F462454

General Info

Members Datasets Scaffolds Average Seq Length
550 279 545 196

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100100150|Ga0070714_1001001504
Length 226
Sequence LTGVAAHIISRTPSLTAADAAGRRASGLRHDCGFAAYDDAVTKLAIIYYSATGHGTTMAQRVAAAAESAGAEVRLRHVTETQDPESFAHNPAWTANYEATKDLPSATGDDIVWAAAQLRAFLDSLGGLWAQGKLADKVYAGFTSSNTIHGGQETTLLSLYITLIHFGGIIVPPGYTDPCKFVDGNPYGASLVTTHDNIHEFDEPTGTALEHLARRVVQTAGRLTAS

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.09
Nodule 0
Rhizoplane 9.82
Rhizosphere 72
Stem 0
Stem Tuber 0
Unclassified 5.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000750 3300001977 Bacteria 4971
2 JGI24743J22301_10002800 3300001991 Bacteria 2680
3 JGI24750J21931_1021732 3300002070 Bacteria 901
4 JGI24748J21848_1020360 3300002074 Bacteria 799
5 JGI24744J21845_10000095 3300002077 Bacteria 11780
6 JGI24742J22300_10000302 3300002244 Bacteria 7329
7 JGI24751J29686_10003178 3300002459 Bacteria 3311
8 Ga0070676_10028028 3300005328 Bacteria 3198
9 Ga0070676_10082569 3300005328 Bacteria 1953
10 Ga0070683_100159595 3300005329 Bacteria 2139
11 Ga0070690_100057901 3300005330 Bacteria 2487
12 Ga0070690_100065093 3300005330 Bacteria 2357
13 Ga0068869_100080397 3300005334 Bacteria 2431
14 Ga0070666_10177335 3300005335 Bacteria 1494
15 Ga0070666_10266353 3300005335 Bacteria 1216
16 Ga0070680_100108527 3300005336 Bacteria 2309
17 Ga0070682_100022980 3300005337 Bacteria 3700
18 Ga0068868_100002071 3300005338 Bacteria 13785
19 Ga0068868_100122577 3300005338 Bacteria 2121
20 Ga0068868_100360609 3300005338 Bacteria 1247
21 Ga0068868_100632717 3300005338 Bacteria 951
22 Ga0070660_100488104 3300005339 Bacteria 1024
23 Ga0070689_100006880 3300005340 Bacteria 7912
24 Ga0070689_100041145 3300005340 Bacteria 3546
25 Ga0070691_10005589 3300005341 Bacteria 5721
26 Ga0070668_100000790 3300005347 Bacteria 21807
27 Ga0070668_100014914 3300005347 Bacteria 5810
28 Ga0070668_100074361 3300005347 Bacteria 2651
29 Ga0070668_100178606 3300005347 Bacteria 1733
30 Ga0070668_101037455 3300005347 Bacteria 738
31 Ga0070669_100011042 3300005353 Bacteria 6409
32 Ga0070669_100094260 3300005353 Bacteria 2249
33 Ga0070675_100038980 3300005354 Bacteria 3875
34 Ga0070675_100170456 3300005354 Bacteria 1876
35 Ga0070671_100014258 3300005355 Bacteria 6418
36 Ga0070671_100317534 3300005355 Bacteria 1327
37 Ga0070671_100453931 3300005355 Bacteria 1100
38 Ga0070671_100594476 3300005355 Bacteria 956
39 Ga0070674_100017482 3300005356 Bacteria 4513
40 Ga0070674_100256431 3300005356 Bacteria 1376
41 Ga0070673_100500631 3300005364 Bacteria 1099
42 Ga0070688_100005102 3300005365 Bacteria 6885
43 Ga0070688_100053025 3300005365 Bacteria 2536
44 Ga0070688_100791558 3300005365 Bacteria 741
45 Ga0070667_100002715 3300005367 Bacteria 15317
46 Ga0070667_100059387 3300005367 Bacteria 3235
47 Ga0070667_100652178 3300005367 Bacteria 972
48 Ga0070703_10027071 3300005406 Bacteria 1707
49 Ga0070709_10006332 3300005434 Bacteria 6444
50 Ga0070714_100100150 3300005435 Bacteria 2552
51 Ga0070714_101376199 3300005435 Bacteria 689
52 Ga0070710_10001756 3300005437 Bacteria 10253
53 Ga0070710_10117330 3300005437 Bacteria 1606
54 Ga0070701_10000291 3300005438 Bacteria 16372
55 Ga0070711_100000327 3300005439 Bacteria 24630
56 Ga0070711_100402410 3300005439 Bacteria 1111
57 Ga0070705_100004944 3300005440 Bacteria 6491
58 Ga0070700_100007330 3300005441 Bacteria 5948
59 Ga0070700_100015672 3300005441 Bacteria 4303
60 Ga0070694_100024768 3300005444 Bacteria 3875
61 Ga0070694_100108405 3300005444 Bacteria 1975
62 Ga0070663_100001238 3300005455 Bacteria 14027
63 Ga0070678_100000105 3300005456 Bacteria 32409
64 Ga0070678_100022456 3300005456 Bacteria 4182
65 Ga0070662_100008059 3300005457 Bacteria 6858
66 Ga0070662_100189721 3300005457 Bacteria 1625
67 Ga0070662_100466909 3300005457 Bacteria 1049
68 Ga0068867_100000723 3300005459 Bacteria 22069
69 Ga0068867_100800821 3300005459 Bacteria 840
70 Ga0070685_10046616 3300005466 Bacteria 2489
71 Ga0070685_10065295 3300005466 Bacteria 2141
72 Ga0070685_10124615 3300005466 Bacteria 1604
73 Ga0070679_100588278 3300005530 Bacteria 1056
74 Ga0070684_100069157 3300005535 Bacteria 3105
75 Ga0068853_100002069 3300005539 Bacteria 14881
76 Ga0068853_100114357 3300005539 Bacteria 2400
77 Ga0068853_100397278 3300005539 Bacteria 1290
78 Ga0070672_100242410 3300005543 Bacteria 1516
79 Ga0070686_100129838 3300005544 Bacteria 1741
80 Ga0070695_100015211 3300005545 Bacteria 4645
81 Ga0070696_100001184 3300005546 Bacteria 16907
82 Ga0070696_100384505 3300005546 Bacteria 1094
83 Ga0070693_100073211 3300005547 Bacteria 2023
84 Ga0070665_100006023 3300005548 Bacteria 12392
85 Ga0070665_100022017 3300005548 Bacteria 6412
86 Ga0070665_100038057 3300005548 Bacteria 4836
87 Ga0070704_100000016 3300005549 Bacteria 57860
88 Ga0068855_100676356 3300005563 Bacteria 1106
89 Ga0068855_100748721 3300005563 Bacteria 1042
90 Ga0068855_100761685 3300005563 Bacteria 1032
91 Ga0068854_100592366 3300005578 Bacteria 945
92 Ga0070702_100036646 3300005615 Bacteria 2719
93 Ga0070702_100150341 3300005615 Bacteria 1494
94 Ga0068852_100050589 3300005616 Bacteria 3561
95 Ga0068859_100000989 3300005617 Bacteria 29085
96 Ga0068859_100435689 3300005617 Bacteria 1407
97 Ga0068859_101028943 3300005617 Bacteria 905
98 Ga0068864_100540436 3300005618 Bacteria 1125
99 Ga0068866_10000152 3300005718 Bacteria 31563
100 Ga0068861_100000157 3300005719 Bacteria 35512
101 Ga0068861_100059737 3300005719 Bacteria 2920
102 Ga0068861_100189157 3300005719 Bacteria 1719
103 Ga0068870_10230742 3300005840 Bacteria 1138
104 Ga0068863_100037288 3300005841 Bacteria 4628
105 Ga0068863_100126275 3300005841 Bacteria 2440
106 Ga0068863_100529776 3300005841 Bacteria 1162
107 Ga0068858_100002244 3300005842 Bacteria 19527
108 Ga0068858_100228499 3300005842 Bacteria 1763
109 Ga0068860_100008060 3300005843 Bacteria 10498
110 Ga0068860_100232743 3300005843 Bacteria 1791
111 Ga0068862_100031053 3300005844 Bacteria 4506
112 Ga0068862_100176266 3300005844 Bacteria 1916
113 Ga0068862_100243070 3300005844 Bacteria 1637
114 Ga0081455_10058678 3300005937 Bacteria 3254
115 Ga0075365_10004430 3300006038 Bacteria 7436
116 Ga0075365_10010057 3300006038 Bacteria 5484
117 Ga0075365_10015577 3300006038 Bacteria 4602
118 Ga0075368_10091720 3300006042 Bacteria 1243
119 Ga0075363_100011531 3300006048 Bacteria 4235
120 Ga0075363_100049544 3300006048 Bacteria 2237
121 Ga0075363_100053403 3300006048 Bacteria 2159
122 Ga0075363_100394424 3300006048 Bacteria 813
123 Ga0075364_10007940 3300006051 Bacteria 6320
124 Ga0075364_10102108 3300006051 Bacteria 1909
125 Ga0075364_10228568 3300006051 Bacteria 1263
126 Ga0070715_10001490 3300006163 Bacteria 6825
127 Ga0070715_10003747 3300006163 Bacteria 4897
128 Ga0070715_10309389 3300006163 Bacteria 848
129 Ga0070716_100008009 3300006173 Bacteria 5233
130 Ga0070716_100011707 3300006173 Bacteria 4422
131 Ga0070716_100222427 3300006173 Bacteria 1269
132 Ga0070712_100000926 3300006175 Bacteria 17635
133 Ga0070712_100001012 3300006175 Bacteria 16927
134 Ga0070712_100081525 3300006175 Bacteria 2344
135 Ga0070712_100254966 3300006175 Bacteria 1404
136 Ga0070712_100327280 3300006175 Bacteria 1248
137 Ga0070712_100901803 3300006175 Bacteria 762
138 Ga0075362_10024760 3300006177 Bacteria 2549
139 Ga0075362_10025433 3300006177 Bacteria 2521
140 Ga0075362_10030380 3300006177 Bacteria 2333
141 Ga0075367_10030896 3300006178 Bacteria 3074
142 Ga0075367_10147637 3300006178 Bacteria 1459
143 Ga0075367_10438086 3300006178 Bacteria 828
144 Ga0075369_10003516 3300006186 Bacteria 5702
145 Ga0075369_10014504 3300006186 Bacteria 3148
146 Ga0075369_10015435 3300006186 Bacteria 3066
147 Ga0075369_10016798 3300006186 Bacteria 2959
148 Ga0075369_10038366 3300006186 Bacteria 2043
