F462525

General Info

Members Datasets Scaffolds Average Seq Length
550 291 1100 236

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2030011|Ga0451853_2030011_553_1269
Length 238
Sequence VAVSENFQRMQRILVVDDDAALSEMLQLVLKADGFDASWCSSGDAAVEAFQRHHPDLVLLDLMLPGRDGVDVCRDIRAVSGVPIVMLTAKSDTRDVVEGLEAGADDYVAKPFKVKELLARIRTRLRRHVPTDDSGVLTIGDLSINVPEHTVRRGHELITLTPLEFDLLLALAKRPRHAFSREVLLEEVWGYRHASDTRLVNVHVQRLRSKIEHDPEHPEIIVTVRGVGYRAGDAREGS

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
253 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
254 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
257 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
261 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
266 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
267 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
268 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
269 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
270 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
271 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
275 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2643221561 Nocardioides sp. Root151 Isolate Unclassified
280 2643221641 Nocardioides sp. Root122 Isolate Unclassified
281 2643221696 Nocardioides sp. Root140 Isolate Unclassified
282 2739367898 Nocardioides sp. CF479 Isolate Unclassified
283 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
284 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
285 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
286 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
287 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
288 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
289 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
290 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
291 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 2.18
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 12.55
Nodule 0.18
Rhizoplane 6
Rhizosphere 77.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2030011 3300041512 Bacteria 1566
2 JGI24739J22299_10051104 3300001989 Bacteria 1334
3 JGI24737J22298_10009946 3300001990 Bacteria 3148
4 JGI24735J21928_10011115 3300002067 Bacteria 2859
5 JGI24735J21928_10069493 3300002067 Bacteria 1009
6 Ga0058859_11725277 3300004798 Bacteria 1014
7 Ga0070658_10019441 3300005327 Bacteria 5439
8 Ga0070658_10057489 3300005327 Bacteria 3163
9 Ga0070683_100000255 3300005329 Bacteria 36630
10 Ga0070683_100066245 3300005329 Bacteria 3364
11 Ga0070683_100130373 3300005329 Bacteria 2379
12 Ga0070682_100468695 3300005337 Bacteria 969
13 Ga0068868_100372667 3300005338 Bacteria 1227
14 Ga0070660_100163694 3300005339 Bacteria 1793
15 Ga0070660_100242389 3300005339 Bacteria 1469
16 Ga0070687_100103638 3300005343 Bacteria 1598
17 Ga0070687_100174045 3300005343 Bacteria 1284
18 Ga0070692_10003834 3300005345 Bacteria 6186
19 Ga0070692_10008723 3300005345 Bacteria 4534
20 Ga0070668_100237829 3300005347 Bacteria 1508
21 Ga0070674_100007958 3300005356 Bacteria 6278
22 Ga0070674_100079440 3300005356 Bacteria 2340
23 Ga0070673_100135117 3300005364 Bacteria 2075
24 Ga0070659_100011998 3300005366 Bacteria 6415
25 Ga0070659_100279060 3300005366 Bacteria 1390
26 Ga0070659_100379332 3300005366 Bacteria 1191
27 Ga0070667_100009931 3300005367 Bacteria 7890
28 Ga0070667_100034919 3300005367 Bacteria 4210
29 Ga0070714_100003056 3300005435 Bacteria 12417
30 Ga0070714_100418066 3300005435 Bacteria 1270
31 Ga0070713_100039451 3300005436 Bacteria 3833
32 Ga0070701_10001347 3300005438 Bacteria 9052
33 Ga0070700_100014673 3300005441 Bacteria 4427
34 Ga0070663_100382387 3300005455 Bacteria 1147
35 Ga0070678_100449479 3300005456 Bacteria 1128
36 Ga0070681_10697556 3300005458 Bacteria 931
37 Ga0068867_100555749 3300005459 Bacteria 995
38 Ga0070698_100000984 3300005471 Bacteria 31337
39 Ga0070679_100014462 3300005530 Bacteria 7579
40 Ga0070679_100489743 3300005530 Bacteria 1174
41 Ga0070684_100033857 3300005535 Bacteria 4365
42 Ga0070684_100170364 3300005535 Bacteria 1977
43 Ga0070684_100309033 3300005535 Bacteria 1451
44 Ga0070684_100318901 3300005535 Bacteria 1427
45 Ga0070684_100572825 3300005535 Bacteria 1049
46 Ga0070672_100010596 3300005543 Bacteria 6397
47 Ga0070693_100451921 3300005547 Bacteria 902
48 Ga0070665_100001445 3300005548 Bacteria 27861
49 Ga0068855_100002565 3300005563 Bacteria 22391
50 Ga0070664_100087873 3300005564 Bacteria 2688
51 Ga0070664_100407688 3300005564 Bacteria 1244
52 Ga0068857_100009915 3300005577 Bacteria 8267
53 Ga0068854_100003536 3300005578 Bacteria 9763
54 Ga0068854_100421543 3300005578 Bacteria 1109
55 Ga0068856_100097403 3300005614 Bacteria 2930
56 Ga0068856_100113866 3300005614 Bacteria 2704
57 Ga0068856_100366854 3300005614 Bacteria 1459
58 Ga0070702_100003328 3300005615 Bacteria 7172
59 Ga0070702_100026862 3300005615 Bacteria 3099
60 Ga0070702_100051898 3300005615 Bacteria 2350
61 Ga0068864_100615759 3300005618 Bacteria 1055
62 Ga0068861_100429678 3300005719 Bacteria 1179
63 Ga0068861_100479287 3300005719 Bacteria 1121
64 Ga0068870_10002535 3300005840 Bacteria 7629
65 Ga0068860_100002101 3300005843 Bacteria 21002
66 Ga0068860_100185445 3300005843 Bacteria 2012
67 Ga0081539_10074430 3300005985 Bacteria 1809
68 Ga0075365_10000461 3300006038 Bacteria 15240
