F462442

General Info

Members Datasets Scaffolds Average Seq Length
550 252 1100 238

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10125665|Ga0070658_101256652
Length 273
Sequence MTTASDTPGQASGRTAVPTSRFDVSAAGRSSRLTLVEELLLAWFSQKGRFLPWRRTRDPYEILVSEVMAQQTQVDRVVPRWERWVERWPTVDALAAAPAADVIREWQGLGYNRRALSLHRAAQHVAAHGWPDDLTELPGVGRYTADAVACFAFGRDVLPVDVNVRRVQERTGHAFTPAAAQALMDLGATVCLARIPRCGECPLAADCPSRGQRYEPLRKQGPFEGSFRQRRAATLRLVADAGRPLAELDADAVAALAKDGLVQVAEGVVSLPA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
178 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.45
Rhizosphere 84
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10125665 3300005327 Unclassified 2134
2 JGI25407J50210_10056805 3300003373 Bacteria 986
3 Ga0070683_100014396 3300005329 Bacteria 6918
4 Ga0070683_100245558 3300005329 Bacteria 1703
5 Ga0070680_100024690 3300005336 Bacteria 4804
6 Ga0070680_100057410 3300005336 Bacteria 3182
7 Ga0070680_100460304 3300005336 Bacteria 1087
8 Ga0070682_100063364 3300005337 Bacteria 2344
9 Ga0070682_100100240 3300005337 Bacteria 1911
10 Ga0070660_100012514 3300005339 Bacteria 6061
11 Ga0070660_100014101 3300005339 Bacteria 5754
12 Ga0070660_100116467 3300005339 Bacteria 2131
13 Ga0070660_100491054 3300005339 Bacteria 1021
14 Ga0070661_100049742 3300005344 Bacteria 3069
15 Ga0070692_10046531 3300005345 Bacteria 2243
16 Ga0070692_10119901 3300005345 Bacteria 1466
17 Ga0070671_100179565 3300005355 Bacteria 1792
18 Ga0070671_100200663 3300005355 Bacteria 1691
19 Ga0070674_100015109 3300005356 Bacteria 4813
20 Ga0070673_100127859 3300005364 Bacteria 2128
21 Ga0070709_10001534 3300005434 Bacteria 12464
22 Ga0070709_10479516 3300005434 Bacteria 941
23 Ga0070714_100008495 3300005435 Bacteria 8024
24 Ga0070714_100011939 3300005435 Bacteria 6910
25 Ga0070714_100020548 3300005435 Bacteria 5394
26 Ga0070714_100022948 3300005435 Bacteria 5121
27 Ga0070714_100023296 3300005435 Bacteria 5084
28 Ga0070714_100026356 3300005435 Bacteria 4804
29 Ga0070714_100052274 3300005435 Bacteria 3484
30 Ga0070714_100471279 3300005435 Bacteria 1195
31 Ga0070713_100027322 3300005436 Bacteria 4491
32 Ga0070713_100114648 3300005436 Bacteria 2355
33 Ga0070713_100124751 3300005436 Bacteria 2263
34 Ga0070713_100515426 3300005436 Bacteria 1129
35 Ga0070710_10003659 3300005437 Bacteria 7267
36 Ga0070710_10006720 3300005437 Bacteria 5544
37 Ga0070710_10017903 3300005437 Bacteria 3637
38 Ga0070710_10146375 3300005437 Unclassified 1453
39 Ga0070701_10007517 3300005438 Bacteria 4661
40 Ga0070711_100041490 3300005439 Bacteria 3108
41 Ga0070711_100091665 3300005439 Bacteria 2191
42 Ga0070705_100004551 3300005440 Bacteria 6748
43 Ga0070705_100065095 3300005440 Bacteria 2181
44 Ga0070700_100035066 3300005441 Bacteria 3033
45 Ga0070700_100365861 3300005441 Bacteria 1074
46 Ga0070708_100157724 3300005445 Bacteria 2113
47 Ga0070663_100139153 3300005455 Bacteria 1851
48 Ga0070678_100010209 3300005456 Bacteria 5724
49 Ga0070678_100022697 3300005456 Bacteria 4165
50 Ga0070681_10013318 3300005458 Bacteria 8173
51 Ga0070681_10278791 3300005458 Bacteria 1582
52 Ga0068867_100023898 3300005459 Bacteria 4377
53 Ga0070707_100357129 3300005468 Unclassified 1419
54 Ga0070698_100032894 3300005471 Bacteria 5371
55 Ga0070698_100037621 3300005471 Bacteria 4988
56 Ga0070698_100123499 3300005471 Bacteria 2547
57 Ga0070698_100274718 3300005471 Unclassified 1617
58 Ga0070679_100030028 3300005530 Bacteria 5364
59 Ga0070679_100099544 3300005530 Bacteria 2894
60 Ga0070679_100132408 3300005530 Bacteria 2474
61 Ga0070679_100329896 3300005530 Bacteria 1474
62 Ga0070684_100006774 3300005535 Bacteria 8884
63 Ga0070684_100033240 3300005535 Bacteria 4402
64 Ga0070684_100050693 3300005535 Bacteria 3606
65 Ga0070684_100087760 3300005535 Bacteria 2762
66 Ga0070697_100425153 3300005536 Bacteria 1155
67 Ga0070672_100479749 3300005543 Bacteria 1074
68 Ga0070686_100064456 3300005544 Bacteria 2377
69 Ga0070695_100016176 3300005545 Bacteria 4512
70 Ga0070696_100023148 3300005546 Bacteria 4222
71 Ga0070696_100069875 3300005546 Bacteria 2469
72 Ga0070696_100124659 3300005546 Bacteria 1868
73 Ga0070693_100008201 3300005547 Bacteria 5134
74 Ga0070693_100032725 3300005547 Bacteria 2863
75 Ga0070693_100101830 3300005547 Bacteria 1751
76 Ga0070704_100187559 3300005549 Bacteria 1659
77 Ga0070704_100266553 3300005549 Bacteria 1413
78 Ga0068855_100008359 3300005563 Bacteria 12518
79 Ga0068855_100138294 3300005563 Bacteria 2778
80 Ga0070664_100143937 3300005564 Bacteria 2101
81 Ga0070664_100805066 3300005564 Bacteria 879
82 Ga0068857_100052161 3300005577 Bacteria 3629
83 Ga0068857_100078497 3300005577 Bacteria 2947
84 Ga0068857_100588345 3300005577 Bacteria 1051
85 Ga0068856_100028816 3300005614 Bacteria 5425
86 Ga0068856_100210062 3300005614 Bacteria 1962
87 Ga0068856_100294324 3300005614 Bacteria 1640
88 Ga0070702_100221988 3300005615 Bacteria 1264
89 Ga0068861_100109865 3300005719 Bacteria 2208
90 Ga0068861_100128922 3300005719 Bacteria 2051
91 Ga0068862_100202411 3300005844 Bacteria 1791
92 Ga0068862_100430120 3300005844 Bacteria 1240
93 Ga0081538_10000266 3300005981 Bacteria 59679
94 Ga0081538_10001790 3300005981 Bacteria 21685
95 Ga0081538_10009611 3300005981 Bacteria 8045
