1105 |
| 264 | Ga0157379_11442008 | 3300014968 | Bacteria | 668 |
| 265 | Ga0157376_10005077 | 3300014969 | Bacteria | 9180 |
| 266 | Ga0157376_10009944 | 3300014969 | Bacteria | 6939 |
| 267 | Ga0157376_10017421 | 3300014969 | Bacteria | 5480 |
| 268 | Ga0157376_10071562 | 3300014969 | Unclassified | 2947 |
| 269 | Ga0157376_10368740 | 3300014969 | Bacteria | 1379 |
| 270 | Ga0157376_10810767 | 3300014969 | Unclassified | 949 |
| 271 | Ga0224569_103564 | 3300022732 | Bacteria | 1214 |
| 272 | Ga0228598_1001829 | 3300024227 | Bacteria | 4628 |
| 273 | Ga0207692_10081110 | 3300025898 | Bacteria | 1735 |
| 274 | Ga0207642_10054770 | 3300025899 | Bacteria | 1821 |
| 275 | Ga0207710_10259056 | 3300025900 | Bacteria | 871 |
| 276 | Ga0207647_10001933 | 3300025904 | Bacteria | 15834 |
| 277 | Ga0207647_10006057 | 3300025904 | Bacteria | 8814 |
| 278 | Ga0207685_10255223 | 3300025905 | Bacteria | 850 |
| 279 | Ga0207699_10202067 | 3300025906 | Bacteria | 1347 |
| 280 | Ga0207699_10305092 | 3300025906 | Unclassified | 1113 |
| 281 | Ga0207699_10469559 | 3300025906 | Bacteria | 905 |
| 282 | Ga0207705_10000171 | 3300025909 | Bacteria | 69439 |
| 283 | Ga0207705_10000405 | 3300025909 | Bacteria | 37816 |
| 284 | Ga0207705_10107734 | 3300025909 | Bacteria | 2056 |
| 285 | Ga0207705_10274159 | 3300025909 | Bacteria | 1290 |
| 286 | Ga0207654_10015153 | 3300025911 | Bacteria | 3994 |
| 287 | Ga0207654_10015292 | 3300025911 | Unclassified | 3980 |
| 288 | Ga0207654_10123633 | 3300025911 | Bacteria | 1628 |
| 289 | Ga0207654_10258486 | 3300025911 | Bacteria | 1170 |
| 290 | Ga0207707_10025388 | 3300025912 | Bacteria | 5184 |
| 291 | Ga0207707_10050158 | 3300025912 | Bacteria | 3636 |
| 292 | Ga0207707_10104691 | 3300025912 | Bacteria | 2473 |
| 293 | Ga0207707_10159542 | 3300025912 | Bacteria | 1972 |
| 294 | Ga0207707_10366027 | 3300025912 | Bacteria | 1241 |
| 295 | Ga0207707_10810557 | 3300025912 | Bacteria | 779 |
| 296 | Ga0207707_10910697 | 3300025912 | Unclassified | 726 |
| 297 | Ga0207695_10000341 | 3300025913 | Bacteria | 109857 |
| 298 | Ga0207695_10008580 | 3300025913 | Bacteria | 12771 |
| 299 | Ga0207695_10016432 | 3300025913 | Bacteria | 8659 |
| 300 | Ga0207695_10032214 | 3300025913 | Bacteria | 5739 |
| 301 | Ga0207695_10115327 | 3300025913 | Bacteria | 2661 |
| 302 | Ga0207695_10116452 | 3300025913 | Bacteria | 2646 |
| 303 | Ga0207695_10184092 | 3300025913 | Unclassified | 2009 |
| 304 | Ga0207695_10332490 | 3300025913 | Bacteria | 1408 |
| 305 | Ga0207695_10456597 | 3300025913 | Bacteria | 1161 |
| 306 | Ga0207695_10469742 | 3300025913 | Unclassified | 1140 |
| 307 | Ga0207695_10605886 | 3300025913 | Unclassified | 976 |
| 308 | Ga0207671_10050120 | 3300025914 | Bacteria | 3091 |
| 309 | Ga0207671_10316558 | 3300025914 | Unclassified | 1234 |
| 310 | Ga0207671_10368908 | 3300025914 | Unclassified | 1140 |
| 311 | Ga0207693_10022454 | 3300025915 | Bacteria | 5014 |
| 312 | Ga0207693_10360371 | 3300025915 | Unclassified | 1138 |
| 313 | Ga0207693_10364286 | 3300025915 | Unclassified | 1131 |
| 314 | Ga0207660_10128835 | 3300025917 | Bacteria | 1924 |
| 315 | Ga0207660_10832319 | 3300025917 | Bacteria | 753 |
| 316 | Ga0207657_10000747 | 3300025919 | Bacteria | 34417 |
| 317 | Ga0207657_10001086 | 3300025919 | Bacteria | 28797 |
| 318 | Ga0207652_10065014 | 3300025921 | Unclassified | 3157 |
| 319 | Ga0207652_10183091 | 3300025921 | Bacteria | 1883 |
| 320 | Ga0207652_10216137 | 3300025921 | Bacteria | 1727 |
| 321 | Ga0207652_10429601 | 3300025921 | Bacteria | 1191 |
| 322 | Ga0207694_10003332 | 3300025924 | Bacteria | 12775 |
| 323 | Ga0207694_10005586 | 3300025924 | Bacteria | 9640 |
| 324 | Ga0207694_10033987 | 3300025924 | Bacteria | 3908 |
| 325 | Ga0207694_10080152 | 3300025924 | Bacteria | 2562 |
| 326 | Ga0207694_10225722 | 3300025924 | Bacteria | 1528 |
| 327 | Ga0207694_10372767 | 3300025924 | Unclassified | 1184 |
| 328 | Ga0207650_10680618 | 3300025925 | Unclassified | 868 |
| 329 | Ga0207659_10544789 | 3300025926 | Bacteria | 986 |
| 330 | Ga0207687_10006394 | 3300025927 | Bacteria | 7786 |
| 331 | Ga0207687_10014284 | 3300025927 | Bacteria | 5196 |
| 332 | Ga0207687_10080839 | 3300025927 | Bacteria | 2347 |
| 333 | Ga0207687_10680786 | 3300025927 | Bacteria | 872 |
| 334 | Ga0207700_10012412 | 3300025928 | Bacteria | 5494 |
| 335 | Ga0207700_10083160 | 3300025928 | Bacteria | 2505 |
| 336 | Ga0207700_10111020 | 3300025928 | Unclassified | 2206 |
| 337 | Ga0207700_10243763 | 3300025928 | Bacteria | 1533 |
| 338 | Ga0207700_10383571 | 3300025928 | Bacteria | 1229 |
| 339 | Ga0207700_10923409 | 3300025928 | Bacteria | 781 |
| 340 | Ga0207664_10005557 | 3300025929 | Bacteria | 8631 |
| 341 | Ga0207664_10744983 | 3300025929 | Unclassified | 881 |
| 342 | Ga0207644_11205604 | 3300025931 | Bacteria | 636 |
| 343 | Ga0207690_10388746 | 3300025932 | Bacteria | 1110 |
| 344 | Ga0207704_10104688 | 3300025938 | Bacteria | 1896 |
| 345 | Ga0207665_10039607 | 3300025939 | Bacteria | 3142 |
| 346 | Ga0207665_10418297 | 3300025939 | Unclassified | 1023 |
| 347 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 348 | Ga0207711_10007356 | 3300025941 | Bacteria | 9216 |
| 349 | Ga0207711_10064945 | 3300025941 | Unclassified | 3153 |
| 350 | Ga0207711_10080562 | 3300025941 | Bacteria | 2844 |
| 351 | Ga0207711_10133977 | 3300025941 | Bacteria | 2224 |
| 352 | Ga0207711_10194195 | 3300025941 | Bacteria | 1851 |
| 353 | Ga0207711_10221797 | 3300025941 | Bacteria | 1729 |
| 354 | Ga0207711_10412578 | 3300025941 | Bacteria | 1255 |
| 355 | Ga0207689_10235772 | 3300025942 | Unclassified | 1512 |
| 356 | Ga0207661_10063760 | 3300025944 | Bacteria | 2985 |
| 357 | Ga0207661_10209450 | 3300025944 | Unclassified | 1717 |
| 358 | Ga0207661_10246960 | 3300025944 | Bacteria | 1585 |
| 359 | Ga0207661_11212151 | 3300025944 | Bacteria | 694 |
| 360 | Ga0207679_10638257 | 3300025945 | Bacteria | 962 |
| 361 | Ga0207679_11099786 | 3300025945 | Bacteria | 729 |
| 362 | Ga0207667_10006944 | 3300025949 | Bacteria | 13682 |
| 363 | Ga0207667_10011261 | 3300025949 | Bacteria | 10405 |
| 364 | Ga0207667_10016174 | 3300025949 | Bacteria | 8437 |
| 365 | Ga0207667_10021169 | 3300025949 | Bacteria | 7211 |
| 366 | Ga0207667_10028898 | 3300025949 | Bacteria | 6019 |
| 367 | Ga0207667_10037861 | 3300025949 | Bacteria | 5155 |
| 368 | Ga0207667_10090807 | 3300025949 | Bacteria | 3156 |
| 369 | Ga0207667_10095983 | 3300025949 | Bacteria | 3060 |
| 370 | Ga0207667_10147997 | 3300025949 | Unclassified | 2417 |
| 371 | Ga0207667_11283702 | 3300025949 | Bacteria | 709 |
| 372 | Ga0207640_10099216 | 3300025981 | Bacteria | 2038 |
| 373 | Ga0207640_10710977 | 3300025981 | Bacteria | 862 |
| 374 | Ga0207658_10492287 | 3300025986 | Unclassified | 1091 |
| 375 | Ga0207677_10002246 | 3300026023 | Bacteria | 10141 |
| 376 | Ga0207703_10108100 | 3300026035 | Unclassified | 2369 |
| 377 | Ga0207703_10248522 | 3300026035 | Unclassified | 1602 |
| 378 | Ga0207639_10160022 | 3300026041 | Bacteria | 1896 |
| 379 | Ga0207639_10387347 | 3300026041 | Bacteria | 1256 |
| 380 | Ga0207678_10004895 | 3300026067 | Bacteria | 12032 |
| 381 | Ga0207678_10178103 | 3300026067 | Bacteria | 1815 |
| 382 | Ga0207678_10230314 | 3300026067 | Bacteria | 1586 |
| 383 | Ga0207702_10014192 | 3300026078 | Bacteria | 6617 |