149 Ga0075369_10039814 3300006186 Bacteria 2008
150 Ga0075369_10041514 3300006186 Bacteria 1970
151 Ga0075366_10095945 3300006195 Bacteria 1778
152 Ga0097621_100190030 3300006237 Bacteria 1778
153 Ga0075370_10000263 3300006353 Bacteria 18891
154 Ga0075370_10005360 3300006353 Bacteria 6364
155 Ga0075370_10018658 3300006353 Bacteria 3764
156 Ga0075370_10111528 3300006353 Bacteria 1589
157 Ga0075370_10217112 3300006353 Bacteria 1130
158 Ga0075370_10453577 3300006353 Bacteria 772
159 Ga0068871_100092608 3300006358 Bacteria 2521
160 Ga0068871_100559494 3300006358 Bacteria 1037
161 Ga0075428_100609833 3300006844 Bacteria 1165
162 Ga0075430_100086605 3300006846 Bacteria 2622
163 Ga0075430_101080702 3300006846 Bacteria 661
164 Ga0075431_100637946 3300006847 Bacteria 1046
165 Ga0075434_101069792 3300006871 Bacteria 820
166 Ga0075434_101375241 3300006871 Bacteria 716
167 Ga0068865_100048975 3300006881 Bacteria 2910
168 Ga0068865_100247403 3300006881 Bacteria 1406
169 Ga0068865_100573130 3300006881 Bacteria 951
170 Ga0068865_100982764 3300006881 Bacteria 738
171 Ga0097620_100000989 3300006931 Bacteria 29085
172 Ga0097620_100435657 3300006931 Bacteria 1407
173 Ga0097620_101028767 3300006931 Bacteria 905
174 Ga0099795_10009051 3300007788 Bacteria 2872
175 Ga0105250_10155410 3300009092 Bacteria 953
176 Ga0105245_10000172 3300009098 Bacteria 61572
177 Ga0105245_10475109 3300009098 Bacteria 1262
178 Ga0105245_11285787 3300009098 Bacteria 780
179 Ga0105247_10000451 3300009101 Bacteria 34877
180 Ga0105247_10093340 3300009101 Bacteria 1913
181 Ga0114129_10070792 3300009147 Bacteria 4863
182 Ga0105243_10001407 3300009148 Bacteria 21285
183 Ga0105243_10559013 3300009148 Bacteria 1095
184 Ga0105243_11287380 3300009148 Bacteria 748
185 Ga0105241_10046677 3300009174 Bacteria 3290
186 Ga0105242_10000281 3300009176 Bacteria 40643
187 Ga0105242_10099051 3300009176 Bacteria 2467
188 Ga0105248_10006396 3300009177 Bacteria 12924
189 Ga0105248_10640229 3300009177 Bacteria 1200
190 Ga0105237_10042728 3300009545 Bacteria 4570
191 Ga0105237_10081002 3300009545 Bacteria 3237
192 Ga0105237_10808399 3300009545 Bacteria 944
193 Ga0105238_10433351 3300009551 Bacteria 1310
194 Ga0105249_10000291 3300009553 Bacteria 51476
195 Ga0105249_10076233 3300009553 Bacteria 3108
196 Ga0105249_10168089 3300009553 Bacteria 2125
197 Ga0105249_10431430 3300009553 Bacteria 1354
198 Ga0105249_11010041 3300009553 Bacteria 901
199 Ga0105239_10046864 3300010375 Bacteria 4736
200 Ga0105239_10050708 3300010375 Bacteria 4551
201 Ga0105239_10183929 3300010375 Bacteria 2338
202 Ga0105239_10302201 3300010375 Bacteria 1802
203 Ga0105246_10033858 3300011119 Bacteria 3398
204 Ga0105246_11061415 3300011119 Bacteria 737
205 Ga0157369_10762101 3300013105 Bacteria 995
206 Ga0157369_10797155 3300013105 Bacteria 971
207 Ga0157369_11129499 3300013105 Bacteria 801
208 Ga0157374_10089298 3300013296 Bacteria 2936
209 Ga0157378_10000282 3300013297 Bacteria 49400
210 Ga0157378_10127478 3300013297 Bacteria 2352
211 Ga0157378_10357689 3300013297 Bacteria 1428
212 Ga0163162_10010137 3300013306 Bacteria 9155
213 Ga0163162_10054734 3300013306 Bacteria 4015
214 Ga0163162_10300868 3300013306 Bacteria 1736
215 Ga0163162_10326875 3300013306 Bacteria 1666
216 Ga0163162_10730131 3300013306 Bacteria 1111
217 Ga0157372_10068411 3300013307 Bacteria 3992
218 Ga0157372_10074132 3300013307 Bacteria 3837
219 Ga0157372_10500594 3300013307 Bacteria 1417
220 Ga0157372_10627332 3300013307 Bacteria 1252
221 Ga0157375_10000443 3300013308 Bacteria 37561
222 Ga0157375_10055332 3300013308 Bacteria 3912
223 Ga0157375_10136204 3300013308 Bacteria 2580
224 Ga0157375_10164122 3300013308 Bacteria 2365
225 Ga0163163_10008452 3300014325 Bacteria 9148
226 Ga0163163_10237708 3300014325 Bacteria 1871
227 Ga0157380_10021236 3300014326 Bacteria 4867
228 Ga0157380_10096800 3300014326 Bacteria 2448
229 Ga0157377_10026491 3300014745 Bacteria 3103
230 Ga0157377_10073144 3300014745 Bacteria 1985
231 Ga0157377_10087134 3300014745 Bacteria 1837
232 Ga0157379_10098828 3300014968 Bacteria 2620
233 Ga0157379_10193174 3300014968 Bacteria 1840
234 Ga0157379_10615568 3300014968 Bacteria 1014
235 Ga0157376_10315604 3300014969 Bacteria 1484
236 Ga0157376_10887300 3300014969 Bacteria 909
237 Ga0163161_10007056 3300017792 Bacteria 7774
238 Ga0163161_10092484 3300017792 Bacteria 2239
239 Ga0163161_10147796 3300017792 Bacteria 1784
240 Ga0163161_10258379 3300017792 Bacteria 1360
241 Ga0163161_10311805 3300017792 Bacteria 1241
242 Ga0163161_10417908 3300017792 Bacteria 1078
243 Ga0213874_10191333 3300021377 Bacteria 732
244 Ga0213876_10000810 3300021384 Bacteria 21170
245 Ga0213876_10096699 3300021384 Bacteria 1564
246 Ga0213875_10075902 3300021388 Bacteria 1568
247 Ga0209051_1034740 3300025303 Bacteria 1886
248 Ga0207653_10036991 3300025885 Bacteria 1591
249 Ga0207692_10001824 3300025898 Bacteria 8093
250 Ga0207692_10004663 3300025898 Bacteria 5435
251 Ga0207642_10000264 3300025899 Bacteria 15769
252 Ga0207642_10051341 3300025899 Bacteria 1865
253 Ga0207710_10002273 3300025900 Bacteria 8994
254 Ga0207688_10000568 3300025901 Bacteria 18123
255 Ga0207688_10000715 3300025901 Bacteria 16430
256 Ga0207680_10281437 3300025903 Bacteria 1155
257 Ga0207647_10083096 3300025904 Bacteria 1918
258 Ga0207685_10001406 3300025905 Bacteria 5016
259 Ga0207685_10063523 3300025905 Bacteria 1471
260 Ga0207685_10242378 3300025905 Bacteria 868
261 Ga0207645_10024750 3300025907 Bacteria 3888
262 Ga0207645_10036143 3300025907 Bacteria 3172
263 Ga0207671_10131252 3300025914 Bacteria 1923
264 Ga0207671_10149171 3300025914 Bacteria 1806
265 Ga0207693_10000049 3300025915 Bacteria 100347
266 Ga0207693_10000258 3300025915 Bacteria 48916
267 Ga0207693_10029610 3300025915 Bacteria 4323
268 Ga0207693_10259615 3300025915 Bacteria 1362
269 Ga0207663_10000314 3300025916 Bacteria 21124
270 Ga0207663_10358813 3300025916 Bacteria 1105
271 Ga0207660_10269445 3300025917 Bacteria 1349
272 Ga0207662_10068229 3300025918 Bacteria 2147
273 Ga0207649_10406073 3300025920 Bacteria 1020
274 Ga0207652_10133850 3300025921 Bacteria 2212
275 Ga0207694_10141618 3300025924 Bacteria 1934
276 Ga0207659_10165039 3300025926 Bacteria 1742
277 Ga0207659_10635554 3300025926 Bacteria 911
278 Ga0207687_10000153 3300025927 Bacteria 46342
279 Ga0207687_10044707 3300025927 Bacteria 3058
280 Ga0207687_10771916 3300025927 Bacteria 819
281 Ga0207644_10008475 3300025931 Bacteria 6730
282 Ga0207644_10281205 3300025931 Bacteria 1336
283 Ga0207644_10428518 3300025931 Bacteria 1084
284 Ga0207690_10179163 3300025932 Bacteria 1594
285 Ga0207706_10001388 3300025933 Bacteria 24173
286 Ga0207706_10010629 3300025933 Bacteria 8407
287 Ga0207706_10168543 3300025933 Bacteria 1925
288 Ga0207686_10000624 3300025934 Bacteria 22005
289 Ga0207709_10036951 3300025935 Bacteria 2899
290 Ga0207709_10645553 3300025935 Bacteria 842
291 Ga0207670_10008378 3300025936 Bacteria 5832
292 Ga0207669_10002322 3300025937 Bacteria 8095
293 Ga0207704_10000115 3300025938 Bacteria 44598
294 Ga0207704_10122278 3300025938 Bacteria 1784
295 Ga0207704_10179354 3300025938 Bacteria 1529
296 Ga0207704_10622250 3300025938 Bacteria 886
297 Ga0207665_10001069 3300025939 Bacteria 18406
298 Ga0207665_10001399 3300025939 Bacteria 16225
299 Ga0207665_10183048 3300025939 Bacteria 1518
300 Ga0207691_10013150 3300025940 Bacteria 7925
301 Ga0207711_10300060 3300025941 Bacteria 1482
302 Ga0207689_10005601 3300025942 Bacteria 11190
303 Ga0207689_10026785 3300025942 Bacteria 4828
304 Ga0207667_10139001 3300025949 Bacteria 2501
305 Ga0207667_10439533 3300025949 Bacteria 1326
306 Ga0207651_10253371 3300025960 Bacteria 1441
307 Ga0207651_10681814 3300025960 Bacteria 904
308 Ga0207712_10010904 3300025961 Bacteria 5785
309 Ga0207712_10046937 3300025961 Bacteria 2997