96 Ga0081540_1004975 3300005983 Bacteria 9992
97 Ga0081540_1012990 3300005983 Bacteria 5440
98 Ga0070717_10049483 3300006028 Bacteria 3450
99 Ga0070717_10248256 3300006028 Bacteria 1571
100 Ga0075432_10023659 3300006058 Bacteria 2105
101 Ga0070715_10001185 3300006163 Bacteria 7494
102 Ga0070715_10014416 3300006163 Bacteria 2928
103 Ga0070716_100001663 3300006173 Bacteria 10021
104 Ga0070716_100024026 3300006173 Bacteria 3240
105 Ga0070716_100038535 3300006173 Bacteria 2647
106 Ga0070712_100006662 3300006175 Bacteria 7181
107 Ga0070712_100151081 3300006175 Bacteria 1783
108 Ga0070712_100201084 3300006175 Bacteria 1565
109 Ga0068871_100011692 3300006358 Bacteria 6445
110 Ga0075430_100110542 3300006846 Bacteria 2291
111 Ga0075433_10001378 3300006852 Bacteria 17864
112 Ga0075433_10137418 3300006852 Bacteria 2172
113 Ga0075433_10143791 3300006852 Bacteria 2120
114 Ga0075433_10198465 3300006852 Bacteria 1784
115 Ga0075434_100013318 3300006871 Bacteria 7822
116 Ga0075434_100205949 3300006871 Bacteria 1987
117 Ga0075434_100213004 3300006871 Bacteria 1952
118 Ga0075434_100390589 3300006871 Bacteria 1412
119 Ga0075429_100042463 3300006880 Bacteria 3957
120 Ga0068865_100170343 3300006881 Bacteria 1669
121 Ga0075436_100275226 3300006914 Bacteria 1203
122 Ga0075435_100005134 3300007076 Bacteria 9101
123 Ga0075435_100085372 3300007076 Bacteria 2598
124 Ga0075435_100308727 3300007076 Bacteria 1353
125 Ga0075435_100422049 3300007076 Bacteria 1149
126 Ga0105250_10109705 3300009092 Unclassified 1130
127 Ga0105240_10003384 3300009093 Bacteria 24800
128 Ga0105240_10005808 3300009093 Bacteria 18306
129 Ga0105240_10067867 3300009093 Bacteria 4419
130 Ga0105240_10441494 3300009093 Bacteria 1458
131 Ga0111539_10233100 3300009094 Bacteria 2143
132 Ga0111539_10293139 3300009094 Bacteria 1893
133 Ga0111539_11420638 3300009094 Bacteria 805
134 Ga0105245_10048035 3300009098 Bacteria 3817
135 Ga0105247_10187640 3300009101 Bacteria 1383
136 Ga0114129_10016824 3300009147 Bacteria 10410
137 Ga0114129_10173935 3300009147 Bacteria 2933
138 Ga0114129_10302263 3300009147 Bacteria 2132
139 Ga0105243_10095113 3300009148 Bacteria 2461
140 Ga0105242_10374212 3300009176 Bacteria 1322
141 Ga0105242_10977154 3300009176 Bacteria 853
142 Ga0105248_10053047 3300009177 Bacteria 4550
143 Ga0105248_10223303 3300009177 Bacteria 2121
144 Ga0105237_10720677 3300009545 Bacteria 1004
145 Ga0105249_10351490 3300009553 Bacteria 1493
146 Ga0105239_10158790 3300010375 Bacteria 2526
147 Ga0105239_10263448 3300010375 Bacteria 1937
148 Ga0157373_10043363 3300013100 Bacteria 3213
149 Ga0157373_10073468 3300013100 Bacteria 2413
150 Ga0157370_10060565 3300013104 Bacteria 3594
151 Ga0157369_10002407 3300013105 Bacteria 22492
152 Ga0157369_10007691 3300013105 Bacteria 12399
153 Ga0157374_10309523 3300013296 Bacteria 1564
154 Ga0157378_10168091 3300013297 Bacteria 2055
155 Ga0157378_10234037 3300013297 Bacteria 1752
156 Ga0163162_10063880 3300013306 Bacteria 3725
157 Ga0163162_10118299 3300013306 Bacteria 2751
158 Ga0157372_10070566 3300013307 Bacteria 3931
159 Ga0157372_10579275 3300013307 Bacteria 1308
160 Ga0157375_10025778 3300013308 Bacteria 5470
161 Ga0157375_10991868 3300013308 Bacteria 980
162 Ga0163163_10310654 3300014325 Bacteria 1629
163 Ga0182008_10181430 3300014497 Bacteria 1065
164 Ga0206354_10928073 3300020081 Bacteria 1008
165 Ga0206353_10937605 3300020082 Bacteria 4108
166 Ga0206353_11080690 3300020082 Bacteria 4118
167 Ga0213876_10231631 3300021384 Bacteria 982
168 Ga0207653_10008972 3300025885 Bacteria 3120
169 Ga0207692_10088843 3300025898 Bacteria 1671
170 Ga0207692_10140748 3300025898 Bacteria 1372
171 Ga0207685_10008837 3300025905 Bacteria 2894
172 Ga0207685_10022859 3300025905 Bacteria 2120
173 Ga0207699_10002375 3300025906 Bacteria 8890
174 Ga0207699_10102000 3300025906 Bacteria 1823
175 Ga0207705_10179523 3300025909 Bacteria 1597
176 Ga0207684_10276483 3300025910 Bacteria 1448
177 Ga0207684_10482151 3300025910 Bacteria 1064
178 Ga0207707_10009855 3300025912 Bacteria 8282
179 Ga0207707_10046286 3300025912 Bacteria 3789
180 Ga0207707_10189954 3300025912 Bacteria 1792
181 Ga0207695_10018875 3300025913 Bacteria 7957
182 Ga0207693_10001725 3300025915 Bacteria 19220
183 Ga0207693_10002896 3300025915 Bacteria 14848
184 Ga0207693_10009199 3300025915 Bacteria 8065
185 Ga0207693_10029671 3300025915 Bacteria 4318
186 Ga0207663_10006764 3300025916 Bacteria 5900
187 Ga0207663_10025090 3300025916 Bacteria 3441
188 Ga0207663_10033835 3300025916 Bacteria 3049
189 Ga0207660_10364004 3300025917 Bacteria 1160
190 Ga0207660_10487622 3300025917 Unclassified 999
191 Ga0207657_10009059 3300025919 Bacteria 10051
192 Ga0207657_10027771 3300025919 Bacteria 5176
193 Ga0207657_10148937 3300025919 Bacteria 1907
194 Ga0207657_10167266 3300025919 Bacteria 1783
195 Ga0207649_10190052 3300025920 Bacteria 1443
196 Ga0207652_10012698 3300025921 Bacteria 6811
197 Ga0207652_10045444 3300025921 Bacteria 3745
198 Ga0207652_10071100 3300025921 Bacteria 3023
199 Ga0207652_10181313 3300025921 Bacteria 1893
200 Ga0207652_10310061 3300025921 Bacteria 1424
201 Ga0207652_10438204 3300025921 Bacteria 1178
202 Ga0207646_10184740 3300025922 Bacteria 1883
203 Ga0207700_10089527 3300025928 Bacteria 2426