| 384 | Ga0207702_10040028 | 3300026078 | Bacteria | 3929 |
| 385 | Ga0207702_10160057 | 3300026078 | Bacteria | 2055 |
| 386 | Ga0207702_10241855 | 3300026078 | Bacteria | 1691 |
| 387 | Ga0207702_10738561 | 3300026078 | Bacteria | 971 |
| 388 | Ga0207641_10023997 | 3300026088 | Bacteria | 5026 |
| 389 | Ga0207641_10996478 | 3300026088 | Bacteria | 834 |
| 390 | Ga0207648_10005760 | 3300026089 | Bacteria | 12416 |
| 391 | Ga0207676_10453403 | 3300026095 | Bacteria | 1209 |
| 392 | Ga0207674_10004620 | 3300026116 | Bacteria | 16522 |
| 393 | Ga0207674_10017687 | 3300026116 | Bacteria | 7769 |
| 394 | Ga0207674_10090366 | 3300026116 | Bacteria | 3054 |
| 395 | Ga0207674_10214834 | 3300026116 | Unclassified | 1872 |
| 396 | Ga0207674_10439429 | 3300026116 | Unclassified | 1261 |
| 397 | Ga0207674_10465681 | 3300026116 | Bacteria | 1222 |
| 398 | Ga0207698_10021915 | 3300026142 | Bacteria | 4428 |
| 399 | Ga0207698_10107624 | 3300026142 | Unclassified | 2328 |
| 400 | Ga0207698_10465141 | 3300026142 | Unclassified | 1224 |
| 401 | Ga0207698_10625926 | 3300026142 | Bacteria | 1063 |
| 402 | Ga0265356_1000302 | 3300028017 | Bacteria | 9176 |
| 403 | Ga0265356_1011454 | 3300028017 | Unclassified | 981 |
| 404 | Ga0268266_10003436 | 3300028379 | Bacteria | 15814 |
| 405 | Ga0268266_10009972 | 3300028379 | Bacteria | 8339 |
| 406 | Ga0268266_10986024 | 3300028379 | Unclassified | 815 |
| 407 | Ga0268264_10270230 | 3300028381 | Bacteria | 1588 |
| 408 | Ga0265336_10001137 | 3300028666 | Bacteria | 12751 |
| 409 | Ga0265338_10008940 | 3300028800 | Unclassified | 12047 |
| 410 | Ga0265338_10092996 | 3300028800 | Bacteria | 2486 |
| 411 | Ga0265338_10109318 | 3300028800 | Bacteria | 2231 |
| 412 | Ga0265338_10460505 | 3300028800 | Bacteria | 899 |
| 413 | Ga0265760_10000069 | 3300031090 | Bacteria | 27891 |
| 414 | Ga0265330_10003141 | 3300031235 | Bacteria | 8747 |
| 415 | Ga0265325_10037564 | 3300031241 | Bacteria | 2560 |
| 416 | Ga0265339_10078050 | 3300031249 | Bacteria | 1754 |
| 417 | Ga0265339_10092099 | 3300031249 | Bacteria | 1587 |
| 418 | Ga0265339_10108942 | 3300031249 | Bacteria | 1435 |
| 419 | Ga0265339_10230869 | 3300031249 | Bacteria | 902 |
| 420 | Ga0265316_10003667 | 3300031344 | Bacteria | 15468 |
| 421 | Ga0265316_10053544 | 3300031344 | Bacteria | 3161 |
| 422 | Ga0265316_10337998 | 3300031344 | Unclassified | 1092 |
| 423 | Ga0265314_10001685 | 3300031711 | Bacteria | 24061 |
| 424 | Ga0265314_10128441 | 3300031711 | Bacteria | 1584 |
| 425 | Ga0265342_10056368 | 3300031712 | Bacteria | 2329 |
| 426 | Ga0307510_10124214 | 3300033180 | Bacteria | 2276 |
| 427 | Ga0307510_10412711 | 3300033180 | Unclassified | 793 |
| 428 | Ga0373926_0036389 | 3300035083 | Bacteria | 1748 |
| 429 | Ga0373934_0086161 | 3300035086 | Unclassified | 1264 |
| 430 | Ga0373923_0313940 | 3300035111 | Bacteria | 744 |
| 431 | Ga0373936_0017444 | 3300035113 | Bacteria | 2764 |
| 432 | Ga0373945_0086577 | 3300035116 | Bacteria | 1207 |
| 433 | Ga0373956_0212001 | 3300035119 | Bacteria | 919 |
| 434 | Ga0373943_0009262 | 3300035170 | Bacteria | 4413 |
| 435 | Ga0373946_0002854 | 3300035171 | Bacteria | 6122 |
| 436 | Ga0373955_0116531 | 3300035172 | Bacteria | 1549 |
| 437 | Ga0373924_0000972 | 3300035410 | Bacteria | 9074 |
| 438 | Ga0373924_0057884 | 3300035410 | Bacteria | 1617 |
| 439 | Ga0373924_0125259 | 3300035410 | Bacteria | 1116 |
| 440 | Ga0373935_0011531 | 3300035692 | Bacteria | 5306 |
| 441 | Ga0373935_0023382 | 3300035692 | Bacteria | 3798 |
| 442 | Ga0373935_0583670 | 3300035692 | Bacteria | 816 |
| 443 | Ga0373927_0012566 | 3300035695 | Bacteria | 5637 |
| 444 | Ga0373927_0055229 | 3300035695 | Bacteria | 2568 |
| 445 | Ga0373947_0020567 | 3300035725 | Bacteria | 3811 |
| 446 | Ga0373937_0000390 | 3300036401 | Bacteria | 40856 |
| 447 | Ga0373937_0007774 | 3300036401 | Bacteria | 9297 |
| 448 | Ga0373937_0035383 | 3300036401 | Unclassified | 4546 |
| 449 | Ga0373937_1073251 | 3300036401 | Unclassified | 754 |
| 450 | Ga0373925_0010808 | 3300037068 | Bacteria | 6619 |
| 451 | Ga0373925_0067665 | 3300037068 | Unclassified | 2694 |
| 452 | Ga0373925_0693500 | 3300037068 | Unclassified | 839 |
| 453 | Ga0373925_0890593 | 3300037068 | Bacteria | 733 |
| 454 | Ga0395898_0030053 | 3300037466 | Bacteria | 5440 |
| 455 | Ga0436361_0519733 | 3300039447 | Bacteria | 1204 |
| 456 | Ga0436361_0663741 | 3300039447 | Bacteria | 2173 |
| 457 | Ga0436362_0554140 | 3300039453 | Bacteria | 697 |
| 458 | Ga0451577_0062378 | 3300042876 | Bacteria | 3324 |
| 459 | Ga0451577_0123286 | 3300042876 | Bacteria | 2321 |
| 460 | Ga0453683_0055465 | 3300044673 | Bacteria | 2480 |
| 461 | Ga0453683_0099833 | 3300044673 | Bacteria | 1822 |
| 462 | Ga0466963_0002421 | 3300044694 | Bacteria | 10434 |
| 463 | Ga0466963_0102992 | 3300044694 | Unclassified | 1955 |
| 464 | Ga0453684_0410582 | 3300044712 | Bacteria | 1514 |
| 465 | Ga0466957_0000242 | 3300044842 | Bacteria | 26107 |
| 466 | Ga0466957_0061703 | 3300044842 | Unclassified | 2302 |
| 467 | Ga0451576_0100969 | 3300045051 | Bacteria | 3000 |
| 468 | Ga0451576_0504139 | 3300045051 | Bacteria | 1271 |
| 469 | Ga0451576_0643324 | 3300045051 | Bacteria | 1114 |
| 470 | Ga0466958_0104949 | 3300045836 | Unclassified | 1760 |
| 471 | Ga0466967_0002153 | 3300045976 | Bacteria | 12094 |
| 472 | Ga0466967_0312665 | 3300045976 | Bacteria | 1513 |
| 473 | Ga0495592_0063194 | 3300046454 | Bacteria | 2716 |
| 474 | Ga0495651_0011687 | 3300046462 | Bacteria | 6750 |
| 475 | Ga0495651_0097452 | 3300046462 | Unclassified | 2196 |
| 476 | Ga0495650_0003916 | 3300046471 | Bacteria | 10507 |
| 477 | Ga0495580_0068474 | 3300046472 | Bacteria | 2482 |
| 478 | Ga0495580_0273218 | 3300046472 | Bacteria | 1154 |
| 479 | Ga0495580_0330751 | 3300046472 | Unclassified | 1035 |
| 480 | Ga0495605_0201547 | 3300046474 | Unclassified | 867 |
| 481 | Ga0495639_0043211 | 3300046475 | Unclassified | 2035 |
| 482 | Ga0495664_0011290 | 3300046477 | Bacteria | 5033 |
| 483 | Ga0495584_0258123 | 3300046491 | Bacteria | 886 |
| 484 | Ga0495585_0013633 | 3300046492 | Bacteria | 4752 |
| 485 | Ga0495596_0083431 | 3300046500 | Bacteria | 1241 |
| 486 | Ga0495608_0148419 | 3300046511 | Bacteria | 1495 |
| 487 | Ga0495620_0286697 | 3300046515 | Bacteria | 626 |
| 488 | Ga0495628_0205442 | 3300046516 | Bacteria | 1483 |
| 489 | Ga0495628_0298624 | 3300046516 | Bacteria | 1193 |
| 490 | Ga0495630_0126059 | 3300046517 | Bacteria | 1943 |
| 491 | Ga0495631_0031431 | 3300046518 | Bacteria | 2402 |
| 492 | Ga0495632_0028004 | 3300046519 | Bacteria | 2944 |
| 493 | Ga0495644_0000001 | 3300046523 | Bacteria | 229227 |
| 494 | Ga0495648_0222508 | 3300046524 | Unclassified | 930 |
| 495 | Ga0495642_0008687 | 3300046528 | Bacteria | 3882 |
| 496 | Ga0495652_0095944 | 3300046529 | Bacteria | 2416 |
| 497 | Ga0495587_0155009 | 3300046536 | Bacteria | 1305 |
| 498 | Ga0495645_0019022 | 3300046543 | Bacteria | 4943 |
| 499 | Ga0495633_0016264 | 3300046558 | Bacteria | 3842 |
| 500 | Ga0495668_0005181 | 3300046616 | Bacteria | 8951 |
| 501 | Ga0495634_0246115 | 3300046642 | Bacteria | 1095 |
| 502 | Ga0495611_0003508 | 3300046648 | Bacteria | 6904 |
| 503 | Ga0495625_0002024 | 3300046660 | Bacteria | 22832 |
| 504 | Ga0495625_0026462 | 3300046660 | Bacteria | 4383 |
| 505 | Ga0495625_0063401 | 3300046660 | Unclassified | 2610 |