69 Ga0075365_10044673 3300006038 Bacteria 2904
70 Ga0075365_10151813 3300006038 Bacteria 1611
71 Ga0075365_10251257 3300006038 Bacteria 1243
72 Ga0075365_10313526 3300006038 Bacteria 1104
73 Ga0075368_10004259 3300006042 Bacteria 4831
74 Ga0075368_10019422 3300006042 Bacteria 2565
75 Ga0075363_100003090 3300006048 Bacteria 6986
76 Ga0075363_100056450 3300006048 Bacteria 2105
77 Ga0075364_10065305 3300006051 Bacteria 2389
78 Ga0075364_10178000 3300006051 Bacteria 1439
79 Ga0075364_10423670 3300006051 Bacteria 909
80 Ga0075362_10003858 3300006177 Bacteria 5320
81 Ga0075367_10024971 3300006178 Bacteria 3374
82 Ga0075367_10051575 3300006178 Bacteria 2432
83 Ga0075367_10087505 3300006178 Bacteria 1892
84 Ga0075367_10313792 3300006178 Bacteria 988
85 Ga0068865_100041407 3300006881 Bacteria 3134
86 Ga0105240_10017510 3300009093 Bacteria 9653
87 Ga0105240_10563182 3300009093 Bacteria 1259
88 Ga0105245_10072534 3300009098 Bacteria 3128
89 Ga0105243_10003624 3300009148 Bacteria 12440
90 Ga0105243_10064639 3300009148 Bacteria 2937
91 Ga0105243_10751183 3300009148 Bacteria 956
92 Ga0105241_10001838 3300009174 Bacteria 16097
93 Ga0105237_10017138 3300009545 Bacteria 7514
94 Ga0105237_10391883 3300009545 Bacteria 1394
95 Ga0105238_10002247 3300009551 Bacteria 19494
96 Ga0105249_10062314 3300009553 Bacteria 3424
97 Ga0105249_10139877 3300009553 Bacteria 2320
98 Ga0105249_10155316 3300009553 Bacteria 2206
99 Ga0105249_10423687 3300009553 Bacteria 1365
100 Ga0105249_11075928 3300009553 Bacteria 874
101 Ga0105239_10008658 3300010375 Bacteria 11532
102 Ga0105239_10031983 3300010375 Bacteria 5781
103 Ga0105246_10001851 3300011119 Bacteria 12708
104 Ga0157371_10063902 3300013102 Bacteria 2609
105 Ga0157369_10784313 3300013105 Bacteria 979
106 Ga0157372_10011409 3300013307 Bacteria 9452
107 Ga0157372_10050623 3300013307 Bacteria 4620
108 Ga0157372_10149538 3300013307 Bacteria 2694
109 Ga0157375_10110310 3300013308 Bacteria 2848
110 Ga0163163_10074284 3300014325 Bacteria 3391
111 Ga0163163_10273831 3300014325 Bacteria 1739
112 Ga0163163_10337783 3300014325 Bacteria 1561
113 Ga0163163_10658598 3300014325 Bacteria 1110
114 Ga0182008_10062129 3300014497 Bacteria 1841
115 Ga0157377_10132981 3300014745 Bacteria 1521
116 Ga0157379_10016422 3300014968 Bacteria 6512
117 Ga0157376_10458546 3300014969 Bacteria 1245
118 Ga0163161_10031658 3300017792 Bacteria 3770
119 Ga0197907_11214155 3300020069 Bacteria 1479
120 Ga0206356_11850484 3300020070 Bacteria 1124
121 Ga0206354_11270840 3300020081 Bacteria 1082
122 Ga0206353_12054289 3300020082 Bacteria 3135
123 Ga0224712_10145284 3300022467 Bacteria 1047
124 Ga0207688_10077915 3300025901 Bacteria 1889
125 Ga0207688_10083232 3300025901 Bacteria 1830
126 Ga0207688_10292090 3300025901 Bacteria 995
127 Ga0207647_10013690 3300025904 Bacteria 5617
128 Ga0207647_10036888 3300025904 Bacteria 3103
129 Ga0207643_10009627 3300025908 Bacteria 5188
130 Ga0207643_10024039 3300025908 Bacteria 3362
131 Ga0207705_10037198 3300025909 Bacteria 3483
132 Ga0207705_10107195 3300025909 Bacteria 2061
133 Ga0207684_10511563 3300025910 Bacteria 1029
134 Ga0207654_10002294 3300025911 Bacteria 9803
135 Ga0207707_10389066 3300025912 Bacteria 1198
136 Ga0207695_10001509 3300025913 Bacteria 38667
137 Ga0207671_10000840 3300025914 Bacteria 38977
138 Ga0207671_10499555 3300025914 Bacteria 970
139 Ga0207660_10241683 3300025917 Bacteria 1423
140 Ga0207662_10191945 3300025918 Bacteria 1318
141 Ga0207662_10263099 3300025918 Bacteria 1136
142 Ga0207657_10035004 3300025919 Bacteria 4507
143 Ga0207657_10272356 3300025919 Bacteria 1346
144 Ga0207652_10017228 3300025921 Bacteria 5911
145 Ga0207652_10475267 3300025921 Bacteria 1126
146 Ga0207694_10000884 3300025924 Bacteria 26607
147 Ga0207650_10224860 3300025925 Bacteria 1512
148 Ga0207659_10212973 3300025926 Bacteria 1550
149 Ga0207687_10145841 3300025927 Bacteria 1801
150 Ga0207687_10146387 3300025927 Bacteria 1798
151 Ga0207700_10040242 3300025928 Bacteria 3410
152 Ga0207664_10018127 3300025929 Bacteria 5173
153 Ga0207664_10167748 3300025929 Bacteria 1877
154 Ga0207690_10017588 3300025932 Bacteria 4369
155 Ga0207690_10081212 3300025932 Bacteria 2264
156 Ga0207690_10199279 3300025932 Bacteria 1519
157 Ga0207690_10201820 3300025932 Bacteria 1511
158 Ga0207709_10137504 3300025935 Bacteria 1675
159 Ga0207709_10385195 3300025935 Bacteria 1068
160 Ga0207669_10072100 3300025937 Bacteria 2173
161 Ga0207704_10011925 3300025938 Bacteria 4298
162 Ga0207711_10035655 3300025941 Bacteria 4218
163 Ga0207711_10176917 3300025941 Bacteria 1939
164 Ga0207661_10128084 3300025944 Bacteria 2170
165 Ga0207661_10175805 3300025944 Bacteria 1866
166 Ga0207661_10251850 3300025944 Bacteria 1570
167 Ga0207679_10076210 3300025945 Bacteria 2547
168 Ga0207679_10272971 3300025945 Bacteria 1447
169 Ga0207679_10370396 3300025945 Bacteria 1254
170 Ga0207667_10007150 3300025949 Bacteria 13475
171 Ga0207651_10025040 3300025960 Bacteria 3703
172 Ga0207712_10045307 3300025961 Bacteria 3045
173 Ga0207712_10278081 3300025961 Bacteria 1365
174 Ga0207668_10060427 3300025972 Bacteria 2660
175 Ga0207640_10003385 3300025981 Bacteria 8592
176 Ga0207658_10004119 3300025986 Bacteria 10139
177 Ga0207658_10219019 3300025986 Bacteria 1600
178 Ga0207677_10253802 3300026023 Bacteria 1430