204 Ga0207700_10114538 3300025928 Bacteria 2176
205 Ga0207700_10159219 3300025928 Bacteria 1874
206 Ga0207664_10003998 3300025929 Bacteria 9936
207 Ga0207664_10005140 3300025929 Bacteria 8917
208 Ga0207664_10062516 3300025929 Bacteria 2973
209 Ga0207664_10125153 3300025929 Bacteria 2157
210 Ga0207664_10413210 3300025929 Unclassified 1201
211 Ga0207644_10071516 3300025931 Bacteria 2538
212 Ga0207706_10024236 3300025933 Bacteria 5440
213 Ga0207706_10196092 3300025933 Bacteria 1771
214 Ga0207669_10028106 3300025937 Bacteria 3090
215 Ga0207665_10001916 3300025939 Bacteria 14032
216 Ga0207665_10006964 3300025939 Bacteria 7483
217 Ga0207665_10021043 3300025939 Bacteria 4287
218 Ga0207665_10651168 3300025939 Bacteria 826
219 Ga0207711_10249792 3300025941 Bacteria 1628
220 Ga0207661_10011889 3300025944 Bacteria 6321
221 Ga0207661_10103027 3300025944 Bacteria 2401
222 Ga0207661_10208065 3300025944 Bacteria 1723
223 Ga0207661_10317799 3300025944 Bacteria 1399
224 Ga0207679_10493218 3300025945 Bacteria 1092
225 Ga0207667_10049143 3300025949 Bacteria 4458
226 Ga0207667_10121919 3300025949 Unclassified 2686
227 Ga0207668_10031708 3300025972 Bacteria 3485
228 Ga0207677_10046999 3300026023 Bacteria 2895
229 Ga0207677_10334492 3300026023 Bacteria 1263
230 Ga0207678_10012020 3300026067 Bacteria 7602
231 Ga0207708_10002361 3300026075 Bacteria 13866
232 Ga0207708_10101700 3300026075 Bacteria 2225
233 Ga0207702_10000955 3300026078 Bacteria 29742
234 Ga0207702_10067244 3300026078 Bacteria 3075
235 Ga0207702_10510540 3300026078 Bacteria 1172
236 Ga0207648_10003964 3300026089 Bacteria 15378
237 Ga0207676_10242599 3300026095 Bacteria 1617
238 Ga0207674_10000833 3300026116 Bacteria 40230
239 Ga0207674_10060636 3300026116 Bacteria 3825
240 Ga0207675_100010327 3300026118 Bacteria 8750
241 Ga0207675_100027151 3300026118 Bacteria 5332
242 Ga0207683_10005063 3300026121 Bacteria 11305
243 Ga0207683_10037352 3300026121 Bacteria 4229
244 Ga0207683_10175388 3300026121 Bacteria 1942
245 Ga0209998_10025041 3300027717 Bacteria 1298
246 Ga0207428_10035189 3300027907 Bacteria 4096
247 Ga0207428_10144448 3300027907 Bacteria 1814
248 Ga0268264_10131064 3300028381 Bacteria 2222
249 Ga0265319_1001369 3300028563 Bacteria 14671
250 Ga0265319_1007209 3300028563 Bacteria 5035
251 Ga0265334_10000248 3300028573 Bacteria 30961
252 Ga0265318_10000303 3300028577 Bacteria 39690
253 Ga0265318_10038655 3300028577 Bacteria 1823
254 Ga0265318_10044491 3300028577 Bacteria 1680
255 Ga0265336_10006545 3300028666 Bacteria 4190
256 Ga0265338_10010750 3300028800 Bacteria 10680
257 Ga0265338_10037527 3300028800 Bacteria 4610
258 Ga0265338_10063277 3300028800 Bacteria 3226
259 Ga0265338_10122489 3300028800 Bacteria 2069
260 Ga0265338_10198915 3300028800 Bacteria 1512
261 Ga0265324_10012742 3300029957 Bacteria 3161
262 Ga0265330_10000170 3300031235 Bacteria 51357
263 Ga0265330_10016655 3300031235 Bacteria 3388
264 Ga0265332_10016630 3300031238 Bacteria 3245
265 Ga0265332_10052522 3300031238 Bacteria 1750
266 Ga0265328_10014204 3300031239 Bacteria 3138
267 Ga0265320_10016926 3300031240 Bacteria 4066
268 Ga0265320_10057134 3300031240 Bacteria 1873
269 Ga0265320_10058743 3300031240 Bacteria 1840
270 Ga0265320_10181889 3300031240 Bacteria 942
271 Ga0265325_10000058 3300031241 Bacteria 76250
272 Ga0265325_10116987 3300031241 Bacteria 1289
273 Ga0265329_10012483 3300031242 Bacteria 3051
274 Ga0265340_10000310 3300031247 Bacteria 25679
275 Ga0265339_10001387 3300031249 Bacteria 18056
276 Ga0265339_10014944 3300031249 Bacteria 4667
277 Ga0265339_10042568 3300031249 Bacteria 2514
278 Ga0265331_10008158 3300031250 Bacteria 5977
279 Ga0265331_10049603 3300031250 Bacteria 2016
280 Ga0265327_10004922 3300031251 Bacteria 11520
281 Ga0265327_10051255 3300031251 Bacteria 2155
282 Ga0265316_10000677 3300031344 Bacteria 37948
283 Ga0265316_10154529 3300031344 Bacteria 1717
284 Ga0265316_10323249 3300031344 Bacteria 1120
285 Ga0265316_10408834 3300031344 Bacteria 977
286 Ga0265313_10021915 3300031595 Bacteria 3482
287 Ga0265313_10023645 3300031595 Bacteria 3305
288 Ga0265314_10003853 3300031711 Bacteria 14304
289 Ga0265314_10004488 3300031711 Bacteria 12939
290 Ga0265314_10015227 3300031711 Bacteria 6108
291 Ga0265314_10207047 3300031711 Unclassified 1154
292 Ga0265342_10001041 3300031712 Bacteria 27186
293 Ga0265342_10036981 3300031712 Bacteria 2980
294 Ga0307405_10001889 3300031731 Bacteria 8998
295 Ga0307413_10020185 3300031824 Bacteria 3538
296 Ga0307410_10021044 3300031852 Bacteria 4005
297 Ga0307406_10003096 3300031901 Bacteria 9043
298 Ga0307407_10046308 3300031903 Bacteria 2462
299 Ga0307416_100008422 3300032002 Bacteria 6655
300 Ga0307411_10034724 3300032005 Bacteria 3141
301 Ga0307415_100000129 3300032126 Bacteria 32651
302 Ga0316583_10015897 3300032133 Bacteria 2711
303 Ga0373930_0012528 3300034816 Bacteria 1549
304 Ga0373958_0031705 3300034819 Bacteria 1040
305 Ga0373959_0007014 3300034820 Bacteria 1886
306 Ga0373938_0040837 3300034957 Bacteria 1030
307 Ga0373940_0002538 3300035088 Bacteria 3567
308 Ga0373949_0015664 3300035090 Unclassified 1695
309 Ga0373951_0004196 3300035091 Bacteria 3437
310 Ga0373952_0004154 3300035092 Bacteria 2617
311 Ga0373932_0004230 3300035112 Bacteria 3409
312 Ga0373939_0001751 3300035114 Bacteria 5232
313 Ga0373939_0047286 3300035114 Bacteria 1321
314 Ga0373941_0001581 3300035115 Bacteria 4839
315 Ga0373941_0094977 3300035115 Unclassified 1029
316 Ga0373960_0019974 3300035121 Bacteria 1766
317 Ga0373960_0064915 3300035121 Bacteria 1116
318 Ga0373946_0051698 3300035171 Bacteria 1721
319 Ga0373942_0023982 3300035207 Bacteria 1562
320 Ga0373962_0024838 3300035242 Unclassified 1606
321 Ga0373931_0007552 3300035691 Bacteria 5120
322 Ga0373931_0138414 3300035691 Bacteria 1408
323 Ga0373925_0005863 3300037068 Bacteria 9108
324 Ga0395899_0007826 3300037312 Bacteria 8236
325 Ga0395899_0079509 3300037312 Bacteria 2388
326 Ga0395899_0129933 3300037312 Bacteria 1799
327 Ga0395899_0480171 3300037312 Bacteria 809
328 Ga0395900_0001092 3300037418 Bacteria 34499
329 Ga0395900_0011854 3300037418 Bacteria 8915
330 Ga0395900_0085807 3300037418 Bacteria 3235
331 Ga0395900_0086066 3300037418 Bacteria 3230
332 Ga0395900_0870790 3300037418 Bacteria 825
333 Ga0395898_0006415 3300037466 Bacteria 12560
334 Ga0395898_0009569 3300037466 Bacteria 10179
335 Ga0395898_0060037 3300037466 Bacteria 3697
336 Ga0395898_0148911 3300037466 Bacteria 2240
337 Ga0395898_0236016 3300037466 Bacteria 1744
338 Ga0395898_0723969 3300037466 Bacteria 937
339 Ga0395905_0004948 3300037471 Bacteria 13728
340 Ga0395905_0006575 3300037471 Bacteria 11679
341 Ga0395905_0111133 3300037471 Bacteria 2573
342 Ga0395905_0202505 3300037471 Bacteria 1861
343 Ga0395901_0001665 3300038443 Bacteria 22941
344 Ga0395901_0010678 3300038443 Bacteria 9310
345 Ga0395901_0032292 3300038443 Bacteria 5402
346 Ga0395901_0073229 3300038443 Bacteria 3572
347 Ga0395901_0174386 3300038443 Bacteria 2255
348 Ga0395901_0460477 3300038443 Bacteria 1299
349 Ga0395901_0545651 3300038443 Bacteria 1175
350 Ga0395901_0747870 3300038443 Unclassified 971
351 Ga0436365_0555375 3300039437 Bacteria 3005
352 Ga0436360_0968648 3300039438 Bacteria 3977
353 Ga0436363_1323674 3300039450 Bacteria 2024
354 Ga0439448_0008258 3300042005 Bacteria 3043
355 Ga0439450_048535 3300042008 Bacteria 1003
356 Ga0450907_022618 3300042146 Bacteria 1059
357 Ga0439464_0066048 3300042439 Bacteria 1065
358 Ga0466961_0007720 3300044693 Bacteria 6850
359 Ga0466961_0126500 3300044693 Bacteria 1603
360 Ga0466963_0004816 3300044694 Bacteria 7868
361 Ga0466963_0005244 3300044694 Bacteria 7570
362 Ga0466963_0047713 3300044694 Bacteria 2827
363 Ga0466963_0050336 3300044694 Bacteria 2757
364 Ga0466963_0103662 3300044694 Bacteria 1949
365 Ga0466964_0016419 3300044706 Bacteria 2827
366 Ga0466964_0064845 3300044706 Bacteria 1529
367 Ga0466964_0196750 3300044706 Bacteria 965
368 Ga0466971_0033312 3300044719 Bacteria 2308
369 Ga0466968_0013530 3300044735 Bacteria 3209
370 Ga0466970_0023079 3300044765 Bacteria 3248
371 Ga0466957_0004217 3300044842 Bacteria 7972
372 Ga0466957_0004632 3300044842 Bacteria 7684
373 Ga0466957_0025475 3300044842 Bacteria 3506
374 Ga0466957_0123016 3300044842 Bacteria 1655
375 Ga0466957_0137926 3300044842 Bacteria 1569
376 Ga0466957_0304416 3300044842 Bacteria 1072
377 Ga0466960_0086481 3300044901 Bacteria 1590
378 Ga0466959_0006141 3300045049 Bacteria 8300
379 Ga0466958_0007657 3300045836 Bacteria 5953
380 Ga0466958_0013547 3300045836 Bacteria 4643
381 Ga0466958_0064800 3300045836 Bacteria 2229
382 Ga0466958_0103748 3300045836 Bacteria 1770
383 Ga0466967_0001213 3300045976 Bacteria 14528
384 Ga0466967_0002378 3300045976 Bacteria 11653
385 Ga0466967_0014903 3300045976 Bacteria 6077
386 Ga0466967_0035249 3300045976 Bacteria 4257
387 Ga0466967_0095078 3300045976 Bacteria 2715
388 Ga0466967_0140381 3300045976 Bacteria 2250
389 Ga0466967_0190241 3300045976 Bacteria 1939
390 Ga0466967_0205528 3300045976 Bacteria 1866
391 Ga0466967_0209444 3300045976 Bacteria 1849
392 Ga0466967_0237973 3300045976 Bacteria 1735
393 Ga0466967_0408116 3300045976 Bacteria 1322
394 Ga0466967_0510268 3300045976 Bacteria 1181
395 Ga0495603_0001339 3300046455 Bacteria 14306
396 Ga0495641_0007359 3300046461 Bacteria 6886
397 Ga0495651_0089389 3300046462 Bacteria 2312
398 Ga0495653_0038421 3300046463 Bacteria 3758
399 Ga0495653_0297577 3300046463 Bacteria 1053
400 Ga0495582_0062121 3300046473 Bacteria 2063
401 Ga0495664_0302854 3300046477 Bacteria 965
402 Ga0495594_0008893 3300046499 Bacteria 5179
403 Ga0495644_0189849 3300046523 Unclassified 791
404 Ga0495634_0096014 3300046642 Bacteria 1920
405 Ga0495635_0080844 3300046663 Unclassified 2224
406 Ga0495635_0090654 3300046663 Bacteria 2091
407 Ga0495661_0095198 3300046665 Bacteria 1687
408 Ga0495588_0000827 3300046674 Bacteria 13760
409 Ga0495599_0329569 3300046678 Bacteria 918
410 Ga0495658_0026215 3300046683 Bacteria 3122
411 Ga0495671_0051635 3300046692 Bacteria 2045
412 Ga0495674_0093481 3300047319 Bacteria 2566
413 Ga0495676_0044821 3300047321 Bacteria 3606
414 Ga0495680_0009650 3300047322 Bacteria 8663
415 Ga0495680_0083472 3300047322 Bacteria 2409
416 Ga0495680_0291710 3300047322 Unclassified 1147
417 Ga0495675_0186062 3300047444 Bacteria 1270
418 Ga0495684_0073542 3300047471 Bacteria 2597
419 Ga0495684_0214650 3300047471 Unclassified 1413
420 Ga0496100_0025426 3300048903 Bacteria 3622
421 Ga0496100_0046237 3300048903 Bacteria 2797