| 506 | Ga0495635_0046370 | 3300046663 | Bacteria | 2998 |
| 507 | Ga0495661_0018456 | 3300046665 | Bacteria | 4587 |
| 508 | Ga0495657_0367835 | 3300046675 | Unclassified | 849 |
| 509 | Ga0495623_0059174 | 3300046679 | Bacteria | 2407 |
| 510 | Ga0495623_0070687 | 3300046679 | Bacteria | 2174 |
| 511 | Ga0495623_0205264 | 3300046679 | Bacteria | 1131 |
| 512 | Ga0495646_0222642 | 3300046680 | Bacteria | 1020 |
| 513 | Ga0495646_0269637 | 3300046680 | Unclassified | 907 |
| 514 | Ga0495658_0685454 | 3300046683 | Unclassified | 656 |
| 515 | Ga0495669_0023454 | 3300046684 | Bacteria | 2686 |
| 516 | Ga0495649_0228873 | 3300046694 | Bacteria | 960 |
| 517 | Ga0495600_0102928 | 3300046809 | Bacteria | 1861 |
| 518 | Ga0495581_0051399 | 3300047315 | Bacteria | 2380 |
| 519 | Ga0495604_0043645 | 3300047317 | Bacteria | 3509 |
| 520 | Ga0495604_0365942 | 3300047317 | Bacteria | 955 |
| 521 | Ga0495674_0012807 | 3300047319 | Bacteria | 7898 |
| 522 | Ga0495680_0385484 | 3300047322 | Bacteria | 970 |
| 523 | Ga0495683_0044994 | 3300047323 | Bacteria | 2219 |
| 524 | Ga0495684_0208571 | 3300047471 | Bacteria | 1438 |
| 525 | Ga0495686_0133782 | 3300047472 | Bacteria | 1468 |
| 526 | Ga0495593_0180188 | 3300047673 | Bacteria | 1064 |
| 527 | Ga0495593_0482212 | 3300047673 | Unclassified | 621 |
| 528 | Ga0495602_0547783 | 3300048088 | Bacteria | 802 |
| 529 | Ga0496101_0175838 | 3300048904 | Unclassified | 1647 |
| 530 | Ga0496102_0140314 | 3300048905 | Bacteria | 2266 |
| 531 | Ga0496104_0198640 | 3300048907 | Unclassified | 1917 |
| 532 | Ga0496105_0012352 | 3300048908 | Bacteria | 6761 |
| 533 | Ga0496105_0216322 | 3300048908 | Bacteria | 1561 |
| 534 | Ga0496105_0429545 | 3300048908 | Bacteria | 1045 |
| 535 | Ga0496106_0428733 | 3300048909 | Bacteria | 1063 |
| 536 | Ga0496108_0608690 | 3300048911 | Unclassified | 952 |
| 537 | Ga0496109_0078782 | 3300048912 | Bacteria | 3034 |
| 538 | Ga0496109_0709555 | 3300048912 | Bacteria | 943 |
| 539 | Ga0496111_0016723 | 3300048914 | Bacteria | 5060 |
| 540 | Ga0496112_0001799 | 3300048915 | Bacteria | 16870 |
| 541 | Ga0496112_0240924 | 3300048915 | Bacteria | 1761 |
| 542 | Ga0496112_0377173 | 3300048915 | Bacteria | 1359 |
| 543 | Ga0496112_0952765 | 3300048915 | Bacteria | 779 |
| 544 | Ga0496113_0000840 | 3300048916 | Bacteria | 16082 |
| 545 | Ga0496115_0069833 | 3300048918 | Bacteria | 2846 |
| 546 | Ga0501037_0136096 | 3300049573 | Bacteria | 1760 |
| 547 | Ga0495601_0002582 | 3300053077 | Bacteria | 10285 |
| 548 | Ga0500651_0000006 | 3300053093 | Bacteria | 305844 |
| 549 | Ga0500595_033982 | 3300053119 | Unclassified | 1689 |
| 550 | Ga0500568_0000575 | 3300053139 | Bacteria | 26862 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100667644 | Ga0070659_1006676441 | 190 |
| 2 | 3300005563 | Ga0068855_100514980 | Ga0068855_1005149802 | 190 |
| 3 | 3300005563 | Ga0068855_100719482 | Ga0068855_1007194821 | 190 |
| 4 | 3300013105 | Ga0157369_11022876 | Ga0157369_110228761 | 190 |
| 5 | 3300013307 | Ga0157372_10003405 | Ga0157372_1000340514 | 190 |
| 6 | 3300014968 | Ga0157379_10519370 | Ga0157379_105193701 | 190 |
| 7 | 3300025911 | Ga0207654_10123633 | Ga0207654_101236331 | 190 |
| 8 | 3300028666 | Ga0265336_10001137 | Ga0265336_1000113711 | 190 |
| 9 | 3300031235 | Ga0265330_10003141 | Ga0265330_100031417 | 190 |
| 10 | 3300031241 | Ga0265325_10037564 | Ga0265325_100375642 | 190 |
| 11 | 3300031249 | Ga0265339_10092099 | Ga0265339_100920992 | 190 |
| 12 | 3300031344 | Ga0265316_10053544 | Ga0265316_100535443 | 190 |
| 13 | 3300046472 | Ga0495580_0330751 | Ga0495580_0330751_92_664 | 190 |
| 14 | 3300046475 | Ga0495639_0043211 | Ga0495639_0043211_887_1459 | 190 |
| 15 | 3300046663 | Ga0495635_0046370 | Ga0495635_0046370_518_1090 | 190 |
| 16 | 3300046680 | Ga0495646_0269637 | Ga0495646_0269637_59_655 | 190 |
| 17 | 3300047315 | Ga0495581_0051399 | Ga0495581_0051399_1568_2140 | 190 |
| 18 | 3300047673 | Ga0495593_0482212 | Ga0495593_0482212_14_586 | 190 |
| 19 | 3300005327 | Ga0070658_10096129 | Ga0070658_100961294 | 191 |
| 20 | 3300005327 | Ga0070658_10125386 | Ga0070658_101253862 | 191 |
| 21 | 3300005327 | Ga0070658_10300992 | Ga0070658_103009923 | 191 |
| 22 | 3300005329 | Ga0070683_100012692 | Ga0070683_1000126927 | 191 |
| 23 | 3300005329 | Ga0070683_100183058 | Ga0070683_1001830582 | 191 |
| 24 | 3300005329 | Ga0070683_100816437 | Ga0070683_1008164371 | 191 |
| 25 | 3300005334 | Ga0068869_100215005 | Ga0068869_1002150051 | 191 |
| 26 | 3300005335 | Ga0070666_10365495 | Ga0070666_103654952 | 191 |
| 27 | 3300005336 | Ga0070680_100111985 | Ga0070680_1001119853 | 191 |
| 28 | 3300005336 | Ga0070680_100283910 | Ga0070680_1002839101 | 191 |
| 29 | 3300005336 | Ga0070680_100549375 | Ga0070680_1005493751 | 191 |
| 30 | 3300005337 | Ga0070682_100192845 | Ga0070682_1001928452 | 191 |
| 31 | 3300005337 | Ga0070682_100350424 | Ga0070682_1003504242 | 191 |
| 32 | 3300005337 | Ga0070682_100718222 | Ga0070682_1007182221 | 191 |
| 33 | 3300005338 | Ga0068868_100018305 | Ga0068868_1000183052 | 191 |
| 34 | 3300005338 | Ga0068868_100025433 | Ga0068868_1000254333 | 191 |
| 35 | 3300005338 | Ga0068868_100056939 | Ga0068868_1000569391 | 191 |
| 36 | 3300005339 | Ga0070660_100012352 | Ga0070660_1000123521 | 191 |
| 37 | 3300005339 | Ga0070660_100109015 | Ga0070660_1001090152 | 191 |
| 38 | 3300005339 | Ga0070660_100553669 | Ga0070660_1005536691 | 191 |
| 39 | 3300005341 | Ga0070691_10417031 | Ga0070691_104170311 | 191 |
| 40 | 3300005344 | Ga0070661_100050669 | Ga0070661_1000506693 | 191 |
| 41 | 3300005355 | Ga0070671_100083926 | Ga0070671_1000839263 | 191 |
| 42 | 3300005355 | Ga0070671_100795194 | Ga0070671_1007951941 | 191 |
| 43 | 3300005364 | Ga0070673_100415723 | Ga0070673_1004157231 | 191 |
| 44 | 3300005366 | Ga0070659_100123091 | Ga0070659_1001230912 | 191 |
| 45 | 3300005366 | Ga0070659_100171737 | Ga0070659_1001717372 | 191 |
| 46 | 3300005366 | Ga0070659_100264950 | Ga0070659_1002649503 | 191 |
| 47 | 3300005366 | Ga0070659_100757832 | Ga0070659_1007578321 | 191 |
| 48 | 3300005367 | Ga0070667_100164689 | Ga0070667_1001646892 | 191 |
| 49 | 3300005367 | Ga0070667_100492363 | Ga0070667_1004923632 | 191 |
| 50 | 3300005434 | Ga0070709_10274811 | Ga0070709_102748112 | 191 |
| 51 | 3300005435 | Ga0070714_100361174 | Ga0070714_1003611741 | 191 |
| 52 | 3300005435 | Ga0070714_100439412 | Ga0070714_1004394122 | 191 |
| 53 | 3300005435 | Ga0070714_100455506 | Ga0070714_1004555062 | 191 |
| 54 | 3300005436 | Ga0070713_100008610 | Ga0070713_1000086106 | 191 |
| 55 | 3300005436 | Ga0070713_100106403 | Ga0070713_1001064032 | 191 |
| 56 | 3300005436 | Ga0070713_100117802 | Ga0070713_1001178023 | 191 |
| 57 | 3300005436 | Ga0070713_100263601 | Ga0070713_1002636011 | 191 |
| 58 | 3300005437 | Ga0070710_10145406 | Ga0070710_101454062 | 191 |
| 59 | 3300005439 | Ga0070711_100638954 | Ga0070711_1006389541 | 191 |
| 60 | 3300005439 | Ga0070711_100742905 | Ga0070711_1007429051 | 191 |
| 61 | 3300005455 | Ga0070663_100019061 | Ga0070663_1000190612 | 191 |
| 62 | 3300005455 | Ga0070663_100071778 | Ga0070663_1000717782 | 191 |
| 63 | 3300005455 | Ga0070663_100111641 | Ga0070663_1001116412 | 191 |
| 64 | 3300005455 | Ga0070663_100447996 | Ga0070663_1004479962 | 191 |
| 65 | 3300005456 | Ga0070678_100228113 | Ga0070678_1002281132 | 191 |