310 Ga0207712_10331096 3300025961 Bacteria 1260
311 Ga0207668_10002895 3300025972 Bacteria 10069
312 Ga0207668_10003252 3300025972 Bacteria 9525
313 Ga0207668_10034998 3300025972 Bacteria 3340
314 Ga0207640_10057695 3300025981 Bacteria 2555
315 Ga0207640_10122402 3300025981 Bacteria 1866
316 Ga0207658_10014201 3300025986 Bacteria 5454
317 Ga0207658_10048233 3300025986 Bacteria 3121
318 Ga0207658_10273259 3300025986 Bacteria 1445
319 Ga0207658_10706422 3300025986 Bacteria 911
320 Ga0207677_10001749 3300026023 Bacteria 11509
321 Ga0207677_10070062 3300026023 Bacteria 2469
322 Ga0207677_10116845 3300026023 Bacteria 1998
323 Ga0207703_10043362 3300026035 Bacteria 3611
324 Ga0207703_10287525 3300026035 Bacteria 1495
325 Ga0207639_10005604 3300026041 Bacteria 8494
326 Ga0207678_10018058 3300026067 Bacteria 6195
327 Ga0207678_10070376 3300026067 Bacteria 3000
328 Ga0207708_10004670 3300026075 Bacteria 10076
329 Ga0207708_10009356 3300026075 Bacteria 7254
330 Ga0207708_10757155 3300026075 Bacteria 834
331 Ga0207708_10790550 3300026075 Bacteria 816
332 Ga0207641_10006779 3300026088 Bacteria 9598
333 Ga0207641_10088274 3300026088 Bacteria 2707
334 Ga0207641_10381285 3300026088 Bacteria 1350
335 Ga0207648_10001288 3300026089 Bacteria 27969
336 Ga0207648_10017518 3300026089 Bacteria 6513
337 Ga0207675_100000220 3300026118 Bacteria 53425
338 Ga0207675_100058081 3300026118 Bacteria 3610
339 Ga0207675_100426257 3300026118 Bacteria 1311
340 Ga0207675_100601785 3300026118 Bacteria 1102
341 Ga0207683_10000184 3300026121 Bacteria 53332
342 Ga0207683_10064539 3300026121 Bacteria 3227
343 Ga0207698_10357720 3300026142 Bacteria 1381
344 Ga0207428_10077062 3300027907 Bacteria 2610
345 Ga0268266_10001619 3300028379 Bacteria 26252
346 Ga0268266_10016255 3300028379 Bacteria 6361
347 Ga0268266_10017679 3300028379 Bacteria 6080
348 Ga0268265_10006939 3300028380 Bacteria 7661
349 Ga0268265_10389770 3300028380 Bacteria 1284
350 Ga0268265_10837602 3300028380 Bacteria 899
351 Ga0268264_10002445 3300028381 Bacteria 16318
352 Ga0268264_10071900 3300028381 Bacteria 2932
353 Ga0307405_10236512 3300031731 Bacteria 1350
354 Ga0307413_10857806 3300031824 Bacteria 768
355 Ga0307409_100215069 3300031995 Bacteria 1731
356 Ga0373936_0349549 3300035113 Bacteria 673
357 Ga0373941_0164678 3300035115 Bacteria 822
358 Ga0373960_0024507 3300035121 Bacteria 1633
359 Ga0373931_0018295 3300035691 Bacteria 3483
360 Ga0373931_0033705 3300035691 Bacteria 2655
361 Ga0436364_1225776 3300037853 Bacteria 23812
362 Ga0436364_1322880 3300037853 Bacteria 19002
363 Ga0436365_1479739 3300039437 Bacteria 73434
364 Ga0436361_1028525 3300039447 Bacteria 3116
365 Ga0436361_1075053 3300039447 Bacteria 918
366 Ga0436363_0380049 3300039450 Bacteria 4037
367 Ga0436363_1378408 3300039450 Bacteria 2677
368 Ga0436363_1626580 3300039450 Bacteria 1873
369 Ga0436362_1274636 3300039453 Bacteria 3294
370 Ga0439461_0011974 3300041410 Bacteria 1617
371 Ga0439466_0008281 3300041411 Bacteria 3919
372 Ga0439465_0004244 3300041413 Bacteria 4662
373 Ga0439465_0055020 3300041413 Bacteria 1309
374 Ga0439431_0013915 3300041997 Bacteria 1860
375 Ga0439445_0005158 3300042004 Bacteria 2971
376 Ga0439434_0000352 3300042435 Bacteria 13174
377 Ga0439459_0014099 3300042438 Bacteria 1448
378 Ga0466972_0028346 3300044658 Bacteria 2763
379 Ga0466965_0003611 3300044683 Bacteria 6813
380 Ga0466963_0013104 3300044694 Bacteria 5086
381 Ga0466963_0247440 3300044694 Bacteria 1251
382 Ga0466964_0340212 3300044706 Bacteria 768
383 Ga0466968_0208126 3300044735 Bacteria 918
384 Ga0466970_0558240 3300044765 Bacteria 662
385 Ga0466957_0014873 3300044842 Bacteria 4537
386 Ga0466960_0000108 3300044901 Bacteria 27686
387 Ga0466960_0004948 3300044901 Bacteria 5245
388 Ga0466960_0190433 3300044901 Bacteria 1116
389 Ga0466959_0662755 3300045049 Bacteria 700
390 Ga0466958_0051312 3300045836 Bacteria 2497
391 Ga0466958_0199484 3300045836 Bacteria 1273
392 Ga0466967_0001102 3300045976 Bacteria 14967
393 Ga0495603_0301565 3300046455 Bacteria 920
394 Ga0495629_0125342 3300046459 Bacteria 1789
395 Ga0495638_0003183 3300046460 Bacteria 12977
396 Ga0495638_0004575 3300046460 Bacteria 10469
397 Ga0495582_0127018 3300046473 Bacteria 1439
398 Ga0495583_0069222 3300046506 Bacteria 1555
399 Ga0495606_0019660 3300046507 Bacteria 5013
400 Ga0495648_0004844 3300046524 Bacteria 11361
401 Ga0495665_0070632 3300046531 Bacteria 1840
402 Ga0495640_0068250 3300046533 Bacteria 2393
403 Ga0495640_0157476 3300046533 Bacteria 1457
404 Ga0495668_0057203 3300046616 Bacteria 2152
405 Ga0495611_0012956 3300046648 Bacteria 3546
406 Ga0495635_0125155 3300046663 Bacteria 1753
407 Ga0495658_0005255 3300046683 Bacteria 6375
408 Ga0495658_0094643 3300046683 Bacteria 1774
409 Ga0495613_0424038 3300046689 Bacteria 905
410 Ga0495649_0072220 3300046694 Bacteria 1850
411 Ga0495649_0258000 3300046694 Bacteria 894
412 Ga0495581_0225177 3300047315 Bacteria 1097
413 Ga0495604_0325300 3300047317 Bacteria 1027
414 Ga0495604_0329819 3300047317 Bacteria 1018
415 Ga0495674_0033100 3300047319 Bacteria 4685
416 Ga0495672_0003329 3300047320 Bacteria 13859
417 Ga0495672_0387224 3300047320 Bacteria 642
418 Ga0495676_0342226 3300047321 Bacteria 1001
419 Ga0495673_0011669 3300047469 Bacteria 4711
420 Ga0495686_0010820 3300047472 Bacteria 6466
421 Ga0495686_0127634 3300047472 Bacteria 1511
422 Ga0495593_0004923 3300047673 Bacteria 7920
423 Ga0496100_0001899 3300048903 Bacteria 10475
424 Ga0496100_0008312 3300048903 Bacteria 5786
425 Ga0496100_0016842 3300048903 Bacteria 4299
426 Ga0496100_0109124 3300048903 Bacteria 1920
427 Ga0496100_0157155 3300048903 Bacteria 1627
428 Ga0496101_0000114 3300048904 Bacteria 79796
429 Ga0496101_0001438 3300048904 Bacteria 14217
430 Ga0496101_0005928 3300048904 Bacteria 7825
431 Ga0496101_0017837 3300048904 Bacteria 4818
432 Ga0496101_0072643 3300048904 Bacteria 2526
433 Ga0496101_0401368 3300048904 Bacteria 1079
434 Ga0496102_0000014 3300048905 Bacteria 310241
435 Ga0496102_0002421 3300048905 Bacteria 15920
436 Ga0496102_0032958 3300048905 Bacteria 4656
437 Ga0496102_0033020 3300048905 Bacteria 4650
438 Ga0496102_0076218 3300048905 Bacteria 3084
439 Ga0496102_0106708 3300048905 Bacteria 2607
440 Ga0496102_0674701 3300048905 Bacteria 957
441 Ga0496102_0885755 3300048905 Bacteria 814
442 Ga0496102_1020026 3300048905 Bacteria 748
443 Ga0496103_0000004 3300048906 Bacteria 510080
444 Ga0496103_0000970 3300048906 Bacteria 20325
445 Ga0496103_0544279 3300048906 Bacteria 741
446 Ga0496104_0000285 3300048907 Bacteria 44731
447 Ga0496104_0013226 3300048907 Bacteria 7440
448 Ga0496104_0294721 3300048907 Bacteria 1535
449 Ga0496105_0000166 3300048908 Bacteria 43904
450 Ga0496105_0282971 3300048908 Bacteria 1337
451 Ga0496106_0006130 3300048909 Bacteria 8892
452 Ga0496106_0494157 3300048909 Bacteria 983
453 Ga0496107_0000152 3300048910 Bacteria 35028
454 Ga0496107_0000364 3300048910 Bacteria 24565
455 Ga0496107_0049723 3300048910 Bacteria 3022
456 Ga0496107_0070292 3300048910 Bacteria 2541
457 Ga0496108_0000520 3300048911 Bacteria 30186
458 Ga0496108_0225670 3300048911 Bacteria 1628
459 Ga0496109_0000679 3300048912 Bacteria 28265
460 Ga0496109_0128924 3300048912 Bacteria 2360
461 Ga0496110_0096510 3300048913 Bacteria 2649
462 Ga0496110_0106596 3300048913 Bacteria 2515
463 Ga0496110_0527282 3300048913 Bacteria 1074
464 Ga0496111_0089307 3300048914 Bacteria 2257
465 Ga0496111_0236983 3300048914 Bacteria 1355
466 Ga0496112_0006797 3300048915 Bacteria 10082
467 Ga0496112_0033686 3300048915 Bacteria 4980
468 Ga0496112_0507915 3300048915 Bacteria 1140
469 Ga0496113_0022545 3300048916 Bacteria 4456
470 Ga0496113_0748771 3300048916 Bacteria 778
471 Ga0496114_0000166 3300048917 Bacteria 47004
472 Ga0496114_0002262 3300048917 Bacteria 14660
473 Ga0496114_0059720 3300048917 Bacteria 3186
474 Ga0496115_0000620 3300048918 Bacteria 26937
475 Ga0496115_0003022 3300048918 Bacteria 12072
476 Ga0496115_0189052 3300048918 Bacteria 1701
477 Ga0496116_0000428 3300048919 Bacteria 59070
478 Ga0496117_0000003 3300048920 Bacteria 1881097
479 Ga0496118_0000001 3300048921 Bacteria 1881100
480 Ga0496118_0000292 3300048921 Bacteria 87325
481 Ga0496119_0001080 3300048922 Bacteria 34426
482 Ga0496120_0001263 3300048923 Bacteria 31791
483 Ga0496121_0000032 3300048924 Bacteria 378997
484 Ga0496121_0193534 3300048924 Bacteria 1456
485 Ga0496125_0292682 3300048928 Bacteria 1002
486 Ga0496126_0000067 3300048929 Bacteria 249091
487 Ga0496126_0006797 3300048929 Bacteria 12687
488 Ga0496126_0035022 3300048929 Bacteria 4708
489 Ga0496126_0160845 3300048929 Bacteria 1919
490 Ga0501033_0092399 3300049570 Bacteria 2213
491 Ga0501037_0026110 3300049573 Bacteria 4317
492 Ga0501043_0043052 3300049579 Bacteria 3549
493 Ga0501046_0001804 3300049580 Bacteria 20417
494 Ga0501047_0008475 3300049581 Bacteria 9701
495 Ga0501047_0008635 3300049581 Bacteria 9623
496 Ga0501048_0061809 3300049582 Bacteria 2651
497 Ga0501069_0141156 3300049585 Bacteria 1382
498 Ga0501070_0007211 3300049586 Bacteria 9435
499 Ga0501080_0264003 3300049742 Bacteria 1568
500 Ga0501035_0001032 3300049822 Bacteria 29280
501 nmdc:mga03683_21040_c1 3300050489 Bacteria 2509
502 nmdc:mga03683_23205_c1 3300050489 Bacteria 2414
503 nmdc:mga03n38_104366_c1 3300050490 Bacteria 1371
504 nmdc:mga03n38_117083_c1 3300050490 Unclassified 1305
505 nmdc:mga03n38_16995_c1 3300050490 Bacteria 2841
506 nmdc:mga03n38_206213_c1 3300050490 Bacteria 1020
507 nmdc:mga00v17_1250_c1 3300050491 Bacteria 7619
508 nmdc:mga00v17_21456_c1 3300050491 Bacteria 3713
509 nmdc:mga00v17_300288_c1 3300050491 Bacteria 1043
510 nmdc:mga00v17_60645_c1 3300050491 Bacteria 2324
511 nmdc:mga00v17_95998_c1 3300050491 Bacteria 1867
512 nmdc:mga0yw44_16202_c1 3300050492 Bacteria 4021
513 nmdc:mga0yw44_16639_c1 3300050492 Bacteria 3979
514 nmdc:mga0yw44_712_c1 3300050492 Bacteria 12202
515 nmdc:mga0k408_146165_c1 3300050493 Bacteria 1407
516 nmdc:mga06z11_104233_c1 3300050494 Bacteria 1561
517 nmdc:mga06z11_3031_c2 3300050494 Bacteria 5371
518 nmdc:mga06z11_390384_c1 3300050494 Bacteria 837
519 nmdc:mga07m45_131831_c1 3300050496 Bacteria 1446
520 nmdc:mga07m45_157267_c1 3300050496 Bacteria 1319
521 nmdc:mga07m45_2960_c1 3300050496 Bacteria 8075
522 nmdc:mga07m45_48039_c1 3300050496 Bacteria 2400
523 nmdc:mga05p37_576087_c1 3300050507 Bacteria 1276
524 nmdc:mga0qj67_13815_c1 3300050509 Bacteria 6094
525 nmdc:mga0sz30_10780_c2 3300050516 Bacteria 2622
526 nmdc:mga0sz30_159373_c1 3300050516 Bacteria 999
527 nmdc:mga0sz30_18522_c1 3300050516 Bacteria 2788
528 nmdc:mga0sz30_7979_c1 3300050516 Bacteria 3985
529 Ga0495601_0275509 3300053077 Bacteria 1097
530 Ga0500610_0137571 3300053079 Bacteria 1236
531 Ga0500635_0007249 3300053080 Bacteria 3002
532 Ga0500635_0090156 3300053080 Bacteria 1114
533 Ga0500578_0218792 3300053086 Bacteria 1159
534 Ga0500643_015151 3300053087 Bacteria 2652
535 Ga0500643_030536 3300053087 Bacteria 1649
536 Ga0500556_0009915 3300053104 Bacteria 2783
537 Ga0500556_0068906 3300053104 Bacteria 1318
538 Ga0500652_000269 3300053131 Bacteria 19409
539 Ga0500620_015768 3300053155 Bacteria 2144
540 Ga0500620_073312 3300053155 Bacteria 1180
541 Ga0500627_0009630 3300053158 Bacteria 3487
542 Ga0500645_000081 3300053730 Bacteria 76748
543 Ga0500645_008597 3300053730 Bacteria 3474
544 Ga0501084_0794514 3300054114 Bacteria 797
545 Ga0466962_0072558 3300061719 Bacteria 1645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_1028525 Ga0436361_1028525_384_1007 159
2 3300039450 Ga0436363_1626580 Ga0436363_1626580_228_824 160
3 3300021384 Ga0213876_10096699 Ga0213876_100966991 167
4 3300047317 Ga0495604_0325300 Ga0495604_0325300_187_753 167
5 3300039447 Ga0436361_1075053 Ga0436361_1075053_136_687 170
6 3300006175 Ga0070712_100901803 Ga0070712_1009018031 175
7 3300046507 Ga0495606_0019660 Ga0495606_0019660_3204_3809 177
8 3300005455 Ga0070663_100001238 Ga0070663_1000012384 181
9 3300009092 Ga0105250_10155410 Ga0105250_101554101 181
10 3300013307 Ga0157372_10068411 Ga0157372_100684113 181
11 3300017792 Ga0163161_10147796 Ga0163161_101477962 181
12 3300005617 Ga0068859_100435689 Ga0068859_1004356892 182
13 3300006931 Ga0097620_100435657 Ga0097620_1004356572 182
14 3300009098 Ga0105245_10475109 Ga0105245_104751092 182
15 3300025986 Ga0207658_10273259 Ga0207658_102732592 182
16 3300044765 Ga0466970_0558240 Ga0466970_0558240_90_638 182
17 3300047320 Ga0495672_0387224 Ga0495672_0387224_17_565 182
18 3300048905 Ga0496102_1020026 Ga0496102_1020026_19_567 182
19 3300053104 Ga0500556_0068906 Ga0500556_0068906_11_559 182
20 3300005338 Ga0068868_100122577 Ga0068868_1001225771 183
21 3300005356 Ga0070674_100256431 Ga0070674_1002564312 183
22 3300005539 Ga0068853_100397278 Ga0068853_1003972781 183
23 3300005719 Ga0068861_100189157 Ga0068861_1001891573 183
24 3300005843 Ga0068860_100232743 Ga0068860_1002327432 183
25 3300005844 Ga0068862_100176266 Ga0068862_1001762665 183
26 3300006871 Ga0075434_101069792 Ga0075434_1010697921 183
27 3300006881 Ga0068865_100573130 Ga0068865_1005731301 183
28 3300009553 Ga0105249_10168089 Ga0105249_101680892 183
29 3300013105 Ga0157369_11129499 Ga0157369_111294991 183
30 3300013307 Ga0157372_10500594 Ga0157372_105005942 183
31 3300013307 Ga0157372_10627332 Ga0157372_106273321 183
32 3300014745 Ga0157377_10087134 Ga0157377_100871343 183
33 3300017792 Ga0163161_10258379 Ga0163161_102583791 183
34 3300017792 Ga0163161_10311805 Ga0163161_103118052 183
35 3300021388 Ga0213875_10075902 Ga0213875_100759022 183
36 3300025927 Ga0207687_10771916 Ga0207687_107719161 183
37 3300025938 Ga0207704_10179354 Ga0207704_101793542 183
38 3300025961 Ga0207712_10331096 Ga0207712_103310961 183
39 3300026023 Ga0207677_10116845 Ga0207677_101168453 183
40 3300026118 Ga0207675_100058081 Ga0207675_1000580813 183
41 3300037853 Ga0436364_1225776 Ga0436364_1225776_573_1196 183
42 3300039453 Ga0436362_1274636 Ga0436362_1274636_908_1531 183
43 3300044901 Ga0466960_0000108 Ga0466960_0000108_2570_3181 183
44 3300048905 Ga0496102_0674701 Ga0496102_0674701_212_829 183
45 3300053155 Ga0500620_073312 Ga0500620_073312_100_699 183
46 3300005338 Ga0068868_100632717 Ga0068868_1006327172 184
47 3300005563 Ga0068855_100748721 Ga0068855_1007487211 184
48 3300006173 Ga0070716_100008009 Ga0070716_1000080091 184
49 3300025933 Ga0207706_10168543 Ga0207706_101685431 184
50 3300026118 Ga0207675_100426257 Ga0207675_1004262572 184
51 3300046455 Ga0495603_0301565 Ga0495603_0301565_48_665 184
52 3300046459 Ga0495629_0125342 Ga0495629_0125342_113_730 184
53 3300046460 Ga0495638_0003183 Ga0495638_0003183_10388_10987 184
54 3300046473 Ga0495582_0127018 Ga0495582_0127018_221_838 184
55 3300046533 Ga0495640_0068250 Ga0495640_0068250_12_629 184
56 3300046683 Ga0495658_0094643 Ga0495658_0094643_310_927 184
57 3300046689 Ga0495613_0424038 Ga0495613_0424038_219_836 184
58 3300046694 Ga0495649_0072220 Ga0495649_0072220_37_657 184
59 3300047315 Ga0495581_0225177 Ga0495581_0225177_97_714 184
60 3300047317 Ga0495604_0329819 Ga0495604_0329819_183_800 184
61 3300047673 Ga0495593_0004923 Ga0495593_0004923_1812_2429 184
62 3300049581 Ga0501047_0008635 Ga0501047_0008635_4270_4869 184
63 3300049585 Ga0501069_0141156 Ga0501069_0141156_603_1202 184
64 3300053077 Ga0495601_0275509 Ga0495601_0275509_37_654 184
65 3300005329 Ga0070683_100159595 Ga0070683_1001595952 185
66 3300005435 Ga0070714_100100150 Ga0070714_1001001504 185
67 3300005439 Ga0070711_100402410 Ga0070711_1004024101 185
68 3300005535 Ga0070684_100069157 Ga0070684_1000691572 185
69 3300005617 Ga0068859_101028943 Ga0068859_1010289431 185
70 3300006163 Ga0070715_10309389 Ga0070715_103093891 185
71 3300006175 Ga0070712_100001012 Ga0070712_10000101215 185
72 3300006881 Ga0068865_100982764 Ga0068865_1009827641 185
73 3300006931 Ga0097620_101028767 Ga0097620_1010287671 185
74 3300009148 Ga0105243_10559013 Ga0105243_105590131 185
75 3300009553 Ga0105249_10431430 Ga0105249_104314302 185
76 3300010375 Ga0105239_10183929 Ga0105239_101839292 185
77 3300013297 Ga0157378_10357689 Ga0157378_103576891 185
78 3300013306 Ga0163162_10730131 Ga0163162_107301312 185
79 3300013308 Ga0157375_10136204 Ga0157375_101362042 185
80 3300014968 Ga0157379_10615568 Ga0157379_106155681 185
81 3300025905 Ga0207685_10242378 Ga0207685_102423781 185
82 3300025915 Ga0207693_10029610 Ga0207693_100296103 185
83 3300025916 Ga0207663_10358813 Ga0207663_103588132 185
84 3300025935 Ga0207709_10645553 Ga0207709_106455531 185
85 3300044683 Ga0466965_0003611 Ga0466965_0003611_1502_2113 185
86 3300044694 Ga0466963_0013104 Ga0466963_0013104_3802_4404 185
87 3300044694 Ga0466963_0247440 Ga0466963_0247440_420_1022 185
88 3300044706 Ga0466964_0340212 Ga0466964_0340212_99_701 185
89 3300044842 Ga0466957_0014873 Ga0466957_0014873_128_730 185
90 3300044901 Ga0466960_0004948 Ga0466960_0004948_1501_2103 185
91 3300045049 Ga0466959_0662755 Ga0466959_0662755_56_658 185
92 3300045836 Ga0466958_0051312 Ga0466958_0051312_34_636 185
93 3300045976 Ga0466967_0001102 Ga0466967_0001102_11527_12129 185
94 3300048905 Ga0496102_0106708 Ga0496102_0106708_268_867 185
95 3300048906 Ga0496103_0544279 Ga0496103_0544279_85_684 185
96 3300048917 Ga0496114_0059720 Ga0496114_0059720_556_1155 185
97 3300048918 Ga0496115_0189052 Ga0496115_0189052_11_610 185
98 3300048921 Ga0496118_0000292 Ga0496118_0000292_38703_39305 185
99 3300048929 Ga0496126_0006797 Ga0496126_0006797_117_716 185
100 3300049570 Ga0501033_0092399 Ga0501033_0092399_1415_2017 185
101 3300049573 Ga0501037_0026110 Ga0501037_0026110_1218_1820 185
102 3300049579 Ga0501043_0043052 Ga0501043_0043052_1264_1866 185
103 3300049580 Ga0501046_0001804 Ga0501046_0001804_5277_5879 185
104 3300049581 Ga0501047_0008475 Ga0501047_0008475_7363_7965 185
105 3300049582 Ga0501048_0061809 Ga0501048_0061809_1080_1682 185
106 3300049586 Ga0501070_0007211 Ga0501070_0007211_3714_4316 185
107 3300049742 Ga0501080_0264003 Ga0501080_0264003_875_1477 185
108 3300049822 Ga0501035_0001032 Ga0501035_0001032_7525_8127 185
109 3300053080 Ga0500635_0007249 Ga0500635_0007249_1669_2286 185
110 3300053086 Ga0500578_0218792 Ga0500578_0218792_477_1076 185
111 3300053131 Ga0500652_000269 Ga0500652_000269_8737_9354 185
112 3300053155 Ga0500620_015768 Ga0500620_015768_1347_1946 185
113 3300054114 Ga0501084_0794514 Ga0501084_0794514_101_703 185
114 3300061719 Ga0466962_0072558 Ga0466962_0072558_624_1226 185
115 3300005615 Ga0070702_100150341 Ga0070702_1001503412 187
116 3300006175 Ga0070712_100327280 Ga0070712_1003272802 187
117 3300013306 Ga0163162_10054734 Ga0163162_100547342 187
118 3300025938 Ga0207704_10122278 Ga0207704_101222783 187
119 3300025981 Ga0207640_10122402 Ga0207640_101224023 187
120 3300039450 Ga0436363_1378408 Ga0436363_1378408_1016_1618 187
121 3300048905 Ga0496102_0885755 Ga0496102_0885755_84_683 187
122 3300006175 Ga0070712_100254966 Ga0070712_1002549662 190
123 3300025915 Ga0207693_10259615 Ga0207693_102596153 190
124 3300021377 Ga0213874_10191333 Ga0213874_101913331 193
125 3300039450 Ga0436363_0380049 Ga0436363_0380049_1080_1679 193
126 3300047321 Ga0495676_0342226 Ga0495676_0342226_118_798 194
127 3300006042 Ga0075368_10091720 Ga0075368_100917202 195
128 3300047472 Ga0495686_0127634 Ga0495686_0127634_624_1238 195
129 iso_pu_bacteria 2643221715 2644634917 195
130 iso_pu_bacteria 2738541274 2738702401 195
131 iso_pu_bacteria 2738543028 2739331657 195
132 iso_pu_bacteria 2902792274 2902798321 195
133 iso_pu_bacteria 2902810491 2902817029 195
134 3300002070 JGI24750J21931_1021732 JGI24750J21931_10217322 198
135 3300002074 JGI24748J21848_1020360 JGI24748J21848_10203601 198
136 3300002077 JGI24744J21845_10000095 JGI24744J21845_100000957 198
137 3300002244 JGI24742J22300_10000302 JGI24742J22300_100003027 198
138 3300005328 Ga0070676_10028028 Ga0070676_100280283 198
139 3300005330 Ga0070690_100057901 Ga0070690_1000579012 198
140 3300005335 Ga0070666_10177335 Ga0070666_101773352 198
141 3300005335 Ga0070666_10266353 Ga0070666_102663532 198
142 3300005336 Ga0070680_100108527 Ga0070680_1001085272 198
143 3300005337 Ga0070682_100022980 Ga0070682_1000229802 198
144 3300005338 Ga0068868_100002071 Ga0068868_10000207112 198
145 3300005339 Ga0070660_100488104 Ga0070660_1004881041 198
146 3300005340 Ga0070689_100006880 Ga0070689_1000068803 198
147 3300005341 Ga0070691_10005589 Ga0070691_100055894 198
148 3300005347 Ga0070668_100000790 Ga0070668_10000079015 198
149 3300005353 Ga0070669_100011042 Ga0070669_1000110423 198
150 3300005354 Ga0070675_100038980 Ga0070675_1000389803 198
151 3300005354 Ga0070675_100170456 Ga0070675_1001704562 198
152 3300005355 Ga0070671_100317534 Ga0070671_1003175341 198
153 3300005356 Ga0070674_100017482 Ga0070674_1000174822 198
154 3300005365 Ga0070688_100005102 Ga0070688_1000051024 198
155 3300005367 Ga0070667_100002715 Ga0070667_1000027158 198
156 3300005406 Ga0070703_10027071 Ga0070703_100270712 198
157 3300005434 Ga0070709_10006332 Ga0070709_100063323 198
158 3300005437 Ga0070710_10001756 Ga0070710_1000175610 198
159 3300005438 Ga0070701_10000291 Ga0070701_100002914 198
160 3300005439 Ga0070711_100000327 Ga0070711_10000032713 198
161 3300005440 Ga0070705_100004944 Ga0070705_1000049444 198
162 3300005441 Ga0070700_100007330 Ga0070700_1000073306 198
163 3300005444 Ga0070694_100024768 Ga0070694_1000247682 198
164 3300005444 Ga0070694_100108405 Ga0070694_1001084051 198
165 3300005456 Ga0070678_100000105 Ga0070678_10000010529 198
166 3300005456 Ga0070678_100022456 Ga0070678_1000224564 198
167 3300005457 Ga0070662_100008059 Ga0070662_1000080594 198
168 3300005459 Ga0068867_100000723 Ga0068867_1000007238 198
169 3300005459 Ga0068867_100800821 Ga0068867_1008008212 198
170 3300005466 Ga0070685_10046616 Ga0070685_100466162 198
171 3300005539 Ga0068853_100002069 Ga0068853_1000020699 198
172 3300005539 Ga0068853_100114357 Ga0068853_1001143572 198
173 3300005545 Ga0070695_100015211 Ga0070695_1000152115 198
174 3300005546 Ga0070696_100001184 Ga0070696_10000118418 198
175 3300005546 Ga0070696_100384505 Ga0070696_1003845051 198
176 3300005548 Ga0070665_100022017 Ga0070665_1000220173 198
177 3300005549 Ga0070704_100000016 Ga0070704_10000001633 198
178 3300005563 Ga0068855_100676356 Ga0068855_1006763562 198
179 3300005578 Ga0068854_100592366 Ga0068854_1005923661 198
180 3300005615 Ga0070702_100036646 Ga0070702_1000366462 198
181 3300005616 Ga0068852_100050589 Ga0068852_1000505893 198
182 3300005617 Ga0068859_100000989 Ga0068859_10000098921 198
183 3300005718 Ga0068866_10000152 Ga0068866_1000015212 198
184 3300005719 Ga0068861_100000157 Ga0068861_10000015724 198
185 3300005719 Ga0068861_100059737 Ga0068861_1000597372 198
186 3300005840 Ga0068870_10230742 Ga0068870_102307422 198
187 3300005842 Ga0068858_100002244 Ga0068858_10000224415 198
188 3300005843 Ga0068860_100008060 Ga0068860_1000080602 198
189 3300005844 Ga0068862_100031053 Ga0068862_1000310534 198
190 3300006048 Ga0075363_100053403 Ga0075363_1000534034 198
191 3300006163 Ga0070715_10001490 Ga0070715_100014905 198
192 3300006175 Ga0070712_100000926 Ga0070712_1000009265 198
193 3300006178 Ga0075367_10438086 Ga0075367_104380862 198
194 3300006186 Ga0075369_10041514 Ga0075369_100415142 198
195 3300006237 Ga0097621_100190030 Ga0097621_1001900302 198
196 3300006353 Ga0075370_10018658 Ga0075370_100186585 198
197 3300006358 Ga0068871_100092608 Ga0068871_1000926082 198
198 3300006931 Ga0097620_100000989 Ga0097620_10000098914 198
199 3300009098 Ga0105245_10000172 Ga0105245_1000017222 198
200 3300009098 Ga0105245_11285787 Ga0105245_112857872 198
201 3300009101 Ga0105247_10000451 Ga0105247_1000045137 198
202 3300009101 Ga0105247_10093340 Ga0105247_100933402 198
203 3300009148 Ga0105243_10001407 Ga0105243_1000140724 198
204 3300009174 Ga0105241_10046677 Ga0105241_100466772 198
205 3300009176 Ga0105242_10000281 Ga0105242_1000028118 198
206 3300009176 Ga0105242_10099051 Ga0105242_100990511 198
207 3300009177 Ga0105248_10006396 Ga0105248_100063964 198
208 3300009545 Ga0105237_10081002 Ga0105237_100810022 198
209 3300009553 Ga0105249_10000291 Ga0105249_1000029117 198
210 3300009553 Ga0105249_11010041 Ga0105249_110100412 198
211 3300010375 Ga0105239_10050708 Ga0105239_100507083 198
212 3300013105 Ga0157369_10762101 Ga0157369_107621011 198
213 3300013105 Ga0157369_10797155 Ga0157369_107971552 198
214 3300013297 Ga0157378_10000282 Ga0157378_1000028223 198
215 3300013306 Ga0163162_10010137 Ga0163162_100101378 198
216 3300013306 Ga0163162_10326875 Ga0163162_103268752 198
217 3300013308 Ga0157375_10000443 Ga0157375_1000044314 198
218 3300013308 Ga0157375_10164122 Ga0157375_101641223 198
219 3300014326 Ga0157380_10021236 Ga0157380_100212363 198
220 3300014745 Ga0157377_10026491 Ga0157377_100264912 198
221 3300014968 Ga0157379_10098828 Ga0157379_100988283 198
222 3300014968 Ga0157379_10193174 Ga0157379_101931742 198
223 3300014969 Ga0157376_10315604 Ga0157376_103156041 198
224 3300017792 Ga0163161_10007056 Ga0163161_100070568 198
225 3300025303 Ga0209051_1034740 Ga0209051_10347402 198
226 3300025885 Ga0207653_10036991 Ga0207653_100369912 198
227 3300025898 Ga0207692_10001824 Ga0207692_100018249 198
228 3300025899 Ga0207642_10000264 Ga0207642_100002642 198
229 3300025899 Ga0207642_10051341 Ga0207642_100513411 198
230 3300025900 Ga0207710_10002273 Ga0207710_1000227310 198
231 3300025901 Ga0207688_10000715 Ga0207688_100007157 198
232 3300025903 Ga0207680_10281437 Ga0207680_102814371 198
233 3300025904 Ga0207647_10083096 Ga0207647_100830963 198
234 3300025905 Ga0207685_10001406 Ga0207685_100014064 198
235 3300025905 Ga0207685_10063523 Ga0207685_100635232 198
236 3300025907 Ga0207645_10024750 Ga0207645_100247502 198
237 3300025915 Ga0207693_10000049 Ga0207693_1000004941 198
238 3300025916 Ga0207663_10000314 Ga0207663_1000031425 198
239 3300025917 Ga0207660_10269445 Ga0207660_102694452 198
240 3300025921 Ga0207652_10133850 Ga0207652_101338502 198
241 3300025926 Ga0207659_10165039 Ga0207659_101650392 198
242 3300025926 Ga0207659_10635554 Ga0207659_106355541 198
243 3300025927 Ga0207687_10000153 Ga0207687_1000015331 198
244 3300025931 Ga0207644_10281205 Ga0207644_102812051 198
245 3300025932 Ga0207690_10179163 Ga0207690_101791632 198
246 3300025933 Ga0207706_10001388 Ga0207706_1000138813 198
247 3300025934 Ga0207686_10000624 Ga0207686_1000062411 198
248 3300025935 Ga0207709_10036951 Ga0207709_100369512 198
249 3300025936 Ga0207670_10008378 Ga0207670_100083785 198
250 3300025937 Ga0207669_10002322 Ga0207669_100023229 198
251 3300025938 Ga0207704_10000115 Ga0207704_1000011514 198
252 3300025938 Ga0207704_10622250 Ga0207704_106222501 198
253 3300025939 Ga0207665_10001069 Ga0207665_100010694 198
254 3300025942 Ga0207689_10026785 Ga0207689_100267854 198
255 3300025949 Ga0207667_10139001 Ga0207667_101390013 198
256 3300025960 Ga0207651_10681814 Ga0207651_106818141 198
257 3300025961 Ga0207712_10010904 Ga0207712_100109045 198
258 3300025972 Ga0207668_10002895 Ga0207668_100028959 198
259 3300025981 Ga0207640_10057695 Ga0207640_100576952 198
260 3300025986 Ga0207658_10048233 Ga0207658_100482332 198
261 3300026023 Ga0207677_10001749 Ga0207677_100017498 198
262 3300026035 Ga0207703_10287525 Ga0207703_102875251 198
263 3300026041 Ga0207639_10005604 Ga0207639_100056049 198
264 3300026067 Ga0207678_10018058 Ga0207678_100180582 198
265 3300026075 Ga0207708_10004670 Ga0207708_100046703 198
266 3300026089 Ga0207648_10001288 Ga0207648_1000128823 198
267 3300026089 Ga0207648_10017518 Ga0207648_100175182 198
268 3300026118 Ga0207675_100000220 Ga0207675_1000002202 198
269 3300026121 Ga0207683_10000184 Ga0207683_1000018419 198
270 3300028379 Ga0268266_10016255 Ga0268266_100162552 198
271 3300028380 Ga0268265_10006939 Ga0268265_100069392 198
272 3300028381 Ga0268264_10002445 Ga0268264_100024452 198
273 3300028381 Ga0268264_10071900 Ga0268264_100719003 198
274 3300031731 Ga0307405_10236512 Ga0307405_102365123 198
275 3300035115 Ga0373941_0164678 Ga0373941_0164678_212_808 198
276 3300035121 Ga0373960_0024507 Ga0373960_0024507_952_1548 198
277 3300035691 Ga0373931_0033705 Ga0373931_0033705_1597_2193 198
278 3300041410 Ga0439461_0011974 Ga0439461_0011974_611_1210 198
279 3300041411 Ga0439466_0008281 Ga0439466_0008281_2564_3163 198
280 3300041413 Ga0439465_0055020 Ga0439465_0055020_210_809 198
281 3300041997 Ga0439431_0013915 Ga0439431_0013915_15_614 198
282 3300042004 Ga0439445_0005158 Ga0439445_0005158_1926_2525 198
283 3300042435 Ga0439434_0000352 Ga0439434_0000352_5204_5803 198
284 3300048903 Ga0496100_0001899 Ga0496100_0001899_439_1038 198
285 3300048903 Ga0496100_0008312 Ga0496100_0008312_4494_5090 198
286 3300048904 Ga0496101_0000114 Ga0496101_0000114_37169_37768 198
287 3300048904 Ga0496101_0005928 Ga0496101_0005928_6406_7002 198
288 3300048905 Ga0496102_0000014 Ga0496102_0000014_251624_252223 198
289 3300048905 Ga0496102_0002421 Ga0496102_0002421_2038_2634 198
290 3300048905 Ga0496102_0076218 Ga0496102_0076218_876_1472 198
291 3300048906 Ga0496103_0000004 Ga0496103_0000004_252127_252726 198
292 3300048906 Ga0496103_0000970 Ga0496103_0000970_5888_6484 198
293 3300048910 Ga0496107_0000364 Ga0496107_0000364_16840_17436 198
294 3300048910 Ga0496107_0049723 Ga0496107_0049723_2109_2708 198
295 3300048910 Ga0496107_0070292 Ga0496107_0070292_419_1015 198
296 3300048911 Ga0496108_0225670 Ga0496108_0225670_188_787 198
297 3300048916 Ga0496113_0748771 Ga0496113_0748771_94_693 198
298 3300048917 Ga0496114_0002262 Ga0496114_0002262_4332_4928 198
299 3300048918 Ga0496115_0003022 Ga0496115_0003022_5405_6001 198
300 3300048919 Ga0496116_0000428 Ga0496116_0000428_461_1060 198
301 3300048920 Ga0496117_0000003 Ga0496117_0000003_1450530_1451129 198
302 3300048921 Ga0496118_0000001 Ga0496118_0000001_1450533_1451132 198
303 3300048922 Ga0496119_0001080 Ga0496119_0001080_497_1096 198
304 3300048923 Ga0496120_0001263 Ga0496120_0001263_30700_31299 198
305 3300048924 Ga0496121_0000032 Ga0496121_0000032_346108_346707 198
306 3300048929 Ga0496126_0000067 Ga0496126_0000067_56543_57142 198
307 3300050494 nmdc:mga06z11_390384_c1 nmdc:mga06z11_390384_c1_109_705 198
308 3300050516 nmdc:mga0sz30_159373_c1 nmdc:mga0sz30_159373_c1_27_653 198
309 3300053087 Ga0500643_015151 Ga0500643_015151_1770_2366 198
310 3300001977 JGI24746J21847_1000750 JGI24746J21847_10007503 199
311 3300001991 JGI24743J22301_10002800 JGI24743J22301_100028003 199
312 3300002459 JGI24751J29686_10003178 JGI24751J29686_100031784 199
313 3300005328 Ga0070676_10082569 Ga0070676_100825692 199
314 3300005330 Ga0070690_100065093 Ga0070690_1000650932 199
315 3300005334 Ga0068869_100080397 Ga0068869_1000803972 199
316 3300005338 Ga0068868_100360609 Ga0068868_1003606092 199
317 3300005340 Ga0070689_100041145 Ga0070689_1000411453 199
318 3300005347 Ga0070668_100014914 Ga0070668_1000149144 199
319 3300005347 Ga0070668_100074361 Ga0070668_1000743612 199
320 3300005347 Ga0070668_100178606 Ga0070668_1001786063 199
321 3300005347 Ga0070668_101037455 Ga0070668_1010374551 199
322 3300005353 Ga0070669_100094260 Ga0070669_1000942602 199
323 3300005355 Ga0070671_100014258 Ga0070671_1000142585 199
324 3300005355 Ga0070671_100453931 Ga0070671_1004539312 199
325 3300005355 Ga0070671_100594476 Ga0070671_1005944762 199
326 3300005364 Ga0070673_100500631 Ga0070673_1005006312 199