422 Ga0496100_0062782 3300048903 Bacteria 2453
423 Ga0496100_0173803 3300048903 Bacteria 1553
424 Ga0496101_0121199 3300048904 Bacteria 1977
425 Ga0496101_0159667 3300048904 Unclassified 1728
426 Ga0496101_0179134 3300048904 Bacteria 1631
427 Ga0496102_0020166 3300048905 Bacteria 5886
428 Ga0496102_0045346 3300048905 Bacteria 3992
429 Ga0496102_0050663 3300048905 Bacteria 3782
430 Ga0496102_0127027 3300048905 Bacteria 2384
431 Ga0496102_0196798 3300048905 Bacteria 1899
432 Ga0496102_0332250 3300048905 Bacteria 1431
433 Ga0496103_0008457 3300048906 Bacteria 6112
434 Ga0496103_0011692 3300048906 Bacteria 5205
435 Ga0496103_0013888 3300048906 Bacteria 4781
436 Ga0496103_0190321 3300048906 Bacteria 1319
437 Ga0496104_0003252 3300048907 Bacteria 14008
438 Ga0496104_0005528 3300048907 Bacteria 11070
439 Ga0496104_0014088 3300048907 Bacteria 7217
440 Ga0496104_0018190 3300048907 Bacteria 6408
441 Ga0496104_0022916 3300048907 Bacteria 5738
442 Ga0496104_0113321 3300048907 Bacteria 2600
443 Ga0496105_0001160 3300048908 Bacteria 18350
444 Ga0496105_0003360 3300048908 Bacteria 11831
445 Ga0496105_0018536 3300048908 Bacteria 5599
446 Ga0496105_0027801 3300048908 Bacteria 4623
447 Ga0496105_0032651 3300048908 Bacteria 4273
448 Ga0496105_0112139 3300048908 Bacteria 2250
449 Ga0496105_0224310 3300048908 Bacteria 1529
450 Ga0496105_0242534 3300048908 Unclassified 1462
451 Ga0496106_0004997 3300048909 Bacteria 9814
452 Ga0496106_0025404 3300048909 Bacteria 4408
453 Ga0496106_0050098 3300048909 Bacteria 3147
454 Ga0496106_0067136 3300048909 Bacteria 2733
455 Ga0496107_0000432 3300048910 Bacteria 22681
456 Ga0496107_0003616 3300048910 Bacteria 10382
457 Ga0496107_0039621 3300048910 Bacteria 3380
458 Ga0496107_0394055 3300048910 Bacteria 1030
459 Ga0496107_0488727 3300048910 Bacteria 913
460 Ga0496108_0001991 3300048911 Bacteria 16351
461 Ga0496108_0015449 3300048911 Bacteria 6228
462 Ga0496108_0026015 3300048911 Bacteria 4826
463 Ga0496108_0035809 3300048911 Bacteria 4127
464 Ga0496108_0145976 3300048911 Bacteria 2040
465 Ga0496108_0278052 3300048911 Bacteria 1457
466 Ga0496109_0011651 3300048912 Bacteria 7562
467 Ga0496109_0045809 3300048912 Bacteria 3970
468 Ga0496109_0071449 3300048912 Bacteria 3186
469 Ga0496110_0002084 3300048913 Bacteria 14913
470 Ga0496110_0003167 3300048913 Bacteria 12524
471 Ga0496110_0009658 3300048913 Bacteria 7812
472 Ga0496110_0031593 3300048913 Bacteria 4569
473 Ga0496110_0065372 3300048913 Bacteria 3215
474 Ga0496110_0155239 3300048913 Bacteria 2073
475 Ga0496110_0396340 3300048913 Bacteria 1258
476 Ga0496110_0452275 3300048913 Bacteria 1170
477 Ga0496111_0000319 3300048914 Bacteria 23843
478 Ga0496111_0012684 3300048914 Bacteria 5712
479 Ga0496111_0023201 3300048914 Bacteria 4354
480 Ga0496111_0029455 3300048914 Bacteria 3899
481 Ga0496111_0036019 3300048914 Bacteria 3538
482 Ga0496112_0006115 3300048915 Bacteria 10522
483 Ga0496112_0015958 3300048915 Bacteria 7022
484 Ga0496112_0029060 3300048915 Bacteria 5344
485 Ga0496112_0043208 3300048915 Bacteria 4412
486 Ga0496112_0053006 3300048915 Bacteria 3983
487 Ga0496112_0096378 3300048915 Bacteria 2928
488 Ga0496112_0124613 3300048915 Bacteria 2547
489 Ga0496112_0135884 3300048915 Bacteria 2429
490 Ga0496112_0337290 3300048915 Bacteria 1451
491 Ga0496112_0513232 3300048915 Bacteria 1133
492 Ga0496113_0009340 3300048916 Bacteria 6430
493 Ga0496113_0023529 3300048916 Bacteria 4368
494 Ga0496113_0025459 3300048916 Bacteria 4217
495 Ga0496113_0084107 3300048916 Bacteria 2442
496 Ga0496113_0421718 3300048916 Unclassified 1072
497 Ga0496114_0032147 3300048917 Bacteria 4318
498 Ga0496114_0055741 3300048917 Bacteria 3297
499 Ga0496114_0155325 3300048917 Bacteria 1986
500 Ga0496114_0288245 3300048917 Bacteria 1448
501 Ga0496114_0588683 3300048917 Bacteria 981
502 Ga0496115_0007637 3300048918 Bacteria 7967
503 Ga0496115_0086799 3300048918 Bacteria 2553
504 Ga0496115_0176326 3300048918 Unclassified 1767
505 Ga0501038_0096109 3300049574 Bacteria 2474
506 Ga0501042_0131441 3300049578 Bacteria 1804
507 Ga0501067_0064373 3300049583 Bacteria 2030
508 Ga0501069_0170761 3300049585 Bacteria 1255
509 Ga0501070_0017532 3300049586 Bacteria 6012
510 Ga0501070_0067112 3300049586 Unclassified 2971
511 Ga0501071_0089952 3300049587 Bacteria 2254
512 Ga0501071_0497071 3300049587 Bacteria 935
513 Ga0501072_0055851 3300049588 Bacteria 3112
514 Ga0501072_0110096 3300049588 Bacteria 2192
515 Ga0501073_0068015 3300049589 Bacteria 2483
516 Ga0501074_0019962 3300049590 Bacteria 4870
517 Ga0501076_0160309 3300049592 Bacteria 1832
518 Ga0501076_0659728 3300049592 Bacteria 863
519 Ga0501080_0011957 3300049742 Bacteria 7949
520 Ga0501081_0023975 3300049743 Bacteria 4093
521 Ga0501081_0102355 3300049743 Bacteria 2026
522 Ga0501045_0139235 3300049824 Bacteria 1805
523 nmdc:mga05p37_34675_c1 3300050507 Bacteria 6182
524 nmdc:mga05p37_7699_c1 3300050507 Bacteria 12711
525 nmdc:mga05p37_811747_c1 3300050507 Bacteria 1022
526 nmdc:mga09592_17649_c1 3300050508 Bacteria 5850
527 nmdc:mga0qj67_206392_c1 3300050509 Bacteria 1596
528 nmdc:mga08y16_172480_c1 3300050511 Bacteria 2247
529 nmdc:mga0n895_132126_c1 3300050512 Bacteria 2522
530 nmdc:mga0n895_153808_c1 3300050512 Bacteria 2331