| 66 | 3300005458 | Ga0070681_10001115 | Ga0070681_100011152 | 191 |
| 67 | 3300005458 | Ga0070681_10046656 | Ga0070681_100466562 | 191 |
| 68 | 3300005458 | Ga0070681_10115114 | Ga0070681_101151142 | 191 |
| 69 | 3300005458 | Ga0070681_10211333 | Ga0070681_102113332 | 191 |
| 70 | 3300005458 | Ga0070681_10262062 | Ga0070681_102620621 | 191 |
| 71 | 3300005458 | Ga0070681_10348103 | Ga0070681_103481033 | 191 |
| 72 | 3300005458 | Ga0070681_10488115 | Ga0070681_104881151 | 191 |
| 73 | 3300005458 | Ga0070681_10909452 | Ga0070681_109094521 | 191 |
| 74 | 3300005458 | Ga0070681_11054945 | Ga0070681_110549451 | 191 |
| 75 | 3300005471 | Ga0070698_100540179 | Ga0070698_1005401792 | 191 |
| 76 | 3300005518 | Ga0070699_100213668 | Ga0070699_1002136683 | 191 |
| 77 | 3300005530 | Ga0070679_100076631 | Ga0070679_1000766311 | 191 |
| 78 | 3300005530 | Ga0070679_100185260 | Ga0070679_1001852602 | 191 |
| 79 | 3300005530 | Ga0070679_100193631 | Ga0070679_1001936312 | 191 |
| 80 | 3300005530 | Ga0070679_100224303 | Ga0070679_1002243032 | 191 |
| 81 | 3300005530 | Ga0070679_100517805 | Ga0070679_1005178052 | 191 |
| 82 | 3300005535 | Ga0070684_100028880 | Ga0070684_1000288804 | 191 |
| 83 | 3300005535 | Ga0070684_100260595 | Ga0070684_1002605952 | 191 |
| 84 | 3300005535 | Ga0070684_101235392 | Ga0070684_1012353921 | 191 |
| 85 | 3300005536 | Ga0070697_100268373 | Ga0070697_1002683732 | 191 |
| 86 | 3300005539 | Ga0068853_100005299 | Ga0068853_1000052997 | 191 |
| 87 | 3300005539 | Ga0068853_100014854 | Ga0068853_1000148547 | 191 |
| 88 | 3300005539 | Ga0068853_100306795 | Ga0068853_1003067951 | 191 |
| 89 | 3300005539 | Ga0068853_100724190 | Ga0068853_1007241902 | 191 |
| 90 | 3300005547 | Ga0070693_100009529 | Ga0070693_1000095293 | 191 |
| 91 | 3300005547 | Ga0070693_100481831 | Ga0070693_1004818311 | 191 |
| 92 | 3300005548 | Ga0070665_100162498 | Ga0070665_1001624982 | 191 |
| 93 | 3300005548 | Ga0070665_100217052 | Ga0070665_1002170522 | 191 |
| 94 | 3300005548 | Ga0070665_101055446 | Ga0070665_1010554461 | 191 |
| 95 | 3300005563 | Ga0068855_100003377 | Ga0068855_1000033772 | 191 |
| 96 | 3300005563 | Ga0068855_100006382 | Ga0068855_1000063829 | 191 |
| 97 | 3300005563 | Ga0068855_100008015 | Ga0068855_1000080157 | 191 |
| 98 | 3300005563 | Ga0068855_100017513 | Ga0068855_1000175134 | 191 |
| 99 | 3300005563 | Ga0068855_100022876 | Ga0068855_1000228762 | 191 |
| 100 | 3300005563 | Ga0068855_100045145 | Ga0068855_1000451452 | 191 |
| 101 | 3300005563 | Ga0068855_100049988 | Ga0068855_1000499885 | 191 |
| 102 | 3300005563 | Ga0068855_100182493 | Ga0068855_1001824933 | 191 |
| 103 | 3300005563 | Ga0068855_100188211 | Ga0068855_1001882113 | 191 |
| 104 | 3300005563 | Ga0068855_100312225 | Ga0068855_1003122252 | 191 |
| 105 | 3300005563 | Ga0068855_100369326 | Ga0068855_1003693262 | 191 |
| 106 | 3300005563 | Ga0068855_100461176 | Ga0068855_1004611761 | 191 |
| 107 | 3300005564 | Ga0070664_100057380 | Ga0070664_1000573801 | 191 |
| 108 | 3300005577 | Ga0068857_100016775 | Ga0068857_1000167753 | 191 |
| 109 | 3300005577 | Ga0068857_100019955 | Ga0068857_1000199555 | 191 |
| 110 | 3300005577 | Ga0068857_100038886 | Ga0068857_1000388863 | 191 |
| 111 | 3300005577 | Ga0068857_100367750 | Ga0068857_1003677502 | 191 |
| 112 | 3300005578 | Ga0068854_100011918 | Ga0068854_1000119185 | 191 |
| 113 | 3300005578 | Ga0068854_100270563 | Ga0068854_1002705632 | 191 |
| 114 | 3300005578 | Ga0068854_100566346 | Ga0068854_1005663461 | 191 |
| 115 | 3300005578 | Ga0068854_100879883 | Ga0068854_1008798831 | 191 |
| 116 | 3300005578 | Ga0068854_101068120 | Ga0068854_1010681201 | 191 |
| 117 | 3300005614 | Ga0068856_100002791 | Ga0068856_10000279115 | 191 |
| 118 | 3300005614 | Ga0068856_100048003 | Ga0068856_1000480032 | 191 |
| 119 | 3300005614 | Ga0068856_100461216 | Ga0068856_1004612162 | 191 |
| 120 | 3300005614 | Ga0068856_100934647 | Ga0068856_1009346472 | 191 |
| 121 | 3300005614 | Ga0068856_101154023 | Ga0068856_1011540231 | 191 |
| 122 | 3300005614 | Ga0068856_101171713 | Ga0068856_1011717132 | 191 |
| 123 | 3300005616 | Ga0068852_100017305 | Ga0068852_1000173056 | 191 |
| 124 | 3300005616 | Ga0068852_100024157 | Ga0068852_1000241573 | 191 |
| 125 | 3300005616 | Ga0068852_100057574 | Ga0068852_1000575743 | 191 |
| 126 | 3300005616 | Ga0068852_100143069 | Ga0068852_1001430692 | 191 |
| 127 | 3300005616 | Ga0068852_100163224 | Ga0068852_1001632242 | 191 |
| 128 | 3300005718 | Ga0068866_10063458 | Ga0068866_100634581 | 191 |
| 129 | 3300005834 | Ga0068851_10011738 | Ga0068851_100117384 | 191 |
| 130 | 3300005834 | Ga0068851_10145946 | Ga0068851_101459461 | 191 |
| 131 | 3300005841 | Ga0068863_100026223 | Ga0068863_1000262236 | 191 |
| 132 | 3300005841 | Ga0068863_100036145 | Ga0068863_1000361454 | 191 |
| 133 | 3300005841 | Ga0068863_100162797 | Ga0068863_1001627973 | 191 |
| 134 | 3300005841 | Ga0068863_100892650 | Ga0068863_1008926501 | 191 |
| 135 | 3300005842 | Ga0068858_100041407 | Ga0068858_1000414071 | 191 |
| 136 | 3300005842 | Ga0068858_100178742 | Ga0068858_1001787422 | 191 |
| 137 | 3300005842 | Ga0068858_100519795 | Ga0068858_1005197952 | 191 |
| 138 | 3300005842 | Ga0068858_100824380 | Ga0068858_1008243802 | 191 |
| 139 | 3300005843 | Ga0068860_100317661 | Ga0068860_1003176612 | 191 |
| 140 | 3300006028 | Ga0070717_10002732 | Ga0070717_100027328 | 191 |
| 141 | 3300006173 | Ga0070716_100530882 | Ga0070716_1005308821 | 191 |
| 142 | 3300006175 | Ga0070712_100152637 | Ga0070712_1001526372 | 191 |
| 143 | 3300006175 | Ga0070712_100566923 | Ga0070712_1005669231 | 191 |
| 144 | 3300006237 | Ga0097621_100001290 | Ga0097621_10000129014 | 191 |
| 145 | 3300006237 | Ga0097621_100053238 | Ga0097621_1000532382 | 191 |
| 146 | 3300006237 | Ga0097621_100059655 | Ga0097621_1000596553 | 191 |
| 147 | 3300006237 | Ga0097621_100243395 | Ga0097621_1002433952 | 191 |
| 148 | 3300006358 | Ga0068871_100059729 | Ga0068871_1000597291 | 191 |
| 149 | 3300006358 | Ga0068871_100189941 | Ga0068871_1001899412 | 191 |
| 150 | 3300006358 | Ga0068871_100227941 | Ga0068871_1002279411 | 191 |
| 151 | 3300006358 | Ga0068871_100229422 | Ga0068871_1002294222 | 191 |
| 152 | 3300006358 | Ga0068871_100351060 | Ga0068871_1003510602 | 191 |
| 153 | 3300006871 | Ga0075434_100957540 | Ga0075434_1009575402 | 191 |
| 154 | 3300006881 | Ga0068865_100037157 | Ga0068865_1000371572 | 191 |
| 155 | 3300007788 | Ga0099795_10173912 | Ga0099795_101739121 | 191 |
| 156 | 3300009093 | Ga0105240_10010798 | Ga0105240_100107987 | 191 |
| 157 | 3300009093 | Ga0105240_10011435 | Ga0105240_100114358 | 191 |
| 158 | 3300009093 | Ga0105240_10015786 | Ga0105240_100157869 | 191 |
| 159 | 3300009093 | Ga0105240_10026891 | Ga0105240_100268918 | 191 |
| 160 | 3300009093 | Ga0105240_10038651 | Ga0105240_100386512 | 191 |
| 161 | 3300009093 | Ga0105240_10133041 | Ga0105240_101330413 | 191 |
| 162 | 3300009093 | Ga0105240_10161890 | Ga0105240_101618902 | 191 |
| 163 | 3300009093 | Ga0105240_10262856 | Ga0105240_102628562 | 191 |
| 164 | 3300009093 | Ga0105240_10584041 | Ga0105240_105840411 | 191 |
| 165 | 3300009093 | Ga0105240_10609269 | Ga0105240_106092692 | 191 |
| 166 | 3300009093 | Ga0105240_11480975 | Ga0105240_114809751 | 191 |
| 167 | 3300009098 | Ga0105245_10004706 | Ga0105245_1000470611 | 191 |
| 168 | 3300009098 | Ga0105245_10031974 | Ga0105245_100319743 | 191 |