179 Ga0207677_10327813 3300026023 Bacteria 1275
180 Ga0207703_10637025 3300026035 Bacteria 1010
181 Ga0207639_10096426 3300026041 Bacteria 2379
182 Ga0207639_10103185 3300026041 Bacteria 2310
183 Ga0207708_10023164 3300026075 Bacteria 4692
184 Ga0207702_10051931 3300026078 Bacteria 3467
185 Ga0207702_10158010 3300026078 Bacteria 2068
186 Ga0207702_10347087 3300026078 Bacteria 1419
187 Ga0207702_10567453 3300026078 Bacteria 1111
188 Ga0207648_10014649 3300026089 Bacteria 7239
189 Ga0207648_10082066 3300026089 Bacteria 2811
190 Ga0207648_10728517 3300026089 Bacteria 920
191 Ga0207674_10005034 3300026116 Bacteria 15778
192 Ga0207675_100001267 3300026118 Bacteria 25253
193 Ga0207675_100147084 3300026118 Bacteria 2241
194 Ga0207675_100385742 3300026118 Bacteria 1378
195 Ga0207683_10031384 3300026121 Bacteria 4611
196 Ga0207683_10449812 3300026121 Bacteria 1187
197 Ga0207698_10181356 3300026142 Bacteria 1865
198 Ga0209813_10000637 3300027866 Bacteria 8122
199 Ga0268266_10017771 3300028379 Bacteria 6059
200 Ga0268266_10164084 3300028379 Bacteria 2011
201 Ga0268264_10000552 3300028381 Bacteria 46800
202 Ga0307517_10005535 3300028786 Bacteria 18981
203 Ga0307508_10116492 3300031616 Bacteria 2273
204 Ga0265314_10200807 3300031711 Bacteria 1179
205 Ga0316576_10010027 3300031727 Bacteria 6136
206 Ga0316578_10030584 3300031728 Bacteria 3062
207 Ga0307516_10024463 3300031730 Bacteria 6168
208 Ga0307405_10187742 3300031731 Bacteria 1490
209 Ga0307405_10541705 3300031731 Bacteria 940
210 Ga0307413_10088501 3300031824 Bacteria 2009
211 Ga0307410_10057777 3300031852 Bacteria 2643
212 Ga0307410_10125612 3300031852 Bacteria 1878
213 Ga0307407_10280008 3300031903 Bacteria 1155
214 Ga0307407_10548096 3300031903 Bacteria 854
215 Ga0307412_10095288 3300031911 Bacteria 2092
216 Ga0307409_100045518 3300031995 Bacteria 3313
217 Ga0307409_100173322 3300031995 Bacteria 1901
218 Ga0307409_100199866 3300031995 Bacteria 1787
219 Ga0307409_100505257 3300031995 Bacteria 1178
220 Ga0307416_100019954 3300032002 Bacteria 4768
221 Ga0307416_100029065 3300032002 Bacteria 4123
222 Ga0307416_100038029 3300032002 Bacteria 3709
223 Ga0307416_100330670 3300032002 Bacteria 1531
224 Ga0307414_10066249 3300032004 Bacteria 2581
225 Ga0307411_10051572 3300032005 Bacteria 2685
226 Ga0307411_10155877 3300032005 Bacteria 1703
227 Ga0307415_100018023 3300032126 Bacteria 4250
228 Ga0307415_100038661 3300032126 Bacteria 3147
229 Ga0307415_100067199 3300032126 Bacteria 2504
230 Ga0307415_100361326 3300032126 Bacteria 1226
231 Ga0307507_10000732 3300033179 Bacteria 72083
232 Ga0316582_0144176 3300036647 Bacteria 1607
233 Ga0395900_0136308 3300037418 Bacteria 2515
234 Ga0395905_0192851 3300037471 Bacteria 1911
235 Ga0395901_0256424 3300038443 Bacteria 1821
236 Ga0436365_0636415 3300039437 Bacteria 1149
237 Ga0451841_0799526 3300041498 Bacteria 1064
238 Ga0451843_1175812 3300041509 Bacteria 1149
239 Ga0439431_0001614 3300041997 Bacteria 5001
240 Ga0439449_0159262 3300042007 Bacteria 843
241 Ga0466969_0015589 3300044656 Bacteria 3982
242 Ga0466972_0035094 3300044658 Bacteria 2455
243 Ga0466965_0043784 3300044683 Bacteria 2211
244 Ga0466966_0099031 3300044684 Bacteria 1804
245 Ga0466966_0128372 3300044684 Bacteria 1553
246 Ga0466961_0010164 3300044693 Bacteria 5995
247 Ga0466961_0034079 3300044693 Bacteria 3269
248 Ga0466961_0211043 3300044693 Bacteria 1198
249 Ga0466963_0025465 3300044694 Bacteria 3773
250 Ga0466963_0062099 3300044694 Bacteria 2499
251 Ga0466963_0126100 3300044694 Bacteria 1765
252 Ga0466963_0409281 3300044694 Bacteria 956
253 Ga0466964_0006679 3300044706 Bacteria 4302
254 Ga0466964_0007475 3300044706 Bacteria 4089
255 Ga0466964_0017169 3300044706 Bacteria 2769
256 Ga0466971_0041305 3300044719 Bacteria 2071
257 Ga0466970_0007562 3300044765 Bacteria 5449
258 Ga0466970_0011035 3300044765 Bacteria 4599
259 Ga0466970_0075436 3300044765 Bacteria 1816
260 Ga0466970_0173187 3300044765 Bacteria 1196
261 Ga0466957_0007470 3300044842 Bacteria 6173
262 Ga0466957_0184849 3300044842 Bacteria 1362
263 Ga0466960_0044023 3300044901 Bacteria 2126
264 Ga0466960_0093672 3300044901 Bacteria 1535
265 Ga0466960_0096647 3300044901 Bacteria 1514
266 Ga0466960_0104829 3300044901 Bacteria 1461
267 Ga0466960_0142210 3300044901 Bacteria 1275
268 Ga0466960_0206738 3300044901 Bacteria 1075
269 Ga0466959_0050251 3300045049 Bacteria 3061
270 Ga0466959_0172036 3300045049 Bacteria 1519
271 Ga0466958_0107716 3300045836 Bacteria 1738
272 Ga0466967_0006383 3300045976 Bacteria 8335
273 Ga0466967_0009294 3300045976 Bacteria 7283
274 Ga0466967_0011324 3300045976 Bacteria 6746
275 Ga0466967_0029646 3300045976 Bacteria 4582
276 Ga0466967_0361437 3300045976 Bacteria 1407
277 Ga0466967_0453532 3300045976 Bacteria 1253
278 Ga0466967_0501852 3300045976 Bacteria 1191
279 Ga0466967_0755373 3300045976 Bacteria 964
280 Ga0466967_0958189 3300045976 Bacteria 852
281 Ga0495603_0003342 3300046455 Bacteria 9553
282 Ga0495603_0077164 3300046455 Bacteria 1955
283 Ga0495629_0007330 3300046459 Bacteria 8128
284 Ga0495629_0031838 3300046459 Bacteria 3734
285 Ga0495629_0239794 3300046459 Bacteria 1249
286 Ga0495638_0117339 3300046460 Bacteria 1575
287 Ga0495641_0121566 3300046461 Bacteria 1165
288 Ga0495664_0052174 3300046477 Bacteria 2429
289 Ga0495585_0057610 3300046492 Bacteria 2144