531 nmdc:mga0n895_2415_c1 3300050512 Bacteria 14567
532 nmdc:mga0n895_92162_c1 3300050512 Bacteria 3033
533 nmdc:mga0rr50_186534_c1 3300050513 Bacteria 1698
534 nmdc:mga08x19_113331_c1 3300050514 Bacteria 1810
535 nmdc:mga08x19_183829_c1 3300050514 Bacteria 1428
536 nmdc:mga08x19_57587_c1 3300050514 Bacteria 2512
537 nmdc:mga0a205_108629_c1 3300050515 Bacteria 2673
538 nmdc:mga0a205_1597_c2 3300050515 Bacteria 18093
539 nmdc:mga0a205_77165_c1 3300050515 Bacteria 3219
540 nmdc:mga0a205_82424_c1 3300050515 Bacteria 3107
541 Ga0495595_0153306 3300053084 Bacteria 1134
542 Ga0495619_0053908 3300053085 Bacteria 2661
543 Ga0501084_0218956 3300054114 Bacteria 1606
544 Ga0501082_0133016 3300060353 Bacteria 2158
545 Ga0466962_0001080 3300061719 Bacteria 12520
546 Ga0466962_0012772 3300061719 Bacteria 4041
547 Ga0466962_0027073 3300061719 Bacteria 2753
548 Ga0466962_0074881 3300061719 Bacteria 1618
549 Ga0466962_0138514 3300061719 Bacteria 1178
550 Ga0530510_0073501 3300061734 Bacteria 2482
551 Ga0070658_10125665
552 JGI25407J50210_10056805
553 Ga0070683_100014396
554 Ga0070683_100245558
555 Ga0070680_100024690
556 Ga0070680_100057410
557 Ga0070680_100460304
558 Ga0070682_100063364
559 Ga0070682_100100240
560 Ga0070660_100012514
561 Ga0070660_100014101
562 Ga0070660_100116467
563 Ga0070660_100491054
564 Ga0070661_100049742
565 Ga0070692_10046531
566 Ga0070692_10119901
567 Ga0070671_100179565
568 Ga0070671_100200663
569 Ga0070674_100015109
570 Ga0070673_100127859
571 Ga0070709_10001534
572 Ga0070709_10479516
573 Ga0070714_100008495
574 Ga0070714_100011939
575 Ga0070714_100020548
576 Ga0070714_100022948
577 Ga0070714_100023296
578 Ga0070714_100026356
579 Ga0070714_100052274
580 Ga0070714_100471279
581 Ga0070713_100027322
582 Ga0070713_100114648
583 Ga0070713_100124751
584 Ga0070713_100515426
585 Ga0070710_10003659
586 Ga0070710_10006720
587 Ga0070710_10017903
588 Ga0070710_10146375
589 Ga0070701_10007517
590 Ga0070711_100041490
591 Ga0070711_100091665
592 Ga0070705_100004551
593 Ga0070705_100065095
594 Ga0070700_100035066
595 Ga0070700_100365861
596 Ga0070708_100157724
597 Ga0070663_100139153
598 Ga0070678_100010209
599 Ga0070678_100022697
600 Ga0070681_10013318
601 Ga0070681_10278791
602 Ga0068867_100023898
603 Ga0070707_100357129
604 Ga0070698_100032894
605 Ga0070698_100037621
606 Ga0070698_100123499
607 Ga0070698_100274718
608 Ga0070679_100030028
609 Ga0070679_100099544
610 Ga0070679_100132408
611 Ga0070679_100329896
612 Ga0070684_100006774
613 Ga0070684_100033240
614 Ga0070684_100050693
615 Ga0070684_100087760
616 Ga0070697_100425153
617 Ga0070672_100479749
618 Ga0070686_100064456
619 Ga0070695_100016176
620 Ga0070696_100023148
621 Ga0070696_100069875
622 Ga0070696_100124659
623 Ga0070693_100008201
624 Ga0070693_100032725
625 Ga0070693_100101830
626 Ga0070704_100187559
627 Ga0070704_100266553
628 Ga0068855_100008359
629 Ga0068855_100138294
630 Ga0070664_100143937
631 Ga0070664_100805066
632 Ga0068857_100052161
633 Ga0068857_100078497
634 Ga0068857_100588345
635 Ga0068856_100028816
636 Ga0068856_100210062
637 Ga0068856_100294324
638 Ga0070702_100221988
639 Ga0068861_100109865
640 Ga0068861_100128922
641 Ga0068862_100202411
642 Ga0068862_100430120
643 Ga0081538_10000266
644 Ga0081538_10001790
645 Ga0081538_10009611
646 Ga0081540_1004975
647 Ga0081540_1012990
648 Ga0070717_10049483
649 Ga0070717_10248256
650 Ga0075432_10023659
651 Ga0070715_10001185
652 Ga0070715_10014416
653 Ga0070716_100001663
654 Ga0070716_100024026
655 Ga0070716_100038535
656 Ga0070712_100006662
657 Ga0070712_100151081
658 Ga0070712_100201084
659 Ga0068871_100011692
660 Ga0075430_100110542
661 Ga0075433_10001378
662 Ga0075433_10137418
663 Ga0075433_10143791
664 Ga0075433_10198465
665 Ga0075434_100013318
666 Ga0075434_100205949
667 Ga0075434_100213004
668 Ga0075434_100390589
669 Ga0075429_100042463
670 Ga0068865_100170343
671 Ga0075436_100275226
672 Ga0075435_100005134
673 Ga0075435_100085372
674 Ga0075435_100308727
675 Ga0075435_100422049
676 Ga0105250_10109705
677 Ga0105240_10003384
678 Ga0105240_10005808
679 Ga0105240_10067867
680 Ga0105240_10441494
681 Ga0111539_10233100
682 Ga0111539_10293139
683 Ga0111539_11420638
684 Ga0105245_10048035
685 Ga0105247_10187640
686 Ga0114129_10016824
687 Ga0114129_10173935
688 Ga0114129_10302263
689 Ga0105243_10095113
690 Ga0105242_10374212
691 Ga0105242_10977154
692 Ga0105248_10053047
693 Ga0105248_10223303
694 Ga0105237_10720677
695 Ga0105249_10351490
696 Ga0105239_10158790
697 Ga0105239_10263448
698 Ga0157373_10043363
699 Ga0157373_10073468
700 Ga0157370_10060565
701 Ga0157369_10002407
702 Ga0157369_10007691
703 Ga0157374_10309523
704 Ga0157378_10168091
705 Ga0157378_10234037
706 Ga0163162_10063880
707 Ga0163162_10118299
708 Ga0157372_10070566
709 Ga0157372_10579275
710 Ga0157375_10025778
711 Ga0157375_10991868
712 Ga0163163_10310654
713 Ga0182008_10181430
714 Ga0206354_10928073
715 Ga0206353_10937605
716 Ga0206353_11080690
717 Ga0213876_10231631
718 Ga0207653_10008972
719 Ga0207692_10088843
720 Ga0207692_10140748
721 Ga0207685_10008837
722 Ga0207685_10022859
723 Ga0207699_10002375
724 Ga0207699_10102000
725 Ga0207705_10179523
726 Ga0207684_10276483
727 Ga0207684_10482151
728 Ga0207707_10009855
729 Ga0207707_10046286
730 Ga0207707_10189954
731 Ga0207695_10018875
732 Ga0207693_10001725
733 Ga0207693_10002896
734 Ga0207693_10009199
735 Ga0207693_10029671
736 Ga0207663_10006764
737 Ga0207663_10025090
738 Ga0207663_10033835
739 Ga0207660_10364004
740 Ga0207660_10487622
741 Ga0207657_10009059
742 Ga0207657_10027771
743 Ga0207657_10148937
744 Ga0207657_10167266
745 Ga0207649_10190052
746 Ga0207652_10012698
747 Ga0207652_10045444
748 Ga0207652_10071100
749 Ga0207652_10181313
750 Ga0207652_10310061
751 Ga0207652_10438204
752 Ga0207646_10184740
753 Ga0207700_10089527
754 Ga0207700_10114538
755 Ga0207700_10159219
756 Ga0207664_10003998
757 Ga0207664_10005140
758 Ga0207664_10062516
759 Ga0207664_10125153
760 Ga0207664_10413210
761 Ga0207644_10071516
762 Ga0207706_10024236
763 Ga0207706_10196092
764 Ga0207669_10028106
765 Ga0207665_10001916
766 Ga0207665_10006964
767 Ga0207665_10021043
768 Ga0207665_10651168
769 Ga0207711_10249792
770 Ga0207661_10011889
771 Ga0207661_10103027
772 Ga0207661_10208065
773 Ga0207661_10317799
774 Ga0207679_10493218
775 Ga0207667_10049143
776 Ga0207667_10121919
777 Ga0207668_10031708
778 Ga0207677_10046999
779 Ga0207677_10334492
780 Ga0207678_10012020
781 Ga0207708_10002361
782 Ga0207708_10101700
783 Ga0207702_10000955
784 Ga0207702_10067244
785 Ga0207702_10510540
786 Ga0207648_10003964
787 Ga0207676_10242599
788 Ga0207674_10000833
789 Ga0207674_10060636
790 Ga0207675_100010327
791 Ga0207675_100027151
792 Ga0207683_10005063
793 Ga0207683_10037352
794 Ga0207683_10175388
795 Ga0209998_10025041
796 Ga0207428_10035189
797 Ga0207428_10144448
798 Ga0268264_10131064
799 Ga0265319_1001369
800 Ga0265319_1007209
801 Ga0265334_10000248
802 Ga0265318_10000303
803 Ga0265318_10038655
804 Ga0265318_10044491
805 Ga0265336_10006545
806 Ga0265338_10010750
807 Ga0265338_10037527
808 Ga0265338_10063277
809 Ga0265338_10122489
810 Ga0265338_10198915
811 Ga0265324_10012742
812 Ga0265330_10000170
813 Ga0265330_10016655
814 Ga0265332_10016630
815 Ga0265332_10052522
816 Ga0265328_10014204
817 Ga0265320_10016926
818 Ga0265320_10057134
819 Ga0265320_10058743
820 Ga0265320_10181889
821 Ga0265325_10000058
822 Ga0265325_10116987
823 Ga0265329_10012483
824 Ga0265340_10000310
825 Ga0265339_10001387
826 Ga0265339_10014944
827 Ga0265339_10042568
828 Ga0265331_10008158
829 Ga0265331_10049603
830 Ga0265327_10004922
831 Ga0265327_10051255
832 Ga0265316_10000677
833 Ga0265316_10154529
834 Ga0265316_10323249
835 Ga0265316_10408834
836 Ga0265313_10021915
837 Ga0265313_10023645
838 Ga0265314_10003853
839 Ga0265314_10004488
840 Ga0265314_10015227
841 Ga0265314_10207047
842 Ga0265342_10001041
843 Ga0265342_10036981
844 Ga0307405_10001889
845 Ga0307413_10020185
846 Ga0307410_10021044
847 Ga0307406_10003096
848 Ga0307407_10046308
849 Ga0307416_100008422
850 Ga0307411_10034724
851 Ga0307415_100000129
852 Ga0316583_10015897
853 Ga0373930_0012528
854 Ga0373958_0031705
855 Ga0373959_0007014
856 Ga0373938_0040837
857 Ga0373940_0002538
858 Ga0373949_0015664
859 Ga0373951_0004196
860 Ga0373952_0004154
861 Ga0373932_0004230
862 Ga0373939_0001751
863 Ga0373939_0047286
864 Ga0373941_0001581
865 Ga0373941_0094977
866 Ga0373960_0019974
867 Ga0373960_0064915
868 Ga0373946_0051698
869 Ga0373942_0023982
870 Ga0373962_0024838
871 Ga0373931_0007552
872 Ga0373931_0138414
873 Ga0373925_0005863
874 Ga0395899_0007826
875 Ga0395899_0079509
876 Ga0395899_0129933
877 Ga0395899_0480171
878 Ga0395900_0001092
879 Ga0395900_0011854
880 Ga0395900_0085807
881 Ga0395900_0086066
882 Ga0395900_0870790
883 Ga0395898_0006415
884 Ga0395898_0009569
885 Ga0395898_0060037
886 Ga0395898_0148911
887 Ga0395898_0236016
888 Ga0395898_0723969
889 Ga0395905_0004948
890 Ga0395905_0006575
891 Ga0395905_0111133
892 Ga0395905_0202505
893 Ga0395901_0001665
894 Ga0395901_0010678
895 Ga0395901_0032292
896 Ga0395901_0073229
897 Ga0395901_0174386
898 Ga0395901_0460477
899 Ga0395901_0545651
900 Ga0395901_0747870
901 Ga0436365_0555375
902 Ga0436360_0968648
903 Ga0436363_1323674
904 Ga0439448_0008258
905 Ga0439450_048535
906 Ga0450907_022618
907 Ga0439464_0066048
908 Ga0466961_0007720
909 Ga0466961_0126500
910 Ga0466963_0004816
911 Ga0466963_0005244
912 Ga0466963_0047713
913 Ga0466963_0050336
914 Ga0466963_0103662
915 Ga0466964_0016419
916 Ga0466964_0064845
917 Ga0466964_0196750
918 Ga0466971_0033312
919 Ga0466968_0013530
920 Ga0466970_0023079
921 Ga0466957_0004217
922 Ga0466957_0004632
923 Ga0466957_0025475
924 Ga0466957_0123016
925 Ga0466957_0137926
926 Ga0466957_0304416
927 Ga0466960_0086481
928 Ga0466959_0006141
929 Ga0466958_0007657
930 Ga0466958_0013547
931 Ga0466958_0064800
932 Ga0466958_0103748
933 Ga0466967_0001213
934 Ga0466967_0002378
935 Ga0466967_0014903
936 Ga0466967_0035249
937 Ga0466967_0095078
938 Ga0466967_0140381
939 Ga0466967_0190241
940 Ga0466967_0205528
941 Ga0466967_0209444
942 Ga0466967_0237973
943 Ga0466967_0408116
944 Ga0466967_0510268
945 Ga0495603_0001339
946 Ga0495641_0007359
947 Ga0495651_0089389
948 Ga0495653_0038421
949 Ga0495653_0297577
950 Ga0495582_0062121
951 Ga0495664_0302854
952 Ga0495594_0008893
953 Ga0495644_0189849
954 Ga0495634_0096014
955 Ga0495635_0080844
956 Ga0495635_0090654
957 Ga0495661_0095198
958 Ga0495588_0000827
959 Ga0495599_0329569
960 Ga0495658_0026215