| 169 | 3300009098 | Ga0105245_10071470 | Ga0105245_100714702 | 191 |
| 170 | 3300009101 | Ga0105247_10106250 | Ga0105247_101062502 | 191 |
| 171 | 3300009148 | Ga0105243_10058162 | Ga0105243_100581622 | 191 |
| 172 | 3300009174 | Ga0105241_10000146 | Ga0105241_1000014642 | 191 |
| 173 | 3300009174 | Ga0105241_10011226 | Ga0105241_100112263 | 191 |
| 174 | 3300009174 | Ga0105241_10018317 | Ga0105241_100183173 | 191 |
| 175 | 3300009174 | Ga0105241_10076731 | Ga0105241_100767312 | 191 |
| 176 | 3300009174 | Ga0105241_10094492 | Ga0105241_100944923 | 191 |
| 177 | 3300009174 | Ga0105241_10110363 | Ga0105241_101103632 | 191 |
| 178 | 3300009174 | Ga0105241_10177930 | Ga0105241_101779302 | 191 |
| 179 | 3300009174 | Ga0105241_10218236 | Ga0105241_102182361 | 191 |
| 180 | 3300009176 | Ga0105242_10014183 | Ga0105242_100141836 | 191 |
| 181 | 3300009176 | Ga0105242_10349732 | Ga0105242_103497322 | 191 |
| 182 | 3300009176 | Ga0105242_10371349 | Ga0105242_103713492 | 191 |
| 183 | 3300009176 | Ga0105242_10786678 | Ga0105242_107866781 | 191 |
| 184 | 3300009176 | Ga0105242_11119857 | Ga0105242_111198571 | 191 |
| 185 | 3300009177 | Ga0105248_10000019 | Ga0105248_1000001943 | 191 |
| 186 | 3300009177 | Ga0105248_10002961 | Ga0105248_100029619 | 191 |
| 187 | 3300009177 | Ga0105248_10033566 | Ga0105248_100335667 | 191 |
| 188 | 3300009177 | Ga0105248_10042059 | Ga0105248_100420593 | 191 |
| 189 | 3300009177 | Ga0105248_10054712 | Ga0105248_100547125 | 191 |
| 190 | 3300009177 | Ga0105248_10237838 | Ga0105248_102378383 | 191 |
| 191 | 3300009177 | Ga0105248_10283413 | Ga0105248_102834132 | 191 |
| 192 | 3300009177 | Ga0105248_10608170 | Ga0105248_106081701 | 191 |
| 193 | 3300009545 | Ga0105237_10095623 | Ga0105237_100956233 | 191 |
| 194 | 3300009545 | Ga0105237_10111838 | Ga0105237_101118382 | 191 |
| 195 | 3300009545 | Ga0105237_10147252 | Ga0105237_101472523 | 191 |
| 196 | 3300009545 | Ga0105237_10219343 | Ga0105237_102193432 | 191 |
| 197 | 3300009545 | Ga0105237_10393034 | Ga0105237_103930341 | 191 |
| 198 | 3300009545 | Ga0105237_10438076 | Ga0105237_104380761 | 191 |
| 199 | 3300009545 | Ga0105237_10929626 | Ga0105237_109296261 | 191 |
| 200 | 3300009545 | Ga0105237_11285368 | Ga0105237_112853681 | 191 |
| 201 | 3300009545 | Ga0105237_11437937 | Ga0105237_114379371 | 191 |
| 202 | 3300009551 | Ga0105238_10012438 | Ga0105238_100124382 | 191 |
| 203 | 3300009551 | Ga0105238_10027728 | Ga0105238_100277287 | 191 |
| 204 | 3300009551 | Ga0105238_10027782 | Ga0105238_100277826 | 191 |
| 205 | 3300009551 | Ga0105238_10053044 | Ga0105238_100530445 | 191 |
| 206 | 3300009551 | Ga0105238_10059896 | Ga0105238_100598962 | 191 |
| 207 | 3300009551 | Ga0105238_10088539 | Ga0105238_100885392 | 191 |
| 208 | 3300009551 | Ga0105238_10125337 | Ga0105238_101253372 | 191 |
| 209 | 3300009551 | Ga0105238_10274641 | Ga0105238_102746413 | 191 |
| 210 | 3300009551 | Ga0105238_10874615 | Ga0105238_108746151 | 191 |
| 211 | 3300009551 | Ga0105238_11915993 | Ga0105238_119159931 | 191 |
| 212 | 3300010375 | Ga0105239_10012806 | Ga0105239_100128064 | 191 |
| 213 | 3300010375 | Ga0105239_10031460 | Ga0105239_100314605 | 191 |
| 214 | 3300010375 | Ga0105239_10033892 | Ga0105239_100338926 | 191 |
| 215 | 3300010375 | Ga0105239_10063854 | Ga0105239_100638542 | 191 |
| 216 | 3300010375 | Ga0105239_10113203 | Ga0105239_101132034 | 191 |
| 217 | 3300010375 | Ga0105239_10147049 | Ga0105239_101470492 | 191 |
| 218 | 3300010375 | Ga0105239_11326304 | Ga0105239_113263041 | 191 |
| 219 | 3300010375 | Ga0105239_11504950 | Ga0105239_115049502 | 191 |
| 220 | 3300013100 | Ga0157373_10088355 | Ga0157373_100883553 | 191 |
| 221 | 3300013102 | Ga0157371_10064445 | Ga0157371_100644453 | 191 |
| 222 | 3300013104 | Ga0157370_10015391 | Ga0157370_100153911 | 191 |
| 223 | 3300013104 | Ga0157370_10036212 | Ga0157370_100362122 | 191 |
| 224 | 3300013104 | Ga0157370_10036704 | Ga0157370_100367045 | 191 |
| 225 | 3300013104 | Ga0157370_10043087 | Ga0157370_100430873 | 191 |
| 226 | 3300013104 | Ga0157370_10051095 | Ga0157370_100510953 | 191 |
| 227 | 3300013104 | Ga0157370_10071115 | Ga0157370_100711153 | 191 |
| 228 | 3300013104 | Ga0157370_10096055 | Ga0157370_100960552 | 191 |
| 229 | 3300013104 | Ga0157370_10237501 | Ga0157370_102375012 | 191 |
| 230 | 3300013104 | Ga0157370_10376726 | Ga0157370_103767262 | 191 |
| 231 | 3300013104 | Ga0157370_11012827 | Ga0157370_110128271 | 191 |
| 232 | 3300013104 | Ga0157370_11108174 | Ga0157370_111081741 | 191 |
| 233 | 3300013105 | Ga0157369_10001300 | Ga0157369_1000130012 | 191 |
| 234 | 3300013105 | Ga0157369_10015873 | Ga0157369_100158737 | 191 |
| 235 | 3300013105 | Ga0157369_10021067 | Ga0157369_100210674 | 191 |
| 236 | 3300013105 | Ga0157369_10050642 | Ga0157369_100506422 | 191 |
| 237 | 3300013105 | Ga0157369_10085700 | Ga0157369_100857003 | 191 |
| 238 | 3300013105 | Ga0157369_10164312 | Ga0157369_101643122 | 191 |
| 239 | 3300013105 | Ga0157369_10292098 | Ga0157369_102920983 | 191 |
| 240 | 3300013105 | Ga0157369_10372273 | Ga0157369_103722732 | 191 |
| 241 | 3300013105 | Ga0157369_10379678 | Ga0157369_103796781 | 191 |
| 242 | 3300013105 | Ga0157369_11123791 | Ga0157369_111237911 | 191 |
| 243 | 3300013105 | Ga0157369_11662532 | Ga0157369_116625321 | 191 |
| 244 | 3300013296 | Ga0157374_10006059 | Ga0157374_100060594 | 191 |
| 245 | 3300013296 | Ga0157374_10014501 | Ga0157374_100145018 | 191 |
| 246 | 3300013296 | Ga0157374_10056732 | Ga0157374_100567322 | 191 |
| 247 | 3300013296 | Ga0157374_10065905 | Ga0157374_100659053 | 191 |
| 248 | 3300013296 | Ga0157374_10133160 | Ga0157374_101331602 | 191 |
| 249 | 3300013296 | Ga0157374_10984309 | Ga0157374_109843092 | 191 |
| 250 | 3300013297 | Ga0157378_10000160 | Ga0157378_1000016028 | 191 |
| 251 | 3300013297 | Ga0157378_10057625 | Ga0157378_100576251 | 191 |
| 252 | 3300013297 | Ga0157378_10082690 | Ga0157378_100826902 | 191 |
| 253 | 3300013306 | Ga0163162_10003329 | Ga0163162_100033297 | 191 |
| 254 | 3300013306 | Ga0163162_10051839 | Ga0163162_100518394 | 191 |
| 255 | 3300013306 | Ga0163162_10055653 | Ga0163162_100556535 | 191 |
| 256 | 3300013306 | Ga0163162_10086083 | Ga0163162_100860832 | 191 |
| 257 | 3300013306 | Ga0163162_10165216 | Ga0163162_101652161 | 191 |
| 258 | 3300013306 | Ga0163162_11375150 | Ga0163162_113751501 | 191 |
| 259 | 3300013307 | Ga0157372_10012941 | Ga0157372_100129418 | 191 |
| 260 | 3300013307 | Ga0157372_10092084 | Ga0157372_100920843 | 191 |
| 261 | 3300013307 | Ga0157372_10136782 | Ga0157372_101367822 | 191 |
| 262 | 3300013307 | Ga0157372_10167467 | Ga0157372_101674673 | 191 |
| 263 | 3300013307 | Ga0157372_10326891 | Ga0157372_103268911 | 191 |
| 264 | 3300013307 | Ga0157372_10419308 | Ga0157372_104193082 | 191 |
| 265 | 3300013307 | Ga0157372_10520001 | Ga0157372_105200011 | 191 |
| 266 | 3300013307 | Ga0157372_10605477 | Ga0157372_106054771 | 191 |
| 267 | 3300013307 | Ga0157372_10618022 | Ga0157372_106180222 | 191 |
| 268 | 3300013308 | Ga0157375_10035479 | Ga0157375_100354795 | 191 |
| 269 | 3300013308 | Ga0157375_10044239 | Ga0157375_100442395 | 191 |
| 270 | 3300013308 | Ga0157375_10231354 | Ga0157375_102313542 | 191 |
| 271 | 3300013308 | Ga0157375_10615922 | Ga0157375_106159222 | 191 |
| 272 | 3300014325 | Ga0163163_10039007 | Ga0163163_100390071 | 191 |