327 3300005365 Ga0070688_100053025 Ga0070688_1000530252 199
328 3300005365 Ga0070688_100791558 Ga0070688_1007915581 199
329 3300005367 Ga0070667_100059387 Ga0070667_1000593873 199
330 3300005367 Ga0070667_100652178 Ga0070667_1006521781 199
331 3300005435 Ga0070714_101376199 Ga0070714_1013761991 199
332 3300005437 Ga0070710_10117330 Ga0070710_101173302 199
333 3300005441 Ga0070700_100015672 Ga0070700_1000156723 199
334 3300005457 Ga0070662_100189721 Ga0070662_1001897211 199
335 3300005457 Ga0070662_100466909 Ga0070662_1004669091 199
336 3300005466 Ga0070685_10065295 Ga0070685_100652952 199
337 3300005466 Ga0070685_10124615 Ga0070685_101246152 199
338 3300005530 Ga0070679_100588278 Ga0070679_1005882782 199
339 3300005543 Ga0070672_100242410 Ga0070672_1002424101 199
340 3300005544 Ga0070686_100129838 Ga0070686_1001298383 199
341 3300005547 Ga0070693_100073211 Ga0070693_1000732112 199
342 3300005548 Ga0070665_100006023 Ga0070665_10000602316 199
343 3300005548 Ga0070665_100038057 Ga0070665_1000380573 199
344 3300005563 Ga0068855_100761685 Ga0068855_1007616851 199
345 3300005618 Ga0068864_100540436 Ga0068864_1005404362 199
346 3300005841 Ga0068863_100037288 Ga0068863_1000372882 199
347 3300005841 Ga0068863_100126275 Ga0068863_1001262753 199
348 3300005841 Ga0068863_100529776 Ga0068863_1005297762 199
349 3300005842 Ga0068858_100228499 Ga0068858_1002284992 199
350 3300005844 Ga0068862_100243070 Ga0068862_1002430702 199
351 3300005937 Ga0081455_10058678 Ga0081455_100586782 199
352 3300006038 Ga0075365_10004430 Ga0075365_100044307 199
353 3300006038 Ga0075365_10010057 Ga0075365_100100574 199
354 3300006038 Ga0075365_10015577 Ga0075365_100155772 199
355 3300006048 Ga0075363_100011531 Ga0075363_1000115313 199
356 3300006048 Ga0075363_100049544 Ga0075363_1000495441 199
357 3300006048 Ga0075363_100394424 Ga0075363_1003944241 199
358 3300006051 Ga0075364_10007940 Ga0075364_100079404 199
359 3300006051 Ga0075364_10102108 Ga0075364_101021082 199
360 3300006051 Ga0075364_10228568 Ga0075364_102285682 199
361 3300006163 Ga0070715_10003747 Ga0070715_100037473 199
362 3300006173 Ga0070716_100011707 Ga0070716_1000117074 199
363 3300006173 Ga0070716_100222427 Ga0070716_1002224272 199
364 3300006175 Ga0070712_100081525 Ga0070712_1000815251 199
365 3300006177 Ga0075362_10024760 Ga0075362_100247603 199
366 3300006177 Ga0075362_10025433 Ga0075362_100254332 199
367 3300006177 Ga0075362_10030380 Ga0075362_100303803 199
368 3300006178 Ga0075367_10030896 Ga0075367_100308964 199
369 3300006178 Ga0075367_10147637 Ga0075367_101476373 199
370 3300006186 Ga0075369_10003516 Ga0075369_100035166 199
371 3300006186 Ga0075369_10014504 Ga0075369_100145043 199
372 3300006186 Ga0075369_10015435 Ga0075369_100154353 199
373 3300006186 Ga0075369_10016798 Ga0075369_100167982 199
374 3300006186 Ga0075369_10038366 Ga0075369_100383663 199
375 3300006186 Ga0075369_10039814 Ga0075369_100398143 199
376 3300006195 Ga0075366_10095945 Ga0075366_100959452 199
377 3300006353 Ga0075370_10000263 Ga0075370_100002635 199
378 3300006353 Ga0075370_10005360 Ga0075370_100053603 199
379 3300006353 Ga0075370_10111528 Ga0075370_101115283 199
380 3300006353 Ga0075370_10217112 Ga0075370_102171122 199
381 3300006353 Ga0075370_10453577 Ga0075370_104535772 199
382 3300006358 Ga0068871_100559494 Ga0068871_1005594941 199
383 3300006844 Ga0075428_100609833 Ga0075428_1006098331 199
384 3300006846 Ga0075430_100086605 Ga0075430_1000866053 199
385 3300006846 Ga0075430_101080702 Ga0075430_1010807021 199
386 3300006847 Ga0075431_100637946 Ga0075431_1006379462 199
387 3300006871 Ga0075434_101375241 Ga0075434_1013752412 199
388 3300006881 Ga0068865_100048975 Ga0068865_1000489752 199
389 3300006881 Ga0068865_100247403 Ga0068865_1002474032 199
390 3300007788 Ga0099795_10009051 Ga0099795_100090513 199
391 3300009147 Ga0114129_10070792 Ga0114129_100707925 199
392 3300009148 Ga0105243_11287380 Ga0105243_112873802 199
393 3300009177 Ga0105248_10640229 Ga0105248_106402291 199
394 3300009545 Ga0105237_10042728 Ga0105237_100427284 199
395 3300009545 Ga0105237_10808399 Ga0105237_108083992 199
396 3300009551 Ga0105238_10433351 Ga0105238_104333512 199
397 3300009553 Ga0105249_10076233 Ga0105249_100762332 199
398 3300010375 Ga0105239_10046864 Ga0105239_100468645 199
399 3300010375 Ga0105239_10302201 Ga0105239_103022011 199
400 3300011119 Ga0105246_10033858 Ga0105246_100338581 199
401 3300011119 Ga0105246_11061415 Ga0105246_110614151 199
402 3300013296 Ga0157374_10089298 Ga0157374_100892981 199
403 3300013297 Ga0157378_10127478 Ga0157378_101274781 199
404 3300013306 Ga0163162_10300868 Ga0163162_103008684 199
405 3300013307 Ga0157372_10074132 Ga0157372_100741323 199
406 3300013308 Ga0157375_10055332 Ga0157375_100553323 199
407 3300014325 Ga0163163_10008452 Ga0163163_100084523 199
408 3300014325 Ga0163163_10237708 Ga0163163_102377082 199
409 3300014326 Ga0157380_10096800 Ga0157380_100968002 199
410 3300014745 Ga0157377_10073144 Ga0157377_100731442 199
411 3300014969 Ga0157376_10887300 Ga0157376_108873001 199
412 3300017792 Ga0163161_10092484 Ga0163161_100924843 199
413 3300017792 Ga0163161_10417908 Ga0163161_104179081 199
414 3300021384 Ga0213876_10000810 Ga0213876_100008105 199
415 3300025898 Ga0207692_10004663 Ga0207692_100046632 199
416 3300025901 Ga0207688_10000568 Ga0207688_1000056813 199
417 3300025907 Ga0207645_10036143 Ga0207645_100361433 199
418 3300025914 Ga0207671_10131252 Ga0207671_101312522 199
419 3300025914 Ga0207671_10149171 Ga0207671_101491711 199
420 3300025915 Ga0207693_10000258 Ga0207693_1000025841 199
421 3300025918 Ga0207662_10068229 Ga0207662_100682292 199
422 3300025920 Ga0207649_10406073 Ga0207649_104060731 199
423 3300025924 Ga0207694_10141618 Ga0207694_101416182 199
424 3300025927 Ga0207687_10044707 Ga0207687_100447073 199
425 3300025931 Ga0207644_10008475 Ga0207644_100084754 199
426 3300025931 Ga0207644_10428518 Ga0207644_104285182 199
427 3300025933 Ga0207706_10010629 Ga0207706_100106295 199
428 3300025939 Ga0207665_10001399 Ga0207665_1000139910 199
429 3300025939 Ga0207665_10183048 Ga0207665_101830483 199
430 3300025940 Ga0207691_10013150 Ga0207691_100131503 199
431 3300025941 Ga0207711_10300060 Ga0207711_103000601 199
432 3300025942 Ga0207689_10005601 Ga0207689_1000560113 199
433 3300025949 Ga0207667_10439533 Ga0207667_104395332 199
434 3300025960 Ga0207651_10253371 Ga0207651_102533712 199
435 3300025961 Ga0207712_10046937 Ga0207712_100469373 199
436 3300025972 Ga0207668_10003252 Ga0207668_100032523 199
437 3300025972 Ga0207668_10034998 Ga0207668_100349982 199
438 3300025986 Ga0207658_10014201 Ga0207658_100142014 199
439 3300025986 Ga0207658_10706422 Ga0207658_107064222 199
440 3300026023 Ga0207677_10070062 Ga0207677_100700622 199
441 3300026035 Ga0207703_10043362 Ga0207703_100433622 199
442 3300026067 Ga0207678_10070376 Ga0207678_100703762 199
443 3300026075 Ga0207708_10009356 Ga0207708_100093563 199
444 3300026075 Ga0207708_10757155 Ga0207708_107571552 199
445 3300026075 Ga0207708_10790550 Ga0207708_107905502 199
446 3300026088 Ga0207641_10006779 Ga0207641_100067794 199
447 3300026088 Ga0207641_10088274 Ga0207641_100882743 199
448 3300026088 Ga0207641_10381285 Ga0207641_103812852 199
449 3300026118 Ga0207675_100601785 Ga0207675_1006017852 199
450 3300026121 Ga0207683_10064539 Ga0207683_100645392 199
451 3300026142 Ga0207698_10357720 Ga0207698_103577202 199
452 3300027907 Ga0207428_10077062 Ga0207428_100770624 199
453 3300028379 Ga0268266_10001619 Ga0268266_1000161928 199
454 3300028379 Ga0268266_10017679 Ga0268266_100176794 199
455 3300028380 Ga0268265_10389770 Ga0268265_103897702 199
456 3300028380 Ga0268265_10837602 Ga0268265_108376022 199
457 3300031824 Ga0307413_10857806 Ga0307413_108578062 199
458 3300031995 Ga0307409_100215069 Ga0307409_1002150692 199