290 Ga0495594_0003094 3300046499 Bacteria 8615
291 Ga0495594_0130642 3300046499 Bacteria 1422
292 Ga0495610_0044883 3300046512 Bacteria 2191
293 Ga0495620_0055996 3300046515 Bacteria 1660
294 Ga0495632_0021191 3300046519 Bacteria 3506
295 Ga0495643_0005927 3300046522 Bacteria 8157
296 Ga0495622_0020768 3300046557 Bacteria 3057
297 Ga0495622_0042788 3300046557 Bacteria 2105
298 Ga0495622_0098828 3300046557 Bacteria 1338
299 Ga0495633_0036162 3300046558 Bacteria 2367
300 Ga0495611_0271338 3300046648 Bacteria 784
301 Ga0495635_0052768 3300046663 Bacteria 2801
302 Ga0495588_0009677 3300046674 Bacteria 4465
303 Ga0495613_0133344 3300046689 Bacteria 1778
304 Ga0495670_0001559 3300046691 Bacteria 11206
305 Ga0495671_0127442 3300046692 Bacteria 1241
306 Ga0495660_0061203 3300046810 Bacteria 2020
307 Ga0495581_0105352 3300047315 Bacteria 1639
308 Ga0495636_0028878 3300047318 Bacteria 2263
309 Ga0495674_0439147 3300047319 Bacteria 1050
310 Ga0495676_0120579 3300047321 Bacteria 1908
311 Ga0495687_050875 3300047443 Bacteria 1762
312 Ga0495679_027349 3300047446 Bacteria 1883
313 Ga0495685_003278 3300047447 Bacteria 5155
314 Ga0495681_0002966 3300047470 Bacteria 11958
315 Ga0495686_0103386 3300047472 Bacteria 1716
316 Ga0496100_0114988 3300048903 Bacteria 1875
317 Ga0496101_0084526 3300048904 Bacteria 2350
318 Ga0496101_0667877 3300048904 Bacteria 821
319 Ga0496102_0022226 3300048905 Bacteria 5618
320 Ga0496103_0030525 3300048906 Bacteria 3280
321 Ga0496103_0114177 3300048906 Bacteria 1717
322 Ga0496104_0018252 3300048907 Bacteria 6399
323 Ga0496105_0003552 3300048908 Bacteria 11560
324 Ga0496105_0033385 3300048908 Bacteria 4226
325 Ga0496106_0031300 3300048909 Bacteria 3964
326 Ga0496107_0028684 3300048910 Bacteria 3956
327 Ga0496107_0035397 3300048910 Bacteria 3579
328 Ga0496107_0249388 3300048910 Bacteria 1321
329 Ga0496107_0651384 3300048910 Bacteria 776
330 Ga0496108_0024390 3300048911 Bacteria 4979
331 Ga0496108_0026479 3300048911 Bacteria 4783
332 Ga0496108_0033149 3300048911 Bacteria 4291
333 Ga0496108_0217913 3300048911 Bacteria 1658
334 Ga0496108_0263797 3300048911 Bacteria 1499
335 Ga0496108_0346936 3300048911 Bacteria 1295
336 Ga0496109_0014258 3300048912 Bacteria 6916
337 Ga0496109_0141777 3300048912 Bacteria 2247
338 Ga0496109_0174374 3300048912 Bacteria 2018
339 Ga0496109_0594496 3300048912 Bacteria 1043
340 Ga0496110_0015251 3300048913 Bacteria 6390
341 Ga0496111_0442569 3300048914 Bacteria 959
342 Ga0496114_0000460 3300048917 Bacteria 29879
343 Ga0496114_0024882 3300048917 Bacteria 4888
344 Ga0496114_0061287 3300048917 Bacteria 3146
345 Ga0496114_0099968 3300048917 Bacteria 2474
346 Ga0496114_0483700 3300048917 Bacteria 1095
347 Ga0496115_0125812 3300048918 Bacteria 2111
348 Ga0496115_0168080 3300048918 Bacteria 1813
349 Ga0496124_0067347 3300048927 Bacteria 2980
350 Ga0501310_006442 3300049130 Bacteria 1232
351 Ga0501315_019360 3300049531 Bacteria 905
352 Ga0501317_006127 3300049533 Bacteria 1310
353 Ga0501321_017214 3300049537 Bacteria 867
354 Ga0501323_001994 3300049539 Bacteria 1919
355 Ga0501325_008489 3300049541 Bacteria 893
356 Ga0501031_0125049 3300049568 Bacteria 1680
357 Ga0501031_0203816 3300049568 Bacteria 1290
358 Ga0501031_0232688 3300049568 Bacteria 1199
359 Ga0501032_0009757 3300049569 Bacteria 6947
360 Ga0501032_0183024 3300049569 Bacteria 1371
361 Ga0501033_0004999 3300049570 Bacteria 10550
362 Ga0501033_0037173 3300049570 Bacteria 3645
363 Ga0501033_0135888 3300049570 Bacteria 1779
364 Ga0501034_0001740 3300049571 Bacteria 27957
365 Ga0501034_0003379 3300049571 Bacteria 18219
366 Ga0501034_0036766 3300049571 Bacteria 4959
367 Ga0501034_0077107 3300049571 Bacteria 3338
368 Ga0501034_0280607 3300049571 Bacteria 1605
369 Ga0501034_0479023 3300049571 Bacteria 1160
370 Ga0501036_0002037 3300049572 Bacteria 15746
371 Ga0501036_0018442 3300049572 Bacteria 5847
372 Ga0501036_0057312 3300049572 Bacteria 3300
373 Ga0501036_0121205 3300049572 Bacteria 2208
374 Ga0501036_0171980 3300049572 Bacteria 1825
375 Ga0501036_0259222 3300049572 Bacteria 1456
376 Ga0501037_0007263 3300049573 Bacteria 8097
377 Ga0501037_0033044 3300049573 Bacteria 3822
378 Ga0501037_0235116 3300049573 Bacteria 1286
379 Ga0501038_0001498 3300049574 Bacteria 21504
380 Ga0501038_0014174 3300049574 Bacteria 7262
381 Ga0501038_0027384 3300049574 Bacteria 5071
382 Ga0501038_0228313 3300049574 Bacteria 1482
383 Ga0501038_0538177 3300049574 Bacteria 889
384 Ga0501039_0024033 3300049575 Bacteria 4680
385 Ga0501039_0035598 3300049575 Bacteria 3842
386 Ga0501039_0077826 3300049575 Bacteria 2579
387 Ga0501039_0091475 3300049575 Bacteria 2371
388 Ga0501040_0225426 3300049576 Bacteria 1334
389 Ga0501041_0026842 3300049577 Bacteria 3468
390 Ga0501041_0143161 3300049577 Bacteria 1491
391 Ga0501041_0169510 3300049577 Bacteria 1366
392 Ga0501041_0184819 3300049577 Bacteria 1305
393 Ga0501042_0024706 3300049578 Bacteria 4216
394 Ga0501042_0223895 3300049578 Bacteria 1357
395 Ga0501042_0352290 3300049578 Bacteria 1065
396 Ga0501043_0004426 3300049579 Bacteria 11410
397 Ga0501043_0005773 3300049579 Bacteria 9964
398 Ga0501043_0069331 3300049579 Bacteria 2769
399 Ga0501043_0106845 3300049579 Bacteria 2198
400 Ga0501043_0321576 3300049579 Bacteria 1179
401 Ga0501043_0430969 3300049579 Bacteria 993
402 Ga0501046_0000573 3300049580 Bacteria 36317
403 Ga0501046_0004929 3300049580 Bacteria 12008
404 Ga0501046_0017923 3300049580 Bacteria 5902
405 Ga0501047_0024465 3300049581 Bacteria 5794
406 Ga0501047_0038848 3300049581 Bacteria 4604
407 Ga0501047_0042203 3300049581 Bacteria 4408
408 Ga0501047_0057802 3300049581 Bacteria 3750
409 Ga0501047_0064179 3300049581 Bacteria 3542
410 Ga0501048_0105739 3300049582 Bacteria 1986
411 Ga0501048_0293507 3300049582 Bacteria 1156
412 Ga0501048_0379738 3300049582 Bacteria 1009
413 Ga0501067_0007513 3300049583 Bacteria 6056
414 Ga0501067_0009342 3300049583 Bacteria 5433
415 Ga0501067_0241973 3300049583 Bacteria 1004
416 Ga0501067_0243177 3300049583 Bacteria 1001
417 Ga0501068_0003535 3300049584 Bacteria 8443
418 Ga0501068_0032694 3300049584 Bacteria 3093
419 Ga0501069_0062515 3300049585 Bacteria 2079
420 Ga0501069_0114241 3300049585 Bacteria 1539
421 Ga0501069_0146061 3300049585 Bacteria 1358
422 Ga0501070_0006853 3300049586 Bacteria 9696
423 Ga0501070_0007922 3300049586 Bacteria 8998
424 Ga0501070_0026250 3300049586 Bacteria 4890
425 Ga0501070_0123770 3300049586 Bacteria 2137
426 Ga0501070_0215351 3300049586 Bacteria 1576
427 Ga0501070_0453251 3300049586 Bacteria 1034
428 Ga0501070_0524269 3300049586 Bacteria 950
429 Ga0501070_0564438 3300049586 Bacteria 910
430 Ga0501071_0007954 3300049587 Bacteria 6994
431 Ga0501071_0084515 3300049587 Bacteria 2326
432 Ga0501071_0095104 3300049587 Bacteria 2192
433 Ga0501071_0208036 3300049587 Bacteria 1471
434 Ga0501071_0475518 3300049587 Bacteria 957
435 Ga0501072_0139287 3300049588 Bacteria 1934
436 Ga0501072_0222187 3300049588 Bacteria 1505
437 Ga0501072_0382764 3300049588 Bacteria 1116
438 Ga0501074_0006164 3300049590 Bacteria 8656
439 Ga0501074_0009058 3300049590 Bacteria 7228
440 Ga0501074_0009128 3300049590 Bacteria 7200
441 Ga0501074_0010125 3300049590 Bacteria 6845
442 Ga0501074_0349271 3300049590 Bacteria 1050
443 Ga0501075_0119393 3300049591 Bacteria 2006
444 Ga0501075_0359991 3300049591 Bacteria 1109
445 Ga0501075_0409881 3300049591 Bacteria 1033
446 Ga0501075_0499576 3300049591 Bacteria 928
447 Ga0501076_0041126 3300049592 Bacteria 3635
448 Ga0501076_0339931 3300049592 Bacteria 1232
449 Ga0501076_0418913 3300049592 Bacteria 1102
450 Ga0501077_0065715 3300049593 Bacteria 2300
451 Ga0501235_079720 3300049669 Bacteria 781
452 Ga0501079_0058010 3300049741 Bacteria 2987
453 Ga0501079_0340333 3300049741 Bacteria 1175
454 Ga0501080_0001653 3300049742 Bacteria 18957
455 Ga0501080_0047628 3300049742 Bacteria 3991
456 Ga0501080_0292225 3300049742 Bacteria 1480
457 Ga0501080_0913458 3300049742 Bacteria 765
458 Ga0501083_0002526 3300049744 Bacteria 12559
459 Ga0501035_0010029 3300049822 Bacteria 8790
460 Ga0501035_0029467 3300049822 Bacteria 5005
461 Ga0501035_0061513 3300049822 Bacteria 3341
462 Ga0501035_0445861 3300049822 Bacteria 1071
463 Ga0501035_0587895 3300049822 Bacteria 908
464 Ga0501044_0016515 3300049823 Bacteria 7923
465 Ga0501044_0021472 3300049823 Bacteria 6885
466 Ga0501044_0110224 3300049823 Bacteria 2761
467 Ga0501045_0072765 3300049824 Bacteria 2531
468 Ga0501045_0254682 3300049824 Bacteria 1306
469 nmdc:mga03683_11805_c1 3300050489 Bacteria 3175
470 nmdc:mga03683_39807_c1 3300050489 Bacteria 1925
471 nmdc:mga03n38_3234_c1 3300050490 Bacteria 5196
472 nmdc:mga03n38_4553_c1 3300050490 Bacteria 4612
473 nmdc:mga03n38_58187_c1 3300050490 Bacteria 1750
474 nmdc:mga00v17_100084_c1 3300050491 Bacteria 1829
475 nmdc:mga00v17_138267_c1 3300050491 Bacteria 1561
476 nmdc:mga00v17_177816_c1 3300050491 Bacteria 1373
477 nmdc:mga00v17_331272_c1 3300050491 Bacteria 989
478 nmdc:mga00v17_457077_c1 3300050491 Bacteria 829
479 nmdc:mga00v17_46218_c1 3300050491 Bacteria 2634
480 nmdc:mga00v17_52481_c1 3300050491 Bacteria 2481
481 nmdc:mga0yw44_144507_c1 3300050492 Bacteria 1548
482 nmdc:mga0yw44_14904_c1 3300050492 Bacteria 4146
483 nmdc:mga0yw44_16508_c1 3300050492 Bacteria 3990
484 nmdc:mga0yw44_213908_c1 3300050492 Bacteria 1276
485 nmdc:mga0yw44_22421_c1 3300050492 Bacteria 3541
486 nmdc:mga0yw44_278514_c1 3300050492 Bacteria 1118
487 nmdc:mga0yw44_39974_c1 3300050492 Bacteria 2783
488 nmdc:mga0yw44_517_c1 3300050492 Bacteria 13812
489 nmdc:mga0yw44_968_c1 3300050492 Bacteria 10931
490 nmdc:mga06z11_173916_c1 3300050494 Bacteria 1238
491 nmdc:mga06z11_19094_c1 3300050494 Bacteria 3145
492 nmdc:mga04h51_71412_c1 3300050495 Bacteria 1213
493 nmdc:mga04h51_7848_c1 3300050495 Bacteria 2836
494 nmdc:mga07m45_176372_c1 3300050496 Bacteria 1243
495 nmdc:mga07m45_29069_c1 3300050496 Bacteria 3054
496 nmdc:mga07m45_39766_c1 3300050496 Bacteria 2630
497 nmdc:mga08y16_861659_c1 3300050511 Bacteria 894
498 Ga0495655_0004436 3300053083 Bacteria 2398
499 Ga0495619_0297497 3300053085 Bacteria 1118
500 Ga0495619_0394075 3300053085 Bacteria 956
501 Ga0500578_0015402 3300053086 Bacteria 4913
502 Ga0500644_0000177 3300053088 Bacteria 40984
503 Ga0500654_039095 3300053099 Bacteria 2721
504 Ga0500660_040507 3300053100 Bacteria 2373
505 Ga0500556_0001149 3300053104 Bacteria 12884
506 Ga0500556_0012407 3300053104 Bacteria 2546
507 Ga0500569_001115 3300053109 Bacteria 4932
508 Ga0500593_001601 3300053117 Bacteria 8155
509 Ga0500594_0043508 3300053118 Bacteria 1239
510 Ga0500614_026192 3300053123 Bacteria 1392
511 Ga0500628_001322 3300053129 Bacteria 4265
512 Ga0500652_063438 3300053131 Bacteria 1524
513 Ga0500658_0006114 3300053134 Bacteria 4478
514 Ga0500561_0000631 3300053137 Bacteria 5605
515 Ga0500573_0027002 3300053140 Bacteria 3300
516 Ga0500579_078945 3300053143 Bacteria 1853
517 Ga0500588_0044352 3300053146 Bacteria 1356
518 Ga0500600_0036245 3300053149 Bacteria 2867
519 Ga0500600_0102290 3300053149 Bacteria 1509
520 Ga0500633_0006450 3300053160 Bacteria 2877
521 Ga0500634_0084491 3300053161 Bacteria 1626
522 Ga0500656_000979 3300053732 Bacteria 2327
523 Ga0500587_005804 3300053739 Bacteria 1651
524 Ga0501084_0012462 3300054114 Bacteria 7046
525 Ga0501084_0252449 3300054114 Bacteria 1489
526 Ga0590071_023877 3300059421 Bacteria 1448
527 Ga0590075_011519 3300059424 Bacteria 2139
528 Ga0590077_006452 3300059426 Bacteria 2403
529 Ga0501082_0033340 3300060353 Bacteria 4443
530 Ga0501082_0302411 3300060353 Bacteria 1393
531 Ga0466962_0061174 3300061719 Bacteria 1797
532 Ga0466962_0158116 3300061719 Bacteria 1101
533 Ga0466962_0174750 3300061719 Bacteria 1046
534 Ga0530510_0133063 3300061734 Bacteria 1830
535 Ga0530510_0310936 3300061734 Bacteria 1180
536 Ga0530510_0516314 3300061734 Bacteria 906
537 Ga0530510_0550306 3300061734 Bacteria 876
538 2643823854 2643221561 Bacteria 4984412
539 2644231499 2643221641 Bacteria 4490190
540 2644533130 2643221696 Bacteria 5431823
541 2740167418 2739367898 Bacteria 4367674
542 2774396562 2773857762 Bacteria 5971770
543 2809198228 2808606439 Bacteria 5952208
544 2812353100 2811994878 Bacteria 5992952
545 2816423891 2816332119 Bacteria 8120218
546 2855389187 2855386786 Bacteria 4752232
547 2891969273 2891968417 Bacteria 5821697
548 2984580678 2984576629 Bacteria 4248407
549 2990258370 2990256926 Bacteria 4252839
550 8054614395 8054609563 Bacteria 5170090
551 Ga0451853_2030011
552 JGI24739J22299_10051104
553 JGI24737J22298_10009946
554 JGI24735J21928_10011115
555 JGI24735J21928_10069493
556 Ga0058859_11725277
557 Ga0070658_10019441
558 Ga0070658_10057489
559 Ga0070683_100000255
560 Ga0070683_100066245
561 Ga0070683_100130373
562 Ga0070682_100468695
563 Ga0068868_100372667
564 Ga0070660_100163694
565 Ga0070660_100242389
566 Ga0070687_100103638
567 Ga0070687_100174045
568 Ga0070692_10003834
569 Ga0070692_10008723
570 Ga0070668_100237829
571 Ga0070674_100007958
572 Ga0070674_100079440
573 Ga0070673_100135117
574 Ga0070659_100011998
575 Ga0070659_100279060
576 Ga0070659_100379332
577 Ga0070667_100009931
578 Ga0070667_100034919
579 Ga0070714_100003056
580 Ga0070714_100418066
581 Ga0070713_100039451
582 Ga0070701_10001347
583 Ga0070700_100014673
584 Ga0070663_100382387
585 Ga0070678_100449479
586 Ga0070681_10697556
587 Ga0068867_100555749
588 Ga0070698_100000984
589 Ga0070679_100014462
590 Ga0070679_100489743
591 Ga0070684_100033857
592 Ga0070684_100170364
593 Ga0070684_100309033
594 Ga0070684_100318901
595 Ga0070684_100572825
596 Ga0070672_100010596
597 Ga0070693_100451921
598 Ga0070665_100001445
599 Ga0068855_100002565
600 Ga0070664_100087873
601 Ga0070664_100407688
602 Ga0068857_100009915
603 Ga0068854_100003536
604 Ga0068854_100421543
605 Ga0068856_100097403
606 Ga0068856_100113866
607 Ga0068856_100366854
608 Ga0070702_100003328
609 Ga0070702_100026862
610 Ga0070702_100051898
611 Ga0068864_100615759
612 Ga0068861_100429678
613 Ga0068861_100479287
614 Ga0068870_10002535
615 Ga0068860_100002101
616 Ga0068860_100185445
617 Ga0081539_10074430
618 Ga0075365_10000461
619 Ga0075365_10044673
620 Ga0075365_10151813
621 Ga0075365_10251257
622 Ga0075365_10313526
623 Ga0075368_10004259
624 Ga0075368_10019422
625 Ga0075363_100003090
626 Ga0075363_100056450
627 Ga0075364_10065305
628 Ga0075364_10178000
629 Ga0075364_10423670
630 Ga0075362_10003858
631 Ga0075367_10024971
632 Ga0075367_10051575
633 Ga0075367_10087505
634 Ga0075367_10313792
635 Ga0068865_100041407
636 Ga0105240_10017510
637 Ga0105240_10563182
638 Ga0105245_10072534
639 Ga0105243_10003624
640 Ga0105243_10064639
641 Ga0105243_10751183
642 Ga0105241_10001838
643 Ga0105237_10017138
644 Ga0105237_10391883
645 Ga0105238_10002247
646 Ga0105249_10062314
647 Ga0105249_10139877
648 Ga0105249_10155316
649 Ga0105249_10423687
650 Ga0105249_11075928
651 Ga0105239_10008658
652 Ga0105239_10031983
653 Ga0105246_10001851
654 Ga0157371_10063902
655 Ga0157369_10784313
656 Ga0157372_10011409
657 Ga0157372_10050623
658 Ga0157372_10149538
659 Ga0157375_10110310
660 Ga0163163_10074284
661 Ga0163163_10273831
662 Ga0163163_10337783
663 Ga0163163_10658598
664 Ga0182008_10062129
665 Ga0157377_10132981
666 Ga0157379_10016422
667 Ga0157376_10458546
668 Ga0163161_10031658
669 Ga0197907_11214155
670 Ga0206356_11850484
671 Ga0206354_11270840
672 Ga0206353_12054289
673 Ga0224712_10145284
674 Ga0207688_10077915
675 Ga0207688_10083232
676 Ga0207688_10292090
677 Ga0207647_10013690
678 Ga0207647_10036888
679 Ga0207643_10009627
680 Ga0207643_10024039
681 Ga0207705_10037198
682 Ga0207705_10107195
683 Ga0207684_10511563
684 Ga0207654_10002294
685 Ga0207707_10389066
686 Ga0207695_10001509
687 Ga0207671_10000840
688 Ga0207671_10499555
689 Ga0207660_10241683
690 Ga0207662_10191945
691 Ga0207662_10263099
692 Ga0207657_10035004
693 Ga0207657_10272356
694 Ga0207652_10017228
695 Ga0207652_10475267
696 Ga0207694_10000884
697 Ga0207650_10224860
698 Ga0207659_10212973
699 Ga0207687_10145841