| 273 | 3300014325 | Ga0163163_10119914 | Ga0163163_101199142 | 191 |
| 274 | 3300014326 | Ga0157380_10602108 | Ga0157380_106021082 | 191 |
| 275 | 3300014968 | Ga0157379_10094376 | Ga0157379_100943762 | 191 |
| 276 | 3300014968 | Ga0157379_11442008 | Ga0157379_114420081 | 191 |
| 277 | 3300014969 | Ga0157376_10005077 | Ga0157376_100050777 | 191 |
| 278 | 3300014969 | Ga0157376_10009944 | Ga0157376_100099444 | 191 |
| 279 | 3300014969 | Ga0157376_10017421 | Ga0157376_100174212 | 191 |
| 280 | 3300014969 | Ga0157376_10071562 | Ga0157376_100715623 | 191 |
| 281 | 3300014969 | Ga0157376_10368740 | Ga0157376_103687403 | 191 |
| 282 | 3300014969 | Ga0157376_10810767 | Ga0157376_108107671 | 191 |
| 283 | 3300022732 | Ga0224569_103564 | Ga0224569_1035642 | 191 |
| 284 | 3300024227 | Ga0228598_1001829 | Ga0228598_10018295 | 191 |
| 285 | 3300025898 | Ga0207692_10081110 | Ga0207692_100811102 | 191 |
| 286 | 3300025899 | Ga0207642_10054770 | Ga0207642_100547702 | 191 |
| 287 | 3300025900 | Ga0207710_10259056 | Ga0207710_102590561 | 191 |
| 288 | 3300025904 | Ga0207647_10001933 | Ga0207647_1000193314 | 191 |
| 289 | 3300025904 | Ga0207647_10006057 | Ga0207647_100060577 | 191 |
| 290 | 3300025905 | Ga0207685_10255223 | Ga0207685_102552231 | 191 |
| 291 | 3300025906 | Ga0207699_10202067 | Ga0207699_102020672 | 191 |
| 292 | 3300025906 | Ga0207699_10305092 | Ga0207699_103050921 | 191 |
| 293 | 3300025906 | Ga0207699_10469559 | Ga0207699_104695592 | 191 |
| 294 | 3300025909 | Ga0207705_10000171 | Ga0207705_1000017149 | 191 |
| 295 | 3300025909 | Ga0207705_10000405 | Ga0207705_1000040531 | 191 |
| 296 | 3300025909 | Ga0207705_10107734 | Ga0207705_101077341 | 191 |
| 297 | 3300025909 | Ga0207705_10274159 | Ga0207705_102741592 | 191 |
| 298 | 3300025911 | Ga0207654_10015153 | Ga0207654_100151533 | 191 |
| 299 | 3300025911 | Ga0207654_10015292 | Ga0207654_100152923 | 191 |
| 300 | 3300025911 | Ga0207654_10258486 | Ga0207654_102584861 | 191 |
| 301 | 3300025912 | Ga0207707_10025388 | Ga0207707_100253886 | 191 |
| 302 | 3300025912 | Ga0207707_10050158 | Ga0207707_100501584 | 191 |
| 303 | 3300025912 | Ga0207707_10104691 | Ga0207707_101046911 | 191 |
| 304 | 3300025912 | Ga0207707_10159542 | Ga0207707_101595422 | 191 |
| 305 | 3300025912 | Ga0207707_10366027 | Ga0207707_103660271 | 191 |
| 306 | 3300025912 | Ga0207707_10810557 | Ga0207707_108105571 | 191 |
| 307 | 3300025912 | Ga0207707_10910697 | Ga0207707_109106971 | 191 |
| 308 | 3300025913 | Ga0207695_10000341 | Ga0207695_1000034192 | 191 |
| 309 | 3300025913 | Ga0207695_10008580 | Ga0207695_1000858010 | 191 |
| 310 | 3300025913 | Ga0207695_10016432 | Ga0207695_100164322 | 191 |
| 311 | 3300025913 | Ga0207695_10032214 | Ga0207695_100322143 | 191 |
| 312 | 3300025913 | Ga0207695_10115327 | Ga0207695_101153272 | 191 |
| 313 | 3300025913 | Ga0207695_10116452 | Ga0207695_101164522 | 191 |
| 314 | 3300025913 | Ga0207695_10184092 | Ga0207695_101840922 | 191 |
| 315 | 3300025913 | Ga0207695_10332490 | Ga0207695_103324902 | 191 |
| 316 | 3300025913 | Ga0207695_10456597 | Ga0207695_104565972 | 191 |
| 317 | 3300025913 | Ga0207695_10469742 | Ga0207695_104697422 | 191 |
| 318 | 3300025913 | Ga0207695_10605886 | Ga0207695_106058861 | 191 |
| 319 | 3300025914 | Ga0207671_10050120 | Ga0207671_100501202 | 191 |
| 320 | 3300025914 | Ga0207671_10316558 | Ga0207671_103165581 | 191 |
| 321 | 3300025914 | Ga0207671_10368908 | Ga0207671_103689082 | 191 |
| 322 | 3300025915 | Ga0207693_10022454 | Ga0207693_100224545 | 191 |
| 323 | 3300025915 | Ga0207693_10360371 | Ga0207693_103603711 | 191 |
| 324 | 3300025915 | Ga0207693_10364286 | Ga0207693_103642861 | 191 |
| 325 | 3300025917 | Ga0207660_10128835 | Ga0207660_101288353 | 191 |
| 326 | 3300025917 | Ga0207660_10832319 | Ga0207660_108323191 | 191 |
| 327 | 3300025919 | Ga0207657_10000747 | Ga0207657_1000074714 | 191 |
| 328 | 3300025919 | Ga0207657_10001086 | Ga0207657_1000108630 | 191 |
| 329 | 3300025921 | Ga0207652_10065014 | Ga0207652_100650142 | 191 |
| 330 | 3300025921 | Ga0207652_10183091 | Ga0207652_101830911 | 191 |
| 331 | 3300025921 | Ga0207652_10216137 | Ga0207652_102161372 | 191 |
| 332 | 3300025921 | Ga0207652_10429601 | Ga0207652_104296011 | 191 |
| 333 | 3300025924 | Ga0207694_10003332 | Ga0207694_100033322 | 191 |
| 334 | 3300025924 | Ga0207694_10005586 | Ga0207694_100055868 | 191 |
| 335 | 3300025924 | Ga0207694_10033987 | Ga0207694_100339871 | 191 |
| 336 | 3300025924 | Ga0207694_10080152 | Ga0207694_100801522 | 191 |
| 337 | 3300025924 | Ga0207694_10225722 | Ga0207694_102257221 | 191 |
| 338 | 3300025924 | Ga0207694_10372767 | Ga0207694_103727672 | 191 |
| 339 | 3300025925 | Ga0207650_10680618 | Ga0207650_106806181 | 191 |
| 340 | 3300025926 | Ga0207659_10544789 | Ga0207659_105447892 | 191 |
| 341 | 3300025927 | Ga0207687_10006394 | Ga0207687_100063945 | 191 |
| 342 | 3300025927 | Ga0207687_10014284 | Ga0207687_100142842 | 191 |
| 343 | 3300025927 | Ga0207687_10080839 | Ga0207687_100808392 | 191 |
| 344 | 3300025927 | Ga0207687_10680786 | Ga0207687_106807862 | 191 |
| 345 | 3300025928 | Ga0207700_10012412 | Ga0207700_100124122 | 191 |
| 346 | 3300025928 | Ga0207700_10083160 | Ga0207700_100831603 | 191 |
| 347 | 3300025928 | Ga0207700_10111020 | Ga0207700_101110202 | 191 |
| 348 | 3300025928 | Ga0207700_10243763 | Ga0207700_102437633 | 191 |
| 349 | 3300025928 | Ga0207700_10383571 | Ga0207700_103835711 | 191 |
| 350 | 3300025928 | Ga0207700_10923409 | Ga0207700_109234092 | 191 |
| 351 | 3300025929 | Ga0207664_10005557 | Ga0207664_100055577 | 191 |
| 352 | 3300025929 | Ga0207664_10744983 | Ga0207664_107449831 | 191 |
| 353 | 3300025931 | Ga0207644_11205604 | Ga0207644_112056041 | 191 |
| 354 | 3300025932 | Ga0207690_10388746 | Ga0207690_103887461 | 191 |
| 355 | 3300025938 | Ga0207704_10104688 | Ga0207704_101046882 | 191 |
| 356 | 3300025939 | Ga0207665_10039607 | Ga0207665_100396071 | 191 |
| 357 | 3300025939 | Ga0207665_10418297 | Ga0207665_104182972 | 191 |
| 358 | 3300025941 | Ga0207711_10000014 | Ga0207711_10000014457 | 191 |
| 359 | 3300025941 | Ga0207711_10007356 | Ga0207711_100073562 | 191 |
| 360 | 3300025941 | Ga0207711_10064945 | Ga0207711_100649452 | 191 |
| 361 | 3300025941 | Ga0207711_10080562 | Ga0207711_100805622 | 191 |
| 362 | 3300025941 | Ga0207711_10133977 | Ga0207711_101339773 | 191 |
| 363 | 3300025941 | Ga0207711_10194195 | Ga0207711_101941953 | 191 |
| 364 | 3300025941 | Ga0207711_10221797 | Ga0207711_102217972 | 191 |
| 365 | 3300025941 | Ga0207711_10412578 | Ga0207711_104125781 | 191 |
| 366 | 3300025942 | Ga0207689_10235772 | Ga0207689_102357721 | 191 |
| 367 | 3300025944 | Ga0207661_10063760 | Ga0207661_100637604 | 191 |
| 368 | 3300025944 | Ga0207661_10209450 | Ga0207661_102094503 | 191 |
| 369 | 3300025944 | Ga0207661_10246960 | Ga0207661_102469602 | 191 |
| 370 | 3300025944 | Ga0207661_11212151 | Ga0207661_112121511 | 191 |
| 371 | 3300025945 | Ga0207679_10638257 | Ga0207679_106382572 | 191 |
| 372 | 3300025945 | Ga0207679_11099786 | Ga0207679_110997861 | 191 |
| 373 | 3300025949 | Ga0207667_10006944 | Ga0207667_1000694410 | 191 |
| 374 | 3300025949 | Ga0207667_10011261 | Ga0207667_100112617 | 191 |
| 375 | 3300025949 | Ga0207667_10016174 | Ga0207667_100161747 | 191 |
| 376 | 3300025949 | Ga0207667_10021169 | Ga0207667_100211695 | 191 |
| 377 | 3300025949 | Ga0207667_10028898 | Ga0207667_100288987 | 191 |