459 3300035113 Ga0373936_0349549 Ga0373936_0349549_12_611 199
460 3300035691 Ga0373931_0018295 Ga0373931_0018295_969_1568 199
461 3300037853 Ga0436364_1322880 Ga0436364_1322880_17453_18067 199
462 3300039437 Ga0436365_1479739 Ga0436365_1479739_7696_8310 199
463 3300041413 Ga0439465_0004244 Ga0439465_0004244_622_1227 199
464 3300042438 Ga0439459_0014099 Ga0439459_0014099_157_840 199
465 3300044658 Ga0466972_0028346 Ga0466972_0028346_454_1056 199
466 3300044735 Ga0466968_0208126 Ga0466968_0208126_112_711 199
467 3300044901 Ga0466960_0190433 Ga0466960_0190433_282_884 199
468 3300045836 Ga0466958_0199484 Ga0466958_0199484_433_1035 199
469 3300046460 Ga0495638_0004575 Ga0495638_0004575_8942_9556 199
470 3300046506 Ga0495583_0069222 Ga0495583_0069222_921_1520 199
471 3300046524 Ga0495648_0004844 Ga0495648_0004844_4107_4706 199
472 3300046531 Ga0495665_0070632 Ga0495665_0070632_258_857 199
473 3300046533 Ga0495640_0157476 Ga0495640_0157476_29_628 199
474 3300046616 Ga0495668_0057203 Ga0495668_0057203_171_770 199
475 3300046648 Ga0495611_0012956 Ga0495611_0012956_1286_1885 199
476 3300046663 Ga0495635_0125155 Ga0495635_0125155_198_797 199
477 3300046683 Ga0495658_0005255 Ga0495658_0005255_4422_5021 199
478 3300046694 Ga0495649_0258000 Ga0495649_0258000_275_874 199
479 3300047319 Ga0495674_0033100 Ga0495674_0033100_36_635 199
480 3300047320 Ga0495672_0003329 Ga0495672_0003329_10126_10725 199
481 3300047469 Ga0495673_0011669 Ga0495673_0011669_656_1255 199
482 3300047472 Ga0495686_0010820 Ga0495686_0010820_1927_2559 199
483 3300048903 Ga0496100_0016842 Ga0496100_0016842_3335_3934 199
484 3300048903 Ga0496100_0109124 Ga0496100_0109124_616_1215 199
485 3300048903 Ga0496100_0157155 Ga0496100_0157155_247_846 199
486 3300048904 Ga0496101_0001438 Ga0496101_0001438_8301_8900 199
487 3300048904 Ga0496101_0017837 Ga0496101_0017837_862_1461 199
488 3300048904 Ga0496101_0072643 Ga0496101_0072643_59_661 199
489 3300048904 Ga0496101_0401368 Ga0496101_0401368_283_882 199
490 3300048905 Ga0496102_0032958 Ga0496102_0032958_2599_3198 199
491 3300048905 Ga0496102_0033020 Ga0496102_0033020_1099_1698 199
492 3300048907 Ga0496104_0000285 Ga0496104_0000285_31615_32214 199
493 3300048907 Ga0496104_0013226 Ga0496104_0013226_3051_3650 199
494 3300048907 Ga0496104_0294721 Ga0496104_0294721_207_806 199
495 3300048908 Ga0496105_0000166 Ga0496105_0000166_28499_29098 199
496 3300048908 Ga0496105_0282971 Ga0496105_0282971_409_1008 199
497 3300048909 Ga0496106_0006130 Ga0496106_0006130_4099_4698 199
498 3300048909 Ga0496106_0494157 Ga0496106_0494157_302_901 199
499 3300048910 Ga0496107_0000152 Ga0496107_0000152_33867_34466 199
500 3300048911 Ga0496108_0000520 Ga0496108_0000520_19855_20454 199
501 3300048912 Ga0496109_0000679 Ga0496109_0000679_22473_23072 199
502 3300048912 Ga0496109_0128924 Ga0496109_0128924_1136_1735 199
503 3300048913 Ga0496110_0096510 Ga0496110_0096510_110_709 199
504 3300048913 Ga0496110_0106596 Ga0496110_0106596_231_830 199
505 3300048913 Ga0496110_0527282 Ga0496110_0527282_254_853 199
506 3300048914 Ga0496111_0089307 Ga0496111_0089307_170_769 199
507 3300048914 Ga0496111_0236983 Ga0496111_0236983_673_1272 199
508 3300048915 Ga0496112_0006797 Ga0496112_0006797_8286_8885 199
509 3300048915 Ga0496112_0033686 Ga0496112_0033686_4230_4829 199
510 3300048915 Ga0496112_0507915 Ga0496112_0507915_499_1098 199
511 3300048916 Ga0496113_0022545 Ga0496113_0022545_2718_3317 199
512 3300048917 Ga0496114_0000166 Ga0496114_0000166_36832_37431 199
513 3300048918 Ga0496115_0000620 Ga0496115_0000620_21549_22148 199
514 3300048924 Ga0496121_0193534 Ga0496121_0193534_573_1175 199
515 3300048928 Ga0496125_0292682 Ga0496125_0292682_363_965 199
516 3300048929 Ga0496126_0035022 Ga0496126_0035022_4071_4673 199
517 3300048929 Ga0496126_0160845 Ga0496126_0160845_268_867 199
518 3300050489 nmdc:mga03683_21040_c1 nmdc:mga03683_21040_c1_1788_2390 199
519 3300050489 nmdc:mga03683_23205_c1 nmdc:mga03683_23205_c1_928_1527 199
520 3300050490 nmdc:mga03n38_104366_c1 nmdc:mga03n38_104366_c1_13_615 199
521 3300050490 nmdc:mga03n38_117083_c1 nmdc:mga03n38_117083_c1_14_640 199
522 3300050490 nmdc:mga03n38_16995_c1 nmdc:mga03n38_16995_c1_1263_1862 199
523 3300050490 nmdc:mga03n38_206213_c1 nmdc:mga03n38_206213_c1_113_712 199
524 3300050491 nmdc:mga00v17_1250_c1 nmdc:mga00v17_1250_c1_4714_5316 199
525 3300050491 nmdc:mga00v17_21456_c1 nmdc:mga00v17_21456_c1_2944_3543 199
526 3300050491 nmdc:mga00v17_300288_c1 nmdc:mga00v17_300288_c1_189_794 199
527 3300050491 nmdc:mga00v17_60645_c1 nmdc:mga00v17_60645_c1_251_850 199
528 3300050491 nmdc:mga00v17_95998_c1 nmdc:mga00v17_95998_c1_71_670 199
529 3300050492 nmdc:mga0yw44_16202_c1 nmdc:mga0yw44_16202_c1_2995_3594 199
530 3300050492 nmdc:mga0yw44_16639_c1 nmdc:mga0yw44_16639_c1_343_942 199
531 3300050492 nmdc:mga0yw44_712_c1 nmdc:mga0yw44_712_c1_4876_5487 199
532 3300050493 nmdc:mga0k408_146165_c1 nmdc:mga0k408_146165_c1_656_1255 199
533 3300050494 nmdc:mga06z11_104233_c1 nmdc:mga06z11_104233_c1_799_1398 199
534 3300050494 nmdc:mga06z11_3031_c2 nmdc:mga06z11_3031_c2_1852_2451 199
535 3300050496 nmdc:mga07m45_131831_c1 nmdc:mga07m45_131831_c1_191_790 199
536 3300050496 nmdc:mga07m45_157267_c1 nmdc:mga07m45_157267_c1_168_767 199
537 3300050496 nmdc:mga07m45_2960_c1 nmdc:mga07m45_2960_c1_4112_4738 199
538 3300050496 nmdc:mga07m45_48039_c1 nmdc:mga07m45_48039_c1_1618_2217 199
539 3300050507 nmdc:mga05p37_576087_c1 nmdc:mga05p37_576087_c1_533_1132 199
540 3300050509 nmdc:mga0qj67_13815_c1 nmdc:mga0qj67_13815_c1_3720_4319 199
541 3300050516 nmdc:mga0sz30_10780_c2 nmdc:mga0sz30_10780_c2_1682_2308 199
542 3300050516 nmdc:mga0sz30_18522_c1 nmdc:mga0sz30_18522_c1_294_896 199
543 3300050516 nmdc:mga0sz30_7979_c1 nmdc:mga0sz30_7979_c1_570_1169 199
544 3300053079 Ga0500610_0137571 Ga0500610_0137571_23_622 199
545 3300053080 Ga0500635_0090156 Ga0500635_0090156_141_743 199
546 3300053087 Ga0500643_030536 Ga0500643_030536_249_863 199
547 3300053104 Ga0500556_0009915 Ga0500556_0009915_1331_1930 199
548 3300053158 Ga0500627_0009630 Ga0500627_0009630_2788_3402 199
549 3300053730 Ga0500645_000081 Ga0500645_000081_67709_68311 199
550 3300053730 Ga0500645_008597 Ga0500645_008597_1490_2104 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00258

Flavodoxin_1

Flavodoxin

46

167

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ydg-assembly1.cif.gz_B crystal structure of trp repressor binding protein wrba 0.9669 2 198
1ydg-assembly1.cif.gz_B crystal structure of trp repressor binding protein wrba 0.9432 2 198
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.9346 1 199
1zwl-assembly1.cif.gz_A structure of wrba from pseudomonas aeruginosa in complex with fmn 0.9296 3 197
2a5l-assembly1.cif.gz_A the crystal structure of the trp repressor binding protein wrba from pseudomonas aeruginosa 0.9293 1 199
ID Description Score Start End Superfamily
1yrhD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.966 2 198 3.40.50.360
1yrhD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9322 2 198 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9222 1 199 3.40.50.360
2a5lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9169 1 199 3.40.50.360
2zkiG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.908 2 198 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A653EMT4-F1-model_v4 NAD(P)H dehydrogenase (Quinone) 0.9972 1 198 GO:0003955
GO:0010181
GO:0016020
AF-A0A7K0RM04-F1-model_v4 deleted 0.9918 1 158
AF-X5L2T6-F1-model_v4 deleted 0.9904 1 197
AF-A0A1A6BGB6-F1-model_v4 NAD(P)H:quinone oxidoreductase, type IV 0.9894 1 199 GO:0003955
GO:0010181
GO:0016020
AF-A0A653EMT4-F1-model_v4 NAD(P)H dehydrogenase (Quinone) 0.9873 1 198 GO:0003955
GO:0010181
GO:0016020

Feature Viewer

pLDDT pTM Quality
91.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map