700 Ga0207687_10146387
701 Ga0207700_10040242
702 Ga0207664_10018127
703 Ga0207664_10167748
704 Ga0207690_10017588
705 Ga0207690_10081212
706 Ga0207690_10199279
707 Ga0207690_10201820
708 Ga0207709_10137504
709 Ga0207709_10385195
710 Ga0207669_10072100
711 Ga0207704_10011925
712 Ga0207711_10035655
713 Ga0207711_10176917
714 Ga0207661_10128084
715 Ga0207661_10175805
716 Ga0207661_10251850
717 Ga0207679_10076210
718 Ga0207679_10272971
719 Ga0207679_10370396
720 Ga0207667_10007150
721 Ga0207651_10025040
722 Ga0207712_10045307
723 Ga0207712_10278081
724 Ga0207668_10060427
725 Ga0207640_10003385
726 Ga0207658_10004119
727 Ga0207658_10219019
728 Ga0207677_10253802
729 Ga0207677_10327813
730 Ga0207703_10637025
731 Ga0207639_10096426
732 Ga0207639_10103185
733 Ga0207708_10023164
734 Ga0207702_10051931
735 Ga0207702_10158010
736 Ga0207702_10347087
737 Ga0207702_10567453
738 Ga0207648_10014649
739 Ga0207648_10082066
740 Ga0207648_10728517
741 Ga0207674_10005034
742 Ga0207675_100001267
743 Ga0207675_100147084
744 Ga0207675_100385742
745 Ga0207683_10031384
746 Ga0207683_10449812
747 Ga0207698_10181356
748 Ga0209813_10000637
749 Ga0268266_10017771
750 Ga0268266_10164084
751 Ga0268264_10000552
752 Ga0307517_10005535
753 Ga0307508_10116492
754 Ga0265314_10200807
755 Ga0316576_10010027
756 Ga0316578_10030584
757 Ga0307516_10024463
758 Ga0307405_10187742
759 Ga0307405_10541705
760 Ga0307413_10088501
761 Ga0307410_10057777
762 Ga0307410_10125612
763 Ga0307407_10280008
764 Ga0307407_10548096
765 Ga0307412_10095288
766 Ga0307409_100045518
767 Ga0307409_100173322
768 Ga0307409_100199866
769 Ga0307409_100505257
770 Ga0307416_100019954
771 Ga0307416_100029065
772 Ga0307416_100038029
773 Ga0307416_100330670
774 Ga0307414_10066249
775 Ga0307411_10051572
776 Ga0307411_10155877
777 Ga0307415_100018023
778 Ga0307415_100038661
779 Ga0307415_100067199
780 Ga0307415_100361326
781 Ga0307507_10000732
782 Ga0316582_0144176
783 Ga0395900_0136308
784 Ga0395905_0192851
785 Ga0395901_0256424
786 Ga0436365_0636415
787 Ga0451841_0799526
788 Ga0451843_1175812
789 Ga0439431_0001614
790 Ga0439449_0159262
791 Ga0466969_0015589
792 Ga0466972_0035094
793 Ga0466965_0043784
794 Ga0466966_0099031
795 Ga0466966_0128372
796 Ga0466961_0010164
797 Ga0466961_0034079
798 Ga0466961_0211043
799 Ga0466963_0025465
800 Ga0466963_0062099
801 Ga0466963_0126100
802 Ga0466963_0409281
803 Ga0466964_0006679
804 Ga0466964_0007475
805 Ga0466964_0017169
806 Ga0466971_0041305
807 Ga0466970_0007562
808 Ga0466970_0011035
809 Ga0466970_0075436
810 Ga0466970_0173187
811 Ga0466957_0007470
812 Ga0466957_0184849
813 Ga0466960_0044023
814 Ga0466960_0093672
815 Ga0466960_0096647
816 Ga0466960_0104829
817 Ga0466960_0142210
818 Ga0466960_0206738
819 Ga0466959_0050251
820 Ga0466959_0172036
821 Ga0466958_0107716
822 Ga0466967_0006383
823 Ga0466967_0009294
824 Ga0466967_0011324
825 Ga0466967_0029646
826 Ga0466967_0361437
827 Ga0466967_0453532
828 Ga0466967_0501852
829 Ga0466967_0755373
830 Ga0466967_0958189
831 Ga0495603_0003342
832 Ga0495603_0077164
833 Ga0495629_0007330
834 Ga0495629_0031838
835 Ga0495629_0239794
836 Ga0495638_0117339
837 Ga0495641_0121566
838 Ga0495664_0052174
839 Ga0495585_0057610
840 Ga0495594_0003094
841 Ga0495594_0130642
842 Ga0495610_0044883
843 Ga0495620_0055996
844 Ga0495632_0021191
845 Ga0495643_0005927
846 Ga0495622_0020768
847 Ga0495622_0042788
848 Ga0495622_0098828
849 Ga0495633_0036162
850 Ga0495611_0271338
851 Ga0495635_0052768
852 Ga0495588_0009677
853 Ga0495613_0133344
854 Ga0495670_0001559
855 Ga0495671_0127442
856 Ga0495660_0061203
857 Ga0495581_0105352
858 Ga0495636_0028878
859 Ga0495674_0439147
860 Ga0495676_0120579
861 Ga0495687_050875
862 Ga0495679_027349
863 Ga0495685_003278
864 Ga0495681_0002966
865 Ga0495686_0103386
866 Ga0496100_0114988
867 Ga0496101_0084526
868 Ga0496101_0667877
869 Ga0496102_0022226
870 Ga0496103_0030525
871 Ga0496103_0114177
872 Ga0496104_0018252
873 Ga0496105_0003552
874 Ga0496105_0033385
875 Ga0496106_0031300
876 Ga0496107_0028684
877 Ga0496107_0035397
878 Ga0496107_0249388
879 Ga0496107_0651384
880 Ga0496108_0024390
881 Ga0496108_0026479
882 Ga0496108_0033149
883 Ga0496108_0217913
884 Ga0496108_0263797
885 Ga0496108_0346936
886 Ga0496109_0014258
887 Ga0496109_0141777
888 Ga0496109_0174374
889 Ga0496109_0594496
890 Ga0496110_0015251
891 Ga0496111_0442569
892 Ga0496114_0000460
893 Ga0496114_0024882
894 Ga0496114_0061287
895 Ga0496114_0099968
896 Ga0496114_0483700
897 Ga0496115_0125812
898 Ga0496115_0168080
899 Ga0496124_0067347
900 Ga0501310_006442
901 Ga0501315_019360
902 Ga0501317_006127
903 Ga0501321_017214
904 Ga0501323_001994
905 Ga0501325_008489
906 Ga0501031_0125049
907 Ga0501031_0203816
908 Ga0501031_0232688
909 Ga0501032_0009757
910 Ga0501032_0183024
911 Ga0501033_0004999
912 Ga0501033_0037173
913 Ga0501033_0135888
914 Ga0501034_0001740
915 Ga0501034_0003379
916 Ga0501034_0036766
917 Ga0501034_0077107
918 Ga0501034_0280607
919 Ga0501034_0479023
920 Ga0501036_0002037
921 Ga0501036_0018442
922 Ga0501036_0057312
923 Ga0501036_0121205
924 Ga0501036_0171980
925 Ga0501036_0259222
926 Ga0501037_0007263
927 Ga0501037_0033044
928 Ga0501037_0235116
929 Ga0501038_0001498
930 Ga0501038_0014174
931 Ga0501038_0027384
932 Ga0501038_0228313
933 Ga0501038_0538177
934 Ga0501039_0024033