961 Ga0495671_0051635
962 Ga0495674_0093481
963 Ga0495676_0044821
964 Ga0495680_0009650
965 Ga0495680_0083472
966 Ga0495680_0291710
967 Ga0495675_0186062
968 Ga0495684_0073542
969 Ga0495684_0214650
970 Ga0496100_0025426
971 Ga0496100_0046237
972 Ga0496100_0062782
973 Ga0496100_0173803
974 Ga0496101_0121199
975 Ga0496101_0159667
976 Ga0496101_0179134
977 Ga0496102_0020166
978 Ga0496102_0045346
979 Ga0496102_0050663
980 Ga0496102_0127027
981 Ga0496102_0196798
982 Ga0496102_0332250
983 Ga0496103_0008457
984 Ga0496103_0011692
985 Ga0496103_0013888
986 Ga0496103_0190321
987 Ga0496104_0003252
988 Ga0496104_0005528
989 Ga0496104_0014088
990 Ga0496104_0018190
991 Ga0496104_0022916
992 Ga0496104_0113321
993 Ga0496105_0001160
994 Ga0496105_0003360
995 Ga0496105_0018536
996 Ga0496105_0027801
997 Ga0496105_0032651
998 Ga0496105_0112139
999 Ga0496105_0224310
1000 Ga0496105_0242534
1001 Ga0496106_0004997
1002 Ga0496106_0025404
1003 Ga0496106_0050098
1004 Ga0496106_0067136
1005 Ga0496107_0000432
1006 Ga0496107_0003616
1007 Ga0496107_0039621
1008 Ga0496107_0394055
1009 Ga0496107_0488727
1010 Ga0496108_0001991
1011 Ga0496108_0015449
1012 Ga0496108_0026015
1013 Ga0496108_0035809
1014 Ga0496108_0145976
1015 Ga0496108_0278052
1016 Ga0496109_0011651
1017 Ga0496109_0045809
1018 Ga0496109_0071449
1019 Ga0496110_0002084
1020 Ga0496110_0003167
1021 Ga0496110_0009658
1022 Ga0496110_0031593
1023 Ga0496110_0065372
1024 Ga0496110_0155239
1025 Ga0496110_0396340
1026 Ga0496110_0452275
1027 Ga0496111_0000319
1028 Ga0496111_0012684
1029 Ga0496111_0023201
1030 Ga0496111_0029455
1031 Ga0496111_0036019
1032 Ga0496112_0006115
1033 Ga0496112_0015958
1034 Ga0496112_0029060
1035 Ga0496112_0043208
1036 Ga0496112_0053006
1037 Ga0496112_0096378
1038 Ga0496112_0124613
1039 Ga0496112_0135884
1040 Ga0496112_0337290
1041 Ga0496112_0513232
1042 Ga0496113_0009340
1043 Ga0496113_0023529
1044 Ga0496113_0025459
1045 Ga0496113_0084107
1046 Ga0496113_0421718
1047 Ga0496114_0032147
1048 Ga0496114_0055741
1049 Ga0496114_0155325
1050 Ga0496114_0288245
1051 Ga0496114_0588683
1052 Ga0496115_0007637
1053 Ga0496115_0086799
1054 Ga0496115_0176326
1055 Ga0501038_0096109
1056 Ga0501042_0131441
1057 Ga0501067_0064373
1058 Ga0501069_0170761
1059 Ga0501070_0017532
1060 Ga0501070_0067112
1061 Ga0501071_0089952
1062 Ga0501071_0497071
1063 Ga0501072_0055851
1064 Ga0501072_0110096
1065 Ga0501073_0068015
1066 Ga0501074_0019962
1067 Ga0501076_0160309
1068 Ga0501076_0659728
1069 Ga0501080_0011957
1070 Ga0501081_0023975
1071 Ga0501081_0102355
1072 Ga0501045_0139235
1073 nmdc:mga05p37_34675_c1
1074 nmdc:mga05p37_7699_c1
1075 nmdc:mga05p37_811747_c1
1076 nmdc:mga09592_17649_c1
1077 nmdc:mga0qj67_206392_c1
1078 nmdc:mga08y16_172480_c1
1079 nmdc:mga0n895_132126_c1
1080 nmdc:mga0n895_153808_c1
1081 nmdc:mga0n895_2415_c1
1082 nmdc:mga0n895_92162_c1
1083 nmdc:mga0rr50_186534_c1
1084 nmdc:mga08x19_113331_c1
1085 nmdc:mga08x19_183829_c1
1086 nmdc:mga08x19_57587_c1
1087 nmdc:mga0a205_108629_c1
1088 nmdc:mga0a205_1597_c2
1089 nmdc:mga0a205_77165_c1
1090 nmdc:mga0a205_82424_c1
1091 Ga0495595_0153306
1092 Ga0495619_0053908
1093 Ga0501084_0218956
1094 Ga0501082_0133016
1095 Ga0466962_0001080
1096 Ga0466962_0012772
1097 Ga0466962_0027073
1098 Ga0466962_0074881
1099 Ga0466962_0138514
1100 Ga0530510_0073501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00633

HHH

Helix-hairpin-helix motif

131

151

0.94

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

64

186

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwe-assembly2.cif.gz_D adenine glycosylase muty variant e43q in complex with dna containing d(8-oxo-g) paired with substrate purine 0.9072 3 174
8dw7-assembly2.cif.gz_D dna glycosylase muty variant n146s in complex with dna containing the transition state analog 1n paired with d(8-oxo-g) 0.9038 2 174
4ypr-assembly2.cif.gz_B crystal structure of d144n muty bound to its anti-substrate 0.9036 2 174
5kn9-assembly1.cif.gz_A muty n-terminal domain in complex with dna containing an intrahelical oxog:a base-pair 0.9029 2 174
4ypr-assembly1.cif.gz_A crystal structure of d144n muty bound to its anti-substrate 0.9003 2 174
ID Description Score Start End Superfamily
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9615 16 120 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9602 15 120 1.10.340.30
af_A0A1D6IX31_1_95_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9534 34 122 1.10.1670.10
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9508 15 118 1.10.340.30
3n5nY02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9419 15 120 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A538I3R6-F1-model_v4 A/G-specific adenine glycosylase 0.9814 2 236 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A7Y5U6Z9-F1-model_v4 HhH-GPD domain-containing protein 0.9735 5 139 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A538I3R6-F1-model_v4 A/G-specific adenine glycosylase 0.9732 2 236 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A7V9C2N9-F1-model_v4 A/G-specific adenine glycosylase 0.9728 34 236 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A7X8KBM2-F1-model_v4 DNA repair protein 0.9598 3 132 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536

Map