| 378 | 3300025949 | Ga0207667_10037861 | Ga0207667_100378615 | 191 |
| 379 | 3300025949 | Ga0207667_10090807 | Ga0207667_100908073 | 191 |
| 380 | 3300025949 | Ga0207667_10095983 | Ga0207667_100959832 | 191 |
| 381 | 3300025949 | Ga0207667_10147997 | Ga0207667_101479973 | 191 |
| 382 | 3300025949 | Ga0207667_11283702 | Ga0207667_112837021 | 191 |
| 383 | 3300025981 | Ga0207640_10099216 | Ga0207640_100992162 | 191 |
| 384 | 3300025981 | Ga0207640_10710977 | Ga0207640_107109771 | 191 |
| 385 | 3300025986 | Ga0207658_10492287 | Ga0207658_104922872 | 191 |
| 386 | 3300026023 | Ga0207677_10002246 | Ga0207677_100022465 | 191 |
| 387 | 3300026035 | Ga0207703_10108100 | Ga0207703_101081003 | 191 |
| 388 | 3300026035 | Ga0207703_10248522 | Ga0207703_102485222 | 191 |
| 389 | 3300026041 | Ga0207639_10160022 | Ga0207639_101600222 | 191 |
| 390 | 3300026041 | Ga0207639_10387347 | Ga0207639_103873471 | 191 |
| 391 | 3300026067 | Ga0207678_10004895 | Ga0207678_100048958 | 191 |
| 392 | 3300026067 | Ga0207678_10178103 | Ga0207678_101781032 | 191 |
| 393 | 3300026067 | Ga0207678_10230314 | Ga0207678_102303142 | 191 |
| 394 | 3300026078 | Ga0207702_10014192 | Ga0207702_100141922 | 191 |
| 395 | 3300026078 | Ga0207702_10040028 | Ga0207702_100400282 | 191 |
| 396 | 3300026078 | Ga0207702_10160057 | Ga0207702_101600572 | 191 |
| 397 | 3300026078 | Ga0207702_10241855 | Ga0207702_102418553 | 191 |
| 398 | 3300026078 | Ga0207702_10738561 | Ga0207702_107385612 | 191 |
| 399 | 3300026088 | Ga0207641_10023997 | Ga0207641_100239972 | 191 |
| 400 | 3300026088 | Ga0207641_10996478 | Ga0207641_109964781 | 191 |
| 401 | 3300026089 | Ga0207648_10005760 | Ga0207648_1000576010 | 191 |
| 402 | 3300026095 | Ga0207676_10453403 | Ga0207676_104534031 | 191 |
| 403 | 3300026116 | Ga0207674_10004620 | Ga0207674_100046207 | 191 |
| 404 | 3300026116 | Ga0207674_10017687 | Ga0207674_100176878 | 191 |
| 405 | 3300026116 | Ga0207674_10090366 | Ga0207674_100903664 | 191 |
| 406 | 3300026116 | Ga0207674_10214834 | Ga0207674_102148342 | 191 |
| 407 | 3300026116 | Ga0207674_10439429 | Ga0207674_104394293 | 191 |
| 408 | 3300026116 | Ga0207674_10465681 | Ga0207674_104656812 | 191 |
| 409 | 3300026142 | Ga0207698_10021915 | Ga0207698_100219152 | 191 |
| 410 | 3300026142 | Ga0207698_10107624 | Ga0207698_101076243 | 191 |
| 411 | 3300026142 | Ga0207698_10465141 | Ga0207698_104651411 | 191 |
| 412 | 3300026142 | Ga0207698_10625926 | Ga0207698_106259262 | 191 |
| 413 | 3300028017 | Ga0265356_1000302 | Ga0265356_10003025 | 191 |
| 414 | 3300028017 | Ga0265356_1011454 | Ga0265356_10114542 | 191 |
| 415 | 3300028379 | Ga0268266_10003436 | Ga0268266_1000343611 | 191 |
| 416 | 3300028379 | Ga0268266_10009972 | Ga0268266_100099728 | 191 |
| 417 | 3300028379 | Ga0268266_10986024 | Ga0268266_109860241 | 191 |
| 418 | 3300028381 | Ga0268264_10270230 | Ga0268264_102702302 | 191 |
| 419 | 3300028800 | Ga0265338_10008940 | Ga0265338_100089402 | 191 |
| 420 | 3300028800 | Ga0265338_10092996 | Ga0265338_100929962 | 191 |
| 421 | 3300028800 | Ga0265338_10109318 | Ga0265338_101093181 | 191 |
| 422 | 3300028800 | Ga0265338_10460505 | Ga0265338_104605052 | 191 |
| 423 | 3300031090 | Ga0265760_10000069 | Ga0265760_1000006917 | 191 |
| 424 | 3300031249 | Ga0265339_10078050 | Ga0265339_100780502 | 191 |
| 425 | 3300031249 | Ga0265339_10108942 | Ga0265339_101089421 | 191 |
| 426 | 3300031249 | Ga0265339_10230869 | Ga0265339_102308691 | 191 |
| 427 | 3300031344 | Ga0265316_10003667 | Ga0265316_100036671 | 191 |
| 428 | 3300031344 | Ga0265316_10337998 | Ga0265316_103379982 | 191 |
| 429 | 3300031711 | Ga0265314_10001685 | Ga0265314_1000168512 | 191 |
| 430 | 3300031711 | Ga0265314_10128441 | Ga0265314_101284411 | 191 |
| 431 | 3300031712 | Ga0265342_10056368 | Ga0265342_100563682 | 191 |
| 432 | 3300033180 | Ga0307510_10124214 | Ga0307510_101242143 | 191 |
| 433 | 3300033180 | Ga0307510_10412711 | Ga0307510_104127111 | 191 |
| 434 | 3300035083 | Ga0373926_0036389 | Ga0373926_0036389_312_887 | 191 |
| 435 | 3300035086 | Ga0373934_0086161 | Ga0373934_0086161_483_1058 | 191 |
| 436 | 3300035111 | Ga0373923_0313940 | Ga0373923_0313940_86_661 | 191 |
| 437 | 3300035113 | Ga0373936_0017444 | Ga0373936_0017444_667_1242 | 191 |
| 438 | 3300035116 | Ga0373945_0086577 | Ga0373945_0086577_314_889 | 191 |
| 439 | 3300035119 | Ga0373956_0212001 | Ga0373956_0212001_287_862 | 191 |
| 440 | 3300035170 | Ga0373943_0009262 | Ga0373943_0009262_1273_1848 | 191 |
| 441 | 3300035171 | Ga0373946_0002854 | Ga0373946_0002854_1659_2234 | 191 |
| 442 | 3300035172 | Ga0373955_0116531 | Ga0373955_0116531_815_1390 | 191 |
| 443 | 3300035410 | Ga0373924_0000972 | Ga0373924_0000972_27_602 | 191 |
| 444 | 3300035410 | Ga0373924_0057884 | Ga0373924_0057884_342_917 | 191 |
| 445 | 3300035410 | Ga0373924_0125259 | Ga0373924_0125259_27_602 | 191 |
| 446 | 3300035692 | Ga0373935_0011531 | Ga0373935_0011531_4604_5179 | 191 |
| 447 | 3300035692 | Ga0373935_0023382 | Ga0373935_0023382_2211_2786 | 191 |
| 448 | 3300035692 | Ga0373935_0583670 | Ga0373935_0583670_228_803 | 191 |
| 449 | 3300035695 | Ga0373927_0012566 | Ga0373927_0012566_1024_1599 | 191 |
| 450 | 3300035695 | Ga0373927_0055229 | Ga0373927_0055229_1722_2297 | 191 |
| 451 | 3300035725 | Ga0373947_0020567 | Ga0373947_0020567_1155_1730 | 191 |
| 452 | 3300036401 | Ga0373937_0000390 | Ga0373937_0000390_29624_30199 | 191 |
| 453 | 3300036401 | Ga0373937_0007774 | Ga0373937_0007774_2157_2732 | 191 |
| 454 | 3300036401 | Ga0373937_0035383 | Ga0373937_0035383_2246_2821 | 191 |
| 455 | 3300036401 | Ga0373937_1073251 | Ga0373937_1073251_21_596 | 191 |
| 456 | 3300037068 | Ga0373925_0010808 | Ga0373925_0010808_2619_3194 | 191 |
| 457 | 3300037068 | Ga0373925_0067665 | Ga0373925_0067665_2088_2663 | 191 |
| 458 | 3300037068 | Ga0373925_0693500 | Ga0373925_0693500_74_649 | 191 |
| 459 | 3300037068 | Ga0373925_0890593 | Ga0373925_0890593_135_710 | 191 |
| 460 | 3300037466 | Ga0395898_0030053 | Ga0395898_0030053_1287_1862 | 191 |
| 461 | 3300039447 | Ga0436361_0519733 | Ga0436361_0519733_302_877 | 191 |
| 462 | 3300039447 | Ga0436361_0663741 | Ga0436361_0663741_1486_2061 | 191 |
| 463 | 3300039453 | Ga0436362_0554140 | Ga0436362_0554140_97_672 | 191 |
| 464 | 3300042876 | Ga0451577_0062378 | Ga0451577_0062378_2612_3187 | 191 |
| 465 | 3300042876 | Ga0451577_0123286 | Ga0451577_0123286_763_1338 | 191 |
| 466 | 3300044673 | Ga0453683_0055465 | Ga0453683_0055465_723_1298 | 191 |
| 467 | 3300044673 | Ga0453683_0099833 | Ga0453683_0099833_510_1085 | 191 |
| 468 | 3300044694 | Ga0466963_0002421 | Ga0466963_0002421_3326_3901 | 191 |
| 469 | 3300044694 | Ga0466963_0102992 | Ga0466963_0102992_767_1342 | 191 |
| 470 | 3300044712 | Ga0453684_0410582 | Ga0453684_0410582_884_1459 | 191 |
| 471 | 3300044842 | Ga0466957_0000242 | Ga0466957_0000242_20323_20898 | 191 |
| 472 | 3300044842 | Ga0466957_0061703 | Ga0466957_0061703_1263_1838 | 191 |
| 473 | 3300045051 | Ga0451576_0100969 | Ga0451576_0100969_1426_2001 | 191 |
| 474 | 3300045051 | Ga0451576_0504139 | Ga0451576_0504139_246_821 | 191 |
| 475 | 3300045051 | Ga0451576_0643324 | Ga0451576_0643324_213_788 | 191 |
| 476 | 3300045836 | Ga0466958_0104949 | Ga0466958_0104949_680_1255 | 191 |
| 477 | 3300045976 | Ga0466967_0002153 | Ga0466967_0002153_886_1461 | 191 |