935 Ga0501039_0035598
936 Ga0501039_0077826
937 Ga0501039_0091475
938 Ga0501040_0225426
939 Ga0501041_0026842
940 Ga0501041_0143161
941 Ga0501041_0169510
942 Ga0501041_0184819
943 Ga0501042_0024706
944 Ga0501042_0223895
945 Ga0501042_0352290
946 Ga0501043_0004426
947 Ga0501043_0005773
948 Ga0501043_0069331
949 Ga0501043_0106845
950 Ga0501043_0321576
951 Ga0501043_0430969
952 Ga0501046_0000573
953 Ga0501046_0004929
954 Ga0501046_0017923
955 Ga0501047_0024465
956 Ga0501047_0038848
957 Ga0501047_0042203
958 Ga0501047_0057802
959 Ga0501047_0064179
960 Ga0501048_0105739
961 Ga0501048_0293507
962 Ga0501048_0379738
963 Ga0501067_0007513
964 Ga0501067_0009342
965 Ga0501067_0241973
966 Ga0501067_0243177
967 Ga0501068_0003535
968 Ga0501068_0032694
969 Ga0501069_0062515
970 Ga0501069_0114241
971 Ga0501069_0146061
972 Ga0501070_0006853
973 Ga0501070_0007922
974 Ga0501070_0026250
975 Ga0501070_0123770
976 Ga0501070_0215351
977 Ga0501070_0453251
978 Ga0501070_0524269
979 Ga0501070_0564438
980 Ga0501071_0007954
981 Ga0501071_0084515
982 Ga0501071_0095104
983 Ga0501071_0208036
984 Ga0501071_0475518
985 Ga0501072_0139287
986 Ga0501072_0222187
987 Ga0501072_0382764
988 Ga0501074_0006164
989 Ga0501074_0009058
990 Ga0501074_0009128
991 Ga0501074_0010125
992 Ga0501074_0349271
993 Ga0501075_0119393
994 Ga0501075_0359991
995 Ga0501075_0409881
996 Ga0501075_0499576
997 Ga0501076_0041126
998 Ga0501076_0339931
999 Ga0501076_0418913
1000 Ga0501077_0065715
1001 Ga0501235_079720
1002 Ga0501079_0058010
1003 Ga0501079_0340333
1004 Ga0501080_0001653
1005 Ga0501080_0047628
1006 Ga0501080_0292225
1007 Ga0501080_0913458
1008 Ga0501083_0002526
1009 Ga0501035_0010029
1010 Ga0501035_0029467
1011 Ga0501035_0061513
1012 Ga0501035_0445861
1013 Ga0501035_0587895
1014 Ga0501044_0016515
1015 Ga0501044_0021472
1016 Ga0501044_0110224
1017 Ga0501045_0072765
1018 Ga0501045_0254682
1019 nmdc:mga03683_11805_c1
1020 nmdc:mga03683_39807_c1
1021 nmdc:mga03n38_3234_c1
1022 nmdc:mga03n38_4553_c1
1023 nmdc:mga03n38_58187_c1
1024 nmdc:mga00v17_100084_c1
1025 nmdc:mga00v17_138267_c1
1026 nmdc:mga00v17_177816_c1
1027 nmdc:mga00v17_331272_c1
1028 nmdc:mga00v17_457077_c1
1029 nmdc:mga00v17_46218_c1
1030 nmdc:mga00v17_52481_c1
1031 nmdc:mga0yw44_144507_c1
1032 nmdc:mga0yw44_14904_c1
1033 nmdc:mga0yw44_16508_c1
1034 nmdc:mga0yw44_213908_c1
1035 nmdc:mga0yw44_22421_c1
1036 nmdc:mga0yw44_278514_c1
1037 nmdc:mga0yw44_39974_c1
1038 nmdc:mga0yw44_517_c1
1039 nmdc:mga0yw44_968_c1
1040 nmdc:mga06z11_173916_c1
1041 nmdc:mga06z11_19094_c1
1042 nmdc:mga04h51_71412_c1
1043 nmdc:mga04h51_7848_c1
1044 nmdc:mga07m45_176372_c1
1045 nmdc:mga07m45_29069_c1
1046 nmdc:mga07m45_39766_c1
1047 nmdc:mga08y16_861659_c1
1048 Ga0495655_0004436
1049 Ga0495619_0297497
1050 Ga0495619_0394075
1051 Ga0500578_0015402
1052 Ga0500644_0000177
1053 Ga0500654_039095
1054 Ga0500660_040507
1055 Ga0500556_0001149
1056 Ga0500556_0012407
1057 Ga0500569_001115
1058 Ga0500593_001601
1059 Ga0500594_0043508
1060 Ga0500614_026192
1061 Ga0500628_001322
1062 Ga0500652_063438
1063 Ga0500658_0006114
1064 Ga0500561_0000631
1065 Ga0500573_0027002
1066 Ga0500579_078945
1067 Ga0500588_0044352
1068 Ga0500600_0036245
1069 Ga0500600_0102290
1070 Ga0500633_0006450
1071 Ga0500634_0084491
1072 Ga0500656_000979
1073 Ga0500587_005804
1074 Ga0501084_0012462
1075 Ga0501084_0252449
1076 Ga0590071_023877
1077 Ga0590075_011519
1078 Ga0590077_006452
1079 Ga0501082_0033340
1080 Ga0501082_0302411
1081 Ga0466962_0061174
1082 Ga0466962_0158116
1083 Ga0466962_0174750
1084 Ga0530510_0133063
1085 Ga0530510_0310936
1086 Ga0530510_0516314
1087 Ga0530510_0550306
1088 2643823854
1089 2644231499
1090 2644533130
1091 2740167418
1092 2774396562
1093 2809198228
1094 2812353100
1095 2816423891
1096 2855389187
1097 2891969273
1098 2984580678
1099 2990258370
1100 8054614395

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

13

122

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

154

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9755 11 123
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.9677 10 125
2gwr-assembly1.cif.gz_A crystal structure of the response regulator protein mtra from mycobacterium tuberculosis 0.9644 7 232
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9641 11 126
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9632 11 126
ID Description Score Start End Superfamily
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9916 11 92 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9852 11 85 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9842 11 91 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.979 11 87 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9775 7 87 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2W6DFP8-F1-model_v4 DNA-binding response regulator MtrA 0.977 8 231 GO:0000156
GO:0000976
GO:0005829
GO:0032993
GO:0045893
AF-A0A847D0Q5-F1-model_v4 Response regulator 0.9683 11 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2N6BN45-F1-model_v4 deleted 0.9649 11 125
AF-A0A2N2TQE8-F1-model_v4 Adenylate/guanylate cyclase domain-containing response regulator 0.9646 10 126 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A2J0KYQ6-F1-model_v4 Response regulatory domain-containing protein 0.9614 11 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map