| 478 | 3300045976 | Ga0466967_0312665 | Ga0466967_0312665_674_1249 | 191 |
| 479 | 3300046454 | Ga0495592_0063194 | Ga0495592_0063194_1161_1736 | 191 |
| 480 | 3300046462 | Ga0495651_0011687 | Ga0495651_0011687_688_1263 | 191 |
| 481 | 3300046462 | Ga0495651_0097452 | Ga0495651_0097452_781_1356 | 191 |
| 482 | 3300046471 | Ga0495650_0003916 | Ga0495650_0003916_6505_7080 | 191 |
| 483 | 3300046472 | Ga0495580_0068474 | Ga0495580_0068474_856_1431 | 191 |
| 484 | 3300046472 | Ga0495580_0273218 | Ga0495580_0273218_343_918 | 191 |
| 485 | 3300046474 | Ga0495605_0201547 | Ga0495605_0201547_25_600 | 191 |
| 486 | 3300046477 | Ga0495664_0011290 | Ga0495664_0011290_3107_3682 | 191 |
| 487 | 3300046491 | Ga0495584_0258123 | Ga0495584_0258123_251_826 | 191 |
| 488 | 3300046492 | Ga0495585_0013633 | Ga0495585_0013633_1725_2300 | 191 |
| 489 | 3300046500 | Ga0495596_0083431 | Ga0495596_0083431_253_828 | 191 |
| 490 | 3300046511 | Ga0495608_0148419 | Ga0495608_0148419_339_914 | 191 |
| 491 | 3300046515 | Ga0495620_0286697 | Ga0495620_0286697_37_612 | 191 |
| 492 | 3300046516 | Ga0495628_0205442 | Ga0495628_0205442_497_1072 | 191 |
| 493 | 3300046516 | Ga0495628_0298624 | Ga0495628_0298624_203_778 | 191 |
| 494 | 3300046517 | Ga0495630_0126059 | Ga0495630_0126059_871_1446 | 191 |
| 495 | 3300046518 | Ga0495631_0031431 | Ga0495631_0031431_1227_1802 | 191 |
| 496 | 3300046519 | Ga0495632_0028004 | Ga0495632_0028004_527_1102 | 191 |
| 497 | 3300046523 | Ga0495644_0000001 | Ga0495644_0000001_165791_166366 | 191 |
| 498 | 3300046524 | Ga0495648_0222508 | Ga0495648_0222508_21_596 | 191 |
| 499 | 3300046528 | Ga0495642_0008687 | Ga0495642_0008687_1718_2293 | 191 |
| 500 | 3300046529 | Ga0495652_0095944 | Ga0495652_0095944_1122_1697 | 191 |
| 501 | 3300046536 | Ga0495587_0155009 | Ga0495587_0155009_486_1061 | 191 |
| 502 | 3300046543 | Ga0495645_0019022 | Ga0495645_0019022_242_817 | 191 |
| 503 | 3300046558 | Ga0495633_0016264 | Ga0495633_0016264_2541_3116 | 191 |
| 504 | 3300046616 | Ga0495668_0005181 | Ga0495668_0005181_209_784 | 191 |
| 505 | 3300046642 | Ga0495634_0246115 | Ga0495634_0246115_439_1014 | 191 |
| 506 | 3300046648 | Ga0495611_0003508 | Ga0495611_0003508_1309_1884 | 191 |
| 507 | 3300046660 | Ga0495625_0002024 | Ga0495625_0002024_16555_17130 | 191 |
| 508 | 3300046660 | Ga0495625_0026462 | Ga0495625_0026462_2766_3341 | 191 |
| 509 | 3300046660 | Ga0495625_0063401 | Ga0495625_0063401_487_1062 | 191 |
| 510 | 3300046665 | Ga0495661_0018456 | Ga0495661_0018456_219_794 | 191 |
| 511 | 3300046675 | Ga0495657_0367835 | Ga0495657_0367835_80_655 | 191 |
| 512 | 3300046679 | Ga0495623_0059174 | Ga0495623_0059174_568_1143 | 191 |
| 513 | 3300046679 | Ga0495623_0070687 | Ga0495623_0070687_1533_2108 | 191 |
| 514 | 3300046679 | Ga0495623_0205264 | Ga0495623_0205264_377_1084 | 191 |
| 515 | 3300046680 | Ga0495646_0222642 | Ga0495646_0222642_218_793 | 191 |
| 516 | 3300046683 | Ga0495658_0685454 | Ga0495658_0685454_19_594 | 191 |
| 517 | 3300046684 | Ga0495669_0023454 | Ga0495669_0023454_25_600 | 191 |
| 518 | 3300046694 | Ga0495649_0228873 | Ga0495649_0228873_157_732 | 191 |
| 519 | 3300046809 | Ga0495600_0102928 | Ga0495600_0102928_715_1290 | 191 |
| 520 | 3300047317 | Ga0495604_0043645 | Ga0495604_0043645_2908_3483 | 191 |
| 521 | 3300047317 | Ga0495604_0365942 | Ga0495604_0365942_45_620 | 191 |
| 522 | 3300047319 | Ga0495674_0012807 | Ga0495674_0012807_3454_4029 | 191 |
| 523 | 3300047322 | Ga0495680_0385484 | Ga0495680_0385484_268_843 | 191 |
| 524 | 3300047323 | Ga0495683_0044994 | Ga0495683_0044994_1448_2023 | 191 |
| 525 | 3300047471 | Ga0495684_0208571 | Ga0495684_0208571_752_1327 | 191 |
| 526 | 3300047472 | Ga0495686_0133782 | Ga0495686_0133782_402_977 | 191 |
| 527 | 3300047673 | Ga0495593_0180188 | Ga0495593_0180188_459_1034 | 191 |
| 528 | 3300048088 | Ga0495602_0547783 | Ga0495602_0547783_31_606 | 191 |
| 529 | 3300048904 | Ga0496101_0175838 | Ga0496101_0175838_493_1068 | 191 |
| 530 | 3300048905 | Ga0496102_0140314 | Ga0496102_0140314_1638_2213 | 191 |
| 531 | 3300048907 | Ga0496104_0198640 | Ga0496104_0198640_436_1011 | 191 |
| 532 | 3300048908 | Ga0496105_0012352 | Ga0496105_0012352_2181_2756 | 191 |
| 533 | 3300048908 | Ga0496105_0216322 | Ga0496105_0216322_552_1127 | 191 |
| 534 | 3300048908 | Ga0496105_0429545 | Ga0496105_0429545_91_666 | 191 |
| 535 | 3300048909 | Ga0496106_0428733 | Ga0496106_0428733_474_1049 | 191 |
| 536 | 3300048911 | Ga0496108_0608690 | Ga0496108_0608690_293_868 | 191 |
| 537 | 3300048912 | Ga0496109_0078782 | Ga0496109_0078782_521_1096 | 191 |
| 538 | 3300048912 | Ga0496109_0709555 | Ga0496109_0709555_107_682 | 191 |
| 539 | 3300048914 | Ga0496111_0016723 | Ga0496111_0016723_3026_3601 | 191 |
| 540 | 3300048915 | Ga0496112_0001799 | Ga0496112_0001799_15492_16067 | 191 |
| 541 | 3300048915 | Ga0496112_0240924 | Ga0496112_0240924_944_1519 | 191 |
| 542 | 3300048915 | Ga0496112_0377173 | Ga0496112_0377173_450_1025 | 191 |
| 543 | 3300048915 | Ga0496112_0952765 | Ga0496112_0952765_121_696 | 191 |
| 544 | 3300048916 | Ga0496113_0000840 | Ga0496113_0000840_811_1386 | 191 |
| 545 | 3300048918 | Ga0496115_0069833 | Ga0496115_0069833_1172_1765 | 191 |
| 546 | 3300049573 | Ga0501037_0136096 | Ga0501037_0136096_680_1255 | 191 |
| 547 | 3300053077 | Ga0495601_0002582 | Ga0495601_0002582_7859_8434 | 191 |
| 548 | 3300053093 | Ga0500651_0000006 | Ga0500651_0000006_137222_137797 | 191 |
| 549 | 3300053119 | Ga0500595_033982 | Ga0500595_033982_522_1127 | 191 |
| 550 | 3300053139 | Ga0500568_0000575 | Ga0500568_0000575_19729_20304 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a5z-assembly2.cif.gz_F | crystal structure of escherichia coli genx in complex with elongation factor p | 0.8569 | 7 | 64 |
| 1yby-assembly1.cif.gz_A | conserved hypothetical protein cth-95 from clostridium thermocellum | 0.8498 | 7 | 191 |
| 5wxk-assembly1.cif.gz_B | earp bound with domain i of ef-p | 0.8451 | 15 | 65 |
| 3a5z-assembly1.cif.gz_B | crystal structure of escherichia coli genx in complex with elongation factor p | 0.8337 | 7 | 139 |
| 1yby-assembly1.cif.gz_A | conserved hypothetical protein cth-95 from clostridium thermocellum | 0.8326 | 7 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3huyV03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9605 | 134 | 191 | 2.40.50.140 |
| af_Q2QYK4_39_108_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9558 | 14 | 67 | 2.30.30.30 |
| 5j3bA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9536 | 134 | 191 | 2.40.50.140 |
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9418 | 70 | 131 | 2.40.50.140 |
| af_I1JVU1_64_124_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9294 | 15 | 67 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8NME1-F1-model_v4 | Elongation factor P | 0.9666 | 73 | 191 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-K2EBP1-F1-model_v4 | Elongation factor P | 0.9519 | 69 | 191 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A2V8NME1-F1-model_v4 | Elongation factor P | 0.9511 | 73 | 191 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A1F7VGA1-F1-model_v4 | Elongation factor P | 0.9425 | 63 | 191 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A6G4ZQB9-F1-model_v4 | Elongation factor P | 0.9298 | 15 | 191 |
GO:0003746
GO:0005737 GO:0043043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar