F462335

General Info

Members Datasets Scaffolds Average Seq Length
549 318 535 306

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100092712|Ga0068856_1000927122
Length 349
Sequence MVEPLAASFRSGIDAMPGATNQHANMPTTMVRPRGARDDMTEQSILSVSKLHKAFGAGEQRVAIINDLSFALRPGECYGLLGPNGAGKTTTLRLCLGLATPDSGEIRLGGKVIPDQARAARKRVGVVPQADNLDPDFTVQENLLVFARYFGITDATMAQRIPELLEFANLTAKKDARIAELSGGMKRRLTLARALVNDPDLIFMDEPTTGLDPQARHMIWERLKNLLARGKTILLTTHFMDEAERLCDRLAVIDHGKMIAEGSPPDLIAQHIEAEVLEIYGENARSWAEQHGRSHASRVEYSGETVFCYTNDAQALLATLQHVQGVRYMHRPANLEDLFLKLTGREMRD

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
11 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
12 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
13 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
14 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
15 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
16 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
262 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
315 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 0.36
Rhizoplane 5.1
Rhizosphere 79.42
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000170 3300002704 Bacteria 28479
2 JGI25155J39150_1000860 3300002704 Bacteria 4435
3 JGI25156J39149_1000293 3300002705 Bacteria 33788
4 JGI25156J39149_1004273 3300002705 Bacteria 4399
5 JGI25154J39366_1000260 3300002738 Bacteria 33788
6 JGI25154J39366_1000267 3300002738 Bacteria 32817
7 JGI25157J39369_1000327 3300002741 Bacteria 33804
8 JGI25152J39213_1006758 3300002773 Bacteria 3054
9 JGI25153J46596_10009991 3300003215 Bacteria 4336
10 Ga0055532_1000184 3300003758 Bacteria 52595
11 Ga0055535_1015487 3300003761 Bacteria 1067
12 Ga0055526_1000791 3300003771 Bacteria 23567
13 Ga0055530_10005420 3300003791 Bacteria 6074
14 Ga0065165_1001259 3300005262 Bacteria 28658
15 Ga0070658_10208487 3300005327 Bacteria 1650
16 Ga0070676_10007256 3300005328 Bacteria 5944
17 Ga0070676_10255412 3300005328 Bacteria 1171
18 Ga0070683_100034749 3300005329 Bacteria 4606
19 Ga0070683_100137153 3300005329 Bacteria 2317
20 Ga0070690_100055099 3300005330 Bacteria 2546
21 Ga0070670_100174279 3300005331 Bacteria 1866
22 Ga0070677_10073012 3300005333 Bacteria 1448
23 Ga0070677_10151210 3300005333 Bacteria 1080
24 Ga0068869_100006173 3300005334 Bacteria 7585
25 Ga0070666_10112381 3300005335 Bacteria 1884
26 Ga0070666_10219901 3300005335 Bacteria 1339
27 Ga0070680_100040608 3300005336 Bacteria 3768
28 Ga0070680_100320804 3300005336 Bacteria 1315
29 Ga0070682_100001863 3300005337 Bacteria 11766
30 Ga0068868_100005246 3300005338 Bacteria 9095
31 Ga0068868_100014883 3300005338 Bacteria 5742
32 Ga0068868_100261501 3300005338 Bacteria 1459
33 Ga0070660_100001978 3300005339 Bacteria 14153
34 Ga0070660_100135149 3300005339 Bacteria 1975
35 Ga0070687_100058264 3300005343 Bacteria 2028
36 Ga0070661_100024519 3300005344 Bacteria 4326
37 Ga0070661_100044127 3300005344 Bacteria 3257
38 Ga0070661_100250502 3300005344 Bacteria 1366
39 Ga0070668_100020756 3300005347 Bacteria 4961
40 Ga0070668_100092505 3300005347 Bacteria 2385
41 Ga0070669_100011627 3300005353 Bacteria 6244
42 Ga0070669_100297859 3300005353 Bacteria 1296
43 Ga0070675_100026809 3300005354 Bacteria 4625
44 Ga0070675_100030414 3300005354 Bacteria 4360
45 Ga0070675_100056426 3300005354 Bacteria 3237
46 Ga0070675_100082190 3300005354 Bacteria 2687
47 Ga0070675_100144959 3300005354 Bacteria 2032
48 Ga0070671_100001538 3300005355 Bacteria 17332
49 Ga0070671_100136823 3300005355 Bacteria 2065
50 Ga0070671_100261965 3300005355 Bacteria 1469
51 Ga0070674_100134523 3300005356 Bacteria 1848
52 Ga0070673_100038828 3300005364 Bacteria 3639
53 Ga0070673_100048966 3300005364 Bacteria 3298
54 Ga0070673_100086888 3300005364 Bacteria 2548
55 Ga0070673_100277950 3300005364 Bacteria 1468
56 Ga0070688_100014639 3300005365 Bacteria 4447
57 Ga0070659_100001966 3300005366 Bacteria 14673
58 Ga0070659_100107055 3300005366 Bacteria 2254
59 Ga0070667_100014002 3300005367 Bacteria 6629
60 Ga0070667_100373318 3300005367 Bacteria 1294
61 Ga0070701_10032289 3300005438 Bacteria 2606
62 Ga0070708_100469597 3300005445 Bacteria 1187
63 Ga0070678_100119933 3300005456 Bacteria 2072
64 Ga0070678_100154296 3300005456 Bacteria 1853
65 Ga0070662_100038615 3300005457 Bacteria 3392
66 Ga0070662_100047082 3300005457 Bacteria 3100
67 Ga0070662_100059013 3300005457 Bacteria 2794
68 Ga0070662_100061865 3300005457 Bacteria 2734
69 Ga0070662_100140588 3300005457 Bacteria 1870
70 Ga0070662_100226966 3300005457 Bacteria 1492
71 Ga0070681_10134930 3300005458 Bacteria 2399
72 Ga0068867_100043708 3300005459 Bacteria 3280
73 Ga0068867_100469771 3300005459 Bacteria 1075
74 Ga0070685_10047294 3300005466 Bacteria 2473
75 Ga0070706_100007046 3300005467 Bacteria 10598
76 Ga0070707_100161029 3300005468 Bacteria 2187
77 Ga0070684_100498925 3300005535 Bacteria 1127
78 Ga0070672_100006073 3300005543 Bacteria 8073
79 Ga0070672_100012687 3300005543 Bacteria 5930
80 Ga0070672_100142776 3300005543 Bacteria 1976
81 Ga0070672_100407876 3300005543 Bacteria 1165
82 Ga0070686_100112139 3300005544 Bacteria 1860
83 Ga0070665_100026651 3300005548 Bacteria 5820
84 Ga0070704_100036448 3300005549 Bacteria 3352
85 Ga0068855_100035868 3300005563 Bacteria 5906
86 Ga0068855_100083279 3300005563 Bacteria 3705
87 Ga0068855_100138140 3300005563 Bacteria 2779
88 Ga0070664_100000867 3300005564 Bacteria 23390
89 Ga0070664_100005596 3300005564 Bacteria 10100
90 Ga0070664_100111270 3300005564 Bacteria 2390
91 Ga0070664_100144017 3300005564 Bacteria 2100
92 Ga0068857_100006660 3300005577 Bacteria 9926
93 Ga0068857_100368407 3300005577 Bacteria 1333
94 Ga0068854_100073461 3300005578 Bacteria 2506
95 Ga0068856_100028943 3300005614 Bacteria 5413
96 Ga0068856_100086791 3300005614 Bacteria 3110
97 Ga0068856_100092712 3300005614 Bacteria 3006
98 Ga0068852_100007873 3300005616 Bacteria 7803
99 Ga0068852_100038245 3300005616 Bacteria 4031
100 Ga0068852_100132697 3300005616 Bacteria 2295
101 Ga0068852_100178137 3300005616 Bacteria 1997
102 Ga0068852_100210182 3300005616 Bacteria 1845
103 Ga0068859_100008419 3300005617 Bacteria 10445
104 Ga0068859_100121622 3300005617 Bacteria 2677
105 Ga0068859_100132537 3300005617 Bacteria 2564
106 Ga0068864_100000633 3300005618 Bacteria 29494
107 Ga0068864_100015704 3300005618 Bacteria 6297
108 Ga0068864_100107777 3300005618 Bacteria 2478
109 Ga0068866_10034618 3300005718 Bacteria 2461
110 Ga0068861_100012851 3300005719 Bacteria 5847
111 Ga0068861_100023846 3300005719 Bacteria 4418
112 Ga0068861_100052391 3300005719 Bacteria 3101
113 Ga0068851_10029132 3300005834 Bacteria 2731
114 Ga0068851_10032278 3300005834 Bacteria 2605
115 Ga0068851_10033564 3300005834 Bacteria 2558
116 Ga0068851_10109141 3300005834 Bacteria 1476
117 Ga0068863_100050165 3300005841 Bacteria 3957
118 Ga0068858_100028034 3300005842 Bacteria 5233
119 Ga0068858_100028884 3300005842 Bacteria 5149
120 Ga0068858_100063048 3300005842 Bacteria 3429
121 Ga0068858_100099422 3300005842 Bacteria 2712
122 Ga0068858_100105956 3300005842 Bacteria 2624
123 Ga0068860_100024320 3300005843 Bacteria 5854
124 Ga0068860_100226713 3300005843 Bacteria 1815
125 Ga0068862_100022833 3300005844 Bacteria 5237
126 Ga0075365_10106431 3300006038 Bacteria 1925
127 Ga0075363_100022515 3300006048 Bacteria 3186
128 Ga0075364_10003430 3300006051 Bacteria 9010
129 Ga0070716_100004488 3300006173 Bacteria 6677
130 Ga0075362_10000222 3300006177 Bacteria 15765
131 Ga0075367_10037604 3300006178 Bacteria 2813
132 Ga0075369_10036217 3300006186 Bacteria 2099
133 Ga0075366_10048007 3300006195 Bacteria 2531
134 Ga0075366_10070252 3300006195 Bacteria 2085
135 Ga0097621_100101303 3300006237 Bacteria 2423
136 Ga0097621_100135320 3300006237 Bacteria 2101
137 Ga0097621_100200380 3300006237 Bacteria 1733
138 Ga0097621_100253178 3300006237 Bacteria 1542
139 Ga0097621_100261748 3300006237 Bacteria 1517
140 Ga0097621_100280883 3300006237 Bacteria 1465
141 Ga0075370_10015081 3300006353 Bacteria 4131
142 Ga0068871_100020186 3300006358 Bacteria 5100
143 Ga0068871_100053567 3300006358 Bacteria 3270
144 Ga0068871_100066207 3300006358 Bacteria 2961
145 Ga0068871_100178426 3300006358 Bacteria 1824
146 Ga0075431_100000817 3300006847 Bacteria 27171
147 Ga0075429_100003041 3300006880 Bacteria 14216
148 Ga0068865_100029210 3300006881 Bacteria 3655
149 Ga0068865_100036245 3300006881 Bacteria 3324
150 Ga0097620_100008419 3300006931 Bacteria 10445
151 Ga0097620_100121625 3300006931 Bacteria 2677
152 Ga0097620_100132541 3300006931 Bacteria 2564
153 Ga0099794_10012062 3300007265 Bacteria 3716
154 Ga0105240_10001692 3300009093 Bacteria 37346
155 Ga0111539_10263957 3300009094 Bacteria 2004
156 Ga0105245_10131295 3300009098 Bacteria 2350
157 Ga0105247_10144998 3300009101 Bacteria 1560
158 Ga0105243_10040470 3300009148 Bacteria 3640
159 Ga0105243_10060370 3300009148 Bacteria 3029
160 Ga0105243_10101540 3300009148 Bacteria 2389
161 Ga0105241_10003948 3300009174 Bacteria 10975
162 Ga0105241_10006603 3300009174 Bacteria 8547
163 Ga0105242_10101625 3300009176 Bacteria 2437
164 Ga0105248_10047282 3300009177 Bacteria 4825
165 Ga0105238_10003518 3300009551 Bacteria 15604
166 Ga0105238_10013485 3300009551 Bacteria 8250
167 Ga0105238_10054933 3300009551 Bacteria 3999
168 Ga0105249_10045426 3300009553 Bacteria 3995
169 Ga0105249_10101206 3300009553 Bacteria 2710
170 Ga0105239_10391261 3300010375 Bacteria 1572
171 Ga0157371_10122059 3300013102 Bacteria 1853
172 Ga0157374_10003255 3300013296 Bacteria 13642
173 Ga0157374_10027924 3300013296 Bacteria 5094
174 Ga0157374_10083444 3300013296 Bacteria 3036
175 Ga0157374_10263190 3300013296 Bacteria 1699
176 Ga0157378_10040438 3300013297 Bacteria 4134
177 Ga0157378_10066588 3300013297 Bacteria 3226
178 Ga0163162_10027068 3300013306 Bacteria 5670
179 Ga0163162_10041723 3300013306 Bacteria 4591
180 Ga0163162_10525177 3300013306 Bacteria 1313
181 Ga0157372_10018316 3300013307 Bacteria 7527
182 Ga0157372_10329743 3300013307 Bacteria 1777
183 Ga0157375_10025420 3300013308 Bacteria 5502
184 Ga0157375_10025469 3300013308 Bacteria 5497
185 Ga0157375_10436874 3300013308 Bacteria 1475
186 Ga0157375_10438586 3300013308 Bacteria 1472
187 Ga0157375_10699154 3300013308 Bacteria 1167
188 Ga0163163_10029770 3300014325 Bacteria 5254
189 Ga0163163_10405416 3300014325 Bacteria 1422
190 Ga0163163_10556325 3300014325 Bacteria 1210
191 Ga0157380_10032136 3300014326 Bacteria 4035
192 Ga0157380_10478839 3300014326 Bacteria 1203
193 Ga0157380_10485663 3300014326 Bacteria 1196
194 Ga0157377_10006752 3300014745 Bacteria 5497
195 Ga0157379_10023823 3300014968 Bacteria 5434
196 Ga0157379_10061777 3300014968 Bacteria 3351
197 Ga0157379_10162939 3300014968 Bacteria 2013
198 Ga0157376_10011011 3300014969 Bacteria 6646
199 Ga0157376_10018794 3300014969 Bacteria 5310
200 Ga0157376_10045026 3300014969 Bacteria 3630
201 Ga0157376_10151848 3300014969 Bacteria 2089
202 Ga0157376_10215812 3300014969 Bacteria 1774
203 Ga0157376_10277505 3300014969 Bacteria 1577
204 Ga0163161_10011712 3300017792 Bacteria 6085
205 Ga0163161_10083159 3300017792 Bacteria 2359
206 Ga0163161_10167152 3300017792 Bacteria 1680
207 Ga0163161_10344441 3300017792 Bacteria 1183
208 Ga0213876_10065952 3300021384 Bacteria 1911
209 Ga0209435_100079 3300025206 Bacteria 51612
210 Ga0209435_100137 3300025206 Bacteria 24597
211 Ga0209147_100060 3300025229 Bacteria 249588
212 Ga0209437_100081 3300025233 Bacteria 271072
213 Ga0209258_100141 3300025242 Bacteria 166385
214 Ga0207425_1000645 3300025245 Bacteria 19440
215 Ga0209646_1000265 3300025246 Bacteria 50897
216 Ga0209646_1000290 3300025246 Bacteria 42743
217 Ga0209026_1000330 3300025250 Bacteria 47453
218 Ga0209026_1002521 3300025250 Bacteria 6784
219 Ga0209759_1000473 3300025256 Bacteria 44908
220 Ga0209759_1000485 3300025256 Bacteria 43802
221 Ga0209129_1000158 3300025258 Bacteria 103711
222 Ga0209673_1002375 3300025273 Bacteria 13220
223 Ga0209564_1000282 3300025295 Bacteria 103837
224 Ga0209758_1000500 3300025297 Bacteria 63618
225 Ga0209758_1000630 3300025297 Bacteria 54005
226 Ga0209050_1000223 3300025298 Bacteria 125465
227 Ga0207656_10061803 3300025321 Bacteria 1645
228 Ga0207656_10084165 3300025321 Bacteria 1434
229 Ga0207682_10002051 3300025893 Bacteria 9121
230 Ga0207682_10037907 3300025893 Bacteria 1954
231 Ga0207682_10069187 3300025893 Bacteria 1493
232 Ga0207682_10137616 3300025893 Bacteria 1094
233 Ga0207642_10016791 3300025899 Bacteria 2768
234 Ga0207688_10004075 3300025901 Bacteria 7962
235 Ga0207645_10011438 3300025907 Bacteria 6058
236 Ga0207645_10014310 3300025907 Bacteria 5313
237 Ga0207645_10019699 3300025907 Bacteria 4422
238 Ga0207645_10252519 3300025907 Bacteria 1167
239 Ga0207643_10030995 3300025908 Bacteria 2979
240 Ga0207705_10213044 3300025909 Bacteria 1466
241 Ga0207654_10008208 3300025911 Bacteria 5267
242 Ga0207707_10117286 3300025912 Bacteria 2327
243 Ga0207695_10036426 3300025913 Bacteria 5319
244 Ga0207660_10067331 3300025917 Bacteria 2593
245 Ga0207660_10114646 3300025917 Bacteria 2033
246 Ga0207657_10001495 3300025919 Bacteria 25015
247 Ga0207649_10010050 3300025920 Bacteria 5192
248 Ga0207649_10085933 3300025920 Bacteria 2048
249 Ga0207652_10109760 3300025921 Bacteria 2446
250 Ga0207681_10003786 3300025923 Bacteria 9387
251 Ga0207681_10068400 3300025923 Bacteria 2466
252 Ga0207681_10107862 3300025923 Bacteria 2020
253 Ga0207681_10163219 3300025923 Bacteria 1681
254 Ga0207681_10360772 3300025923 Bacteria 1165
255 Ga0207694_10140276 3300025924 Bacteria 1943
256 Ga0207650_10013932 3300025925 Bacteria 5578
257 Ga0207650_10053911 3300025925 Bacteria 2981
258 Ga0207650_10116213 3300025925 Bacteria 2077
259 Ga0207650_10130247 3300025925 Bacteria 1968
260 Ga0207659_10052955 3300025926 Bacteria 2893
261 Ga0207659_10089966 3300025926 Bacteria 2290
262 Ga0207659_10092702 3300025926 Bacteria 2259
263 Ga0207659_10143128 3300025926 Bacteria 1858
264 Ga0207659_10162463 3300025926 Bacteria 1755
265 Ga0207687_10100982 3300025927 Bacteria 2123
266 Ga0207644_10009771 3300025931 Bacteria 6307
267 Ga0207644_10131865 3300025931 Bacteria 1914
268 Ga0207644_10222249 3300025931 Bacteria 1497
269 Ga0207690_10000959 3300025932 Bacteria 18469
270 Ga0207706_10002668 3300025933 Bacteria 17378
271 Ga0207706_10022195 3300025933 Bacteria 5697
272 Ga0207706_10039197 3300025933 Bacteria 4200
273 Ga0207706_10221364 3300025933 Bacteria 1657
274 Ga0207706_10305617 3300025933 Bacteria 1385
275 Ga0207686_10018193 3300025934 Bacteria 3974
276 Ga0207686_10077514 3300025934 Bacteria 2158
277 Ga0207709_10008638 3300025935 Bacteria 5627
278 Ga0207669_10012975 3300025937 Bacteria 4120
279 Ga0207669_10174888 3300025937 Bacteria 1532
280 Ga0207704_10003079 3300025938 Bacteria 7535
281 Ga0207665_10047695 3300025939 Bacteria 2873
282 Ga0207691_10000612 3300025940 Bacteria 35502
283 Ga0207691_10003129 3300025940 Bacteria 16168
284 Ga0207691_10172788 3300025940 Bacteria 1892
285 Ga0207691_10381145 3300025940 Bacteria 1204
286 Ga0207711_10122650 3300025941 Bacteria 2321
287 Ga0207689_10005225 3300025942 Bacteria 11645
288 Ga0207689_10006428 3300025942 Bacteria 10390
289 Ga0207689_10049766 3300025942 Bacteria 3457
290 Ga0207661_10350277 3300025944 Bacteria 1332
291 Ga0207679_10009097 3300025945 Bacteria 6347
292 Ga0207679_10089699 3300025945 Bacteria 2374
293 Ga0207679_10162565 3300025945 Bacteria 1829
294 Ga0207679_10210253 3300025945 Bacteria 1631
295 Ga0207679_10338933 3300025945 Bacteria 1307
296 Ga0207667_10028143 3300025949 Bacteria 6105
297 Ga0207667_10049848 3300025949 Bacteria 4420
298 Ga0207651_10000489 3300025960 Bacteria 16657
299 Ga0207651_10036899 3300025960 Bacteria 3196
300 Ga0207651_10045570 3300025960 Bacteria 2942
301 Ga0207712_10064682 3300025961 Bacteria 2609
302 Ga0207668_10026546 3300025972 Bacteria 3761
303 Ga0207640_10095834 3300025981 Bacteria 2067
304 Ga0207640_10105533 3300025981 Bacteria 1985
305 Ga0207658_10002481 3300025986 Bacteria 13444
306 Ga0207658_10154926 3300025986 Bacteria 1871
307 Ga0207658_10540790 3300025986 Bacteria 1041
308 Ga0207677_10014782 3300026023 Bacteria 4570
309 Ga0207677_10199016 3300026023 Bacteria 1591
310 Ga0207703_10002613 3300026035 Bacteria 15539
311 Ga0207703_10006418 3300026035 Bacteria 9400
312 Ga0207703_10027828 3300026035 Bacteria 4453
313 Ga0207703_10047851 3300026035 Bacteria 3449
314 Ga0207703_10145801 3300026035 Bacteria 2059
315 Ga0207639_10148138 3300026041 Bacteria 1963
316 Ga0207678_10070084 3300026067 Bacteria 3006
317 Ga0207678_10115258 3300026067 Bacteria 2292
318 Ga0207708_10014475 3300026075 Bacteria 5904
319 Ga0207708_10285724 3300026075 Bacteria 1338
320 Ga0207702_10080387 3300026078 Bacteria 2828
321 Ga0207702_10205850 3300026078 Bacteria 1827
322 Ga0207641_10037951 3300026088 Bacteria 4025
323 Ga0207641_10076735 3300026088 Bacteria 2890
324 Ga0207648_10017883 3300026089 Bacteria 6432
325 Ga0207648_10038273 3300026089 Bacteria 4221
326 Ga0207648_10057476 3300026089 Bacteria 3394
327 Ga0207648_10078189 3300026089 Bacteria 2886
328 Ga0207648_10093989 3300026089 Bacteria 2622
329 Ga0207676_10038339 3300026095 Bacteria 3656
330 Ga0207676_10128234 3300026095 Bacteria 2152
331 Ga0207674_10025008 3300026116 Bacteria 6374
332 Ga0207674_10086172 3300026116 Bacteria 3135
333 Ga0207675_100003397 3300026118 Bacteria 15561
334 Ga0207675_100032838 3300026118 Bacteria 4836
335 Ga0207675_100162699 3300026118 Bacteria 2130
336 Ga0207675_100197882 3300026118 Bacteria 1929
337 Ga0207683_10003848 3300026121 Bacteria 13019
338 Ga0207683_10024424 3300026121 Bacteria 5206
339 Ga0207683_10025278 3300026121 Bacteria 5122
340 Ga0207698_10024234 3300026142 Bacteria 4256
341 Ga0207698_10045989 3300026142 Bacteria 3292
342 Ga0207698_10227613 3300026142 Bacteria 1690
343 Ga0209969_1007197 3300027360 Bacteria 1571
344 Ga0209588_1017153 3300027671 Bacteria 2242
345 Ga0209813_10036632 3300027866 Bacteria 1475
346 Ga0268265_10118265 3300028380 Bacteria 2178
347 Ga0268264_10002070 3300028381 Bacteria 17906
348 Ga0268264_10014837 3300028381 Bacteria 6398
349 Ga0268264_10352667 3300028381 Bacteria 1401
350 Ga0265318_10003181 3300028577 Bacteria 8385
351 Ga0307511_10000653 3300030521 Bacteria 37038
352 Ga0265330_10017894 3300031235 Bacteria 3259
353 Ga0265332_10000006 3300031238 Bacteria 327963
354 Ga0265332_10006768 3300031238 Bacteria 5193
355 Ga0265328_10005040 3300031239 Bacteria 5691
356 Ga0265328_10014789 3300031239 Bacteria 3066
357 Ga0265331_10005912 3300031250 Bacteria 7315
358 Ga0265331_10022712 3300031250 Bacteria 3198
359 Ga0265316_10003730 3300031344 Bacteria 15309
360 Ga0307408_100050016 3300031548 Bacteria 3004
361 Ga0307408_100157002 3300031548 Bacteria 1803
362 Ga0265314_10003019 3300031711 Bacteria 16634
363 Ga0265314_10043878 3300031711 Bacteria 3174
364 Ga0307516_10020880 3300031730 Bacteria 6759
365 Ga0307405_10032089 3300031731 Bacteria 3100
366 Ga0307405_10075710 3300031731 Bacteria 2181
367 Ga0307413_10098085 3300031824 Bacteria 1928
368 Ga0307406_10039274 3300031901 Bacteria 2935
369 Ga0307412_10020585 3300031911 Bacteria 4017
370 Ga0307412_10187815 3300031911 Bacteria 1560
371 Ga0307409_100000577 3300031995 Bacteria 15970
372 Ga0307409_100002540 3300031995 Bacteria 9574
373 Ga0307416_100002818 3300032002 Bacteria 10112
374 Ga0307416_100044859 3300032002 Bacteria 3475
375 Ga0307416_100047868 3300032002 Bacteria 3388
376 Ga0307411_10018344 3300032005 Bacteria 4011
377 Ga0307415_100006508 3300032126 Bacteria 6311
378 Ga0307415_100085923 3300032126 Bacteria 2262
379 Ga0307507_10183739 3300033179 Bacteria 1488
380 Ga0373959_0007456 3300034820 Bacteria 1839
381 Ga0373941_0019332 3300035115 Bacteria 1895
382 Ga0373945_0106511 3300035116 Bacteria 1103
383 Ga0373943_0042059 3300035170 Bacteria 2213
384 Ga0373943_0119210 3300035170 Bacteria 1401
385 Ga0373962_0008890 3300035242 Bacteria 2481
386 Ga0373927_0033664 3300035695 Bacteria 3336
387 Ga0373937_0135845 3300036401 Bacteria 2299
388 Ga0373925_0182611 3300037068 Bacteria 1661
389 Ga0395899_0002882 3300037312 Bacteria 13815
390 Ga0395899_0003628 3300037312 Bacteria 12217
391 Ga0395900_0022527 3300037418 Bacteria 6445
392 Ga0395900_0075864 3300037418 Bacteria 3456
393 Ga0395900_0253805 3300037418 Bacteria 1759
394 Ga0395898_0006001 3300037466 Bacteria 13041
395 Ga0395905_0000549 3300037471 Bacteria 51321
396 Ga0395905_0001262 3300037471 Bacteria 31273
397 Ga0395905_0001839 3300037471 Bacteria 24502
398 Ga0395905_0003586 3300037471 Bacteria 16519
399 Ga0395905_0006051 3300037471 Bacteria 12254
400 Ga0395905_0015392 3300037471 Bacteria 7269
401 Ga0395905_0306319 3300037471 Bacteria 1477
402 Ga0395901_0038998 3300038443 Bacteria 4914
403 Ga0395901_0542918 3300038443 Bacteria 1179
404 Ga0436365_1691899 3300039437 Bacteria 2172
405 Ga0451789_0590955 3300041443 Bacteria 2789
406 Ga0451798_0468504 3300041458 Bacteria 2075
407 Ga0451804_0553210 3300041463 Bacteria 5112
408 Ga0439441_017807 3300042001 Bacteria 1280
409 Ga0439455_0022496 3300042012 Bacteria 1511
410 Ga0451577_0023827 3300042876 Bacteria 5575
411 Ga0466972_0000140 3300044658 Bacteria 59505
412 Ga0466972_0018698 3300044658 Bacteria 3465
413 Ga0466972_0032616 3300044658 Bacteria 2557
414 Ga0466965_0000818 3300044683 Bacteria 11733
415 Ga0466965_0009563 3300044683 Bacteria 4507
416 Ga0466965_0096169 3300044683 Bacteria 1511
417 Ga0466966_0018973 3300044684 Bacteria 4532
418 Ga0466966_0021631 3300044684 Bacteria 4223
419 Ga0466961_0087899 3300044693 Bacteria 1963
420 Ga0453684_0033105 3300044712 Bacteria 7212
421 Ga0466968_0010668 3300044735 Bacteria 3567
422 Ga0466968_0031187 3300044735 Bacteria 2210
423 Ga0466968_0044342 3300044735 Bacteria 1884
424 Ga0466970_0040382 3300044765 Bacteria 2478
425 Ga0466959_0229485 3300045049 Bacteria 1285
426 Ga0451576_0156515 3300045051 Bacteria 2377
427 Ga0495592_0000711 3300046454 Bacteria 23301
428 Ga0495580_0186785 3300046472 Bacteria 1430
429 Ga0495606_0004241 3300046507 Bacteria 14500
430 Ga0495628_0001663 3300046516 Bacteria 20314
431 Ga0495632_0009180 3300046519 Bacteria 5977
432 Ga0495643_0045162 3300046522 Bacteria 2392
433 Ga0495642_0006014 3300046528 Bacteria 4661
434 Ga0495642_0041153 3300046528 Bacteria 1879
435 Ga0495642_0050647 3300046528 Bacteria 1708
436 Ga0495652_0004318 3300046529 Bacteria 13622
437 Ga0495598_0012181 3300046537 Bacteria 2103
438 Ga0495598_0062177 3300046537 Bacteria 1155
439 Ga0495598_0065497 3300046537 Bacteria 1131
440 Ga0495621_0015334 3300046539 Bacteria 2443
441 Ga0495597_0067070 3300046542 Bacteria 1553
442 Ga0495645_0001291 3300046543 Bacteria 17090
443 Ga0495645_0020885 3300046543 Bacteria 4732
444 Ga0495668_0165523 3300046616 Bacteria 1211
445 Ga0495625_0009260 3300046660 Bacteria 8262
446 Ga0495661_0001479 3300046665 Bacteria 19638
447 Ga0495657_0072554 3300046675 Bacteria 2245
448 Ga0495599_0001351 3300046678 Bacteria 14001
449 Ga0495647_0057070 3300046681 Bacteria 1532
450 Ga0495658_0008655 3300046683 Bacteria 5051
451 Ga0495658_0021167 3300046683 Bacteria 3426
452 Ga0495613_0128053 3300046689 Bacteria 1819
453 Ga0495636_0012687 3300047318 Bacteria 3337
454 Ga0495687_026256 3300047443 Bacteria 2744
455 Ga0496100_0027113 3300048903 Bacteria 3520
456 Ga0496100_0356114 3300048903 Bacteria 1106
457 Ga0496100_0565310 3300048903 Bacteria 881
458 Ga0496101_0030214 3300048904 Bacteria 3797
459 Ga0496102_0003567 3300048905 Bacteria 13187
460 Ga0496102_0388129 3300048905 Bacteria 1314
461 Ga0496103_0034885 3300048906 Bacteria 3078
462 Ga0496104_0061232 3300048907 Bacteria 3568
463 Ga0496104_0113113 3300048907 Bacteria 2603
464 Ga0496104_0231159 3300048907 Bacteria 1761
465 Ga0496105_0025340 3300048908 Bacteria 4828
466 Ga0496105_0125301 3300048908 Bacteria 2117
467 Ga0496105_0133511 3300048908 Bacteria 2045
468 Ga0496106_0044158 3300048909 Bacteria 3345
469 Ga0496107_0104654 3300048910 Bacteria 2077
470 Ga0496108_0034865 3300048911 Bacteria 4181
471 Ga0496108_0142882 3300048911 Bacteria 2062
472 Ga0496109_0110004 3300048912 Bacteria 2561
473 Ga0496109_0194210 3300048912 Bacteria 1907
474 Ga0496110_0129671 3300048913 Bacteria 2276
475 Ga0496110_0405563 3300048913 Bacteria 1243
476 Ga0496111_0010469 3300048914 Bacteria 6225
477 Ga0496114_0234041 3300048917 Bacteria 1614
478 Ga0496114_0317999 3300048917 Bacteria 1375
479 Ga0496114_0563849 3300048917 Bacteria 1006
480 Ga0496121_0002479 3300048924 Bacteria 28114
481 Ga0496121_0095272 3300048924 Bacteria 2314
482 Ga0496122_0000968 3300048925 Bacteria 51537
483 Ga0496123_0004825 3300048926 Bacteria 13907
484 Ga0496124_0000388 3300048927 Bacteria 80485
485 Ga0496125_0002865 3300048928 Bacteria 21711
486 Ga0496125_0003499 3300048928 Bacteria 18978
487 Ga0496125_0027904 3300048928 Bacteria 5107
488 Ga0501292_001319 3300049515 Bacteria 3051
489 Ga0501031_0019753 3300049568 Bacteria 4390
490 Ga0501032_0048570 3300049569 Bacteria 2865
491 Ga0501033_0002339 3300049570 Bacteria 16164
492 Ga0501034_0143198 3300049571 Bacteria 2369
493 Ga0501037_0003806 3300049573 Bacteria 10947
494 Ga0501038_0113812 3300049574 Bacteria 2238
495 Ga0501039_0003932 3300049575 Bacteria 11168
496 Ga0501040_0079002 3300049576 Bacteria 2277
497 Ga0501041_0004135 3300049577 Bacteria 8394
498 Ga0501042_0006414 3300049578 Bacteria 7630
499 Ga0501047_0000477 3300049581 Bacteria 43621
500 Ga0501075_0002497 3300049591 Bacteria 12252
501 Ga0501076_0002131 3300049592 Bacteria 13585
502 Ga0501077_0137181 3300049593 Bacteria 1551
503 Ga0501080_0018160 3300049742 Bacteria 6510
504 Ga0501081_0000696 3300049743 Bacteria 19414
505 Ga0501035_0004651 3300049822 Bacteria 13025
506 Ga0501035_0100607 3300049822 Bacteria 2538
507 Ga0501044_0000987 3300049823 Bacteria 34197
508 nmdc:mga03683_75369_c1 3300050489 Bacteria 1449
509 nmdc:mga03n38_173962_c1 3300050490 Bacteria 1099
510 nmdc:mga00v17_8359_c1 3300050491 Bacteria 5568
511 nmdc:mga0yw44_7154_c1 3300050492 Bacteria 5465
512 nmdc:mga0k408_24801_c1 3300050493 Bacteria 3393
513 nmdc:mga0k408_35918_c1 3300050493 Bacteria 2842
514 nmdc:mga06z11_32248_c1 3300050494 Bacteria 2554
515 nmdc:mga07m45_12786_c1 3300050496 Bacteria 4440
516 nmdc:mga05p37_143415_c1 3300050507 Bacteria 2925
517 nmdc:mga09592_24148_c1 3300050508 Bacteria 5026
518 nmdc:mga0qj67_101315_c1 3300050509 Bacteria 2322
519 nmdc:mga06r32_4702_c1 3300050510 Bacteria 12267
520 nmdc:mga08y16_14875_c2 3300050511 Bacteria 6017
521 Ga0495601_0005658 3300053077 Bacteria 7289
522 Ga0495601_0054774 3300053077 Bacteria 2524
523 Ga0500578_0000292 3300053086 Bacteria 61943
524 Ga0500578_0105274 3300053086 Bacteria 1782
525 Ga0500646_0000869 3300053090 Bacteria 8331
526 Ga0500651_0000274 3300053093 Bacteria 30518
527 Ga0500618_012093 3300053125 Bacteria 2270
528 Ga0500642_0011286 3300053130 Bacteria 3189
529 Ga0500652_002299 3300053131 Bacteria 5743
530 Ga0500568_0016703 3300053139 Bacteria 3254
531 Ga0500604_0000727 3300053151 Bacteria 9013
532 Ga0500622_0000198 3300053156 Bacteria 63633
533 Ga0500645_001196 3300053730 Bacteria 13804
534 Ga0501082_0000754 3300060353 Bacteria 28420
535 Ga0466962_0000421 3300061719 Bacteria 18318

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0565310 Ga0496100_0565310_58_870 264
2 3300046542 Ga0495597_0067070 Ga0495597_0067070_695_1543 282
3 3300050509 nmdc:mga0qj67_101315_c1 nmdc:mga0qj67_101315_c1_65_925 286
4 3300005347 Ga0070668_100092505 Ga0070668_1000925052 288
5 3300005844 Ga0068862_100022833 Ga0068862_1000228335 288
6 3300025321 Ga0207656_10061803 Ga0207656_100618032 288
7 3300026089 Ga0207648_10038273 Ga0207648_100382733 288
8 3300028380 Ga0268265_10118265 Ga0268265_101182653 288
9 3300046537 Ga0495598_0065497 Ga0495598_0065497_23_943 288
10 3300047318 Ga0495636_0012687 Ga0495636_0012687_1768_2673 291
11 3300035170 Ga0373943_0119210 Ga0373943_0119210_261_1178 292
12 3300037471 Ga0395905_0001262 Ga0395905_0001262_3062_4030 292
13 3300048907 Ga0496104_0113113 Ga0496104_0113113_1088_2005 292
14 3300048908 Ga0496105_0133511 Ga0496105_0133511_313_1230 292
15 3300048917 Ga0496114_0563849 Ga0496114_0563849_37_954 292
16 3300037418 Ga0395900_0253805 Ga0395900_0253805_616_1587 293
17 3300037471 Ga0395905_0003586 Ga0395905_0003586_14099_15070 293
18 3300037471 Ga0395905_0015392 Ga0395905_0015392_927_1898 293
19 3300003791 Ga0055530_10005420 Ga0055530_100054202 295
20 3300005262 Ga0065165_1001259 Ga0065165_100125914 295
21 3300006195 Ga0075366_10070252 Ga0075366_100702522 295
22 3300013296 Ga0157374_10003255 Ga0157374_100032555 295
23 3300013308 Ga0157375_10438586 Ga0157375_104385862 295
24 3300025273 Ga0209673_1002375 Ga0209673_100237515 295
25 3300025297 Ga0209758_1000500 Ga0209758_10005007 295
26 3300025298 Ga0209050_1000223 Ga0209050_100022383 295
27 3300041443 Ga0451789_0590955 Ga0451789_0590955_766_1686 295
28 3300041458 Ga0451798_0468504 Ga0451798_0468504_1003_1923 295
29 3300041463 Ga0451804_0553210 Ga0451804_0553210_842_1762 295
30 3300044735 Ga0466968_0031187 Ga0466968_0031187_1014_1934 295
31 3300046519 Ga0495632_0009180 Ga0495632_0009180_221_1141 295
32 3300048905 Ga0496102_0003567 Ga0496102_0003567_9481_10401 295
33 3300050493 nmdc:mga0k408_35918_c1 nmdc:mga0k408_35918_c1_1117_2034 295
34 3300053086 Ga0500578_0000292 Ga0500578_0000292_52930_53847 295
35 3300053093 Ga0500651_0000274 Ga0500651_0000274_5561_6481 295
36 3300053130 Ga0500642_0011286 Ga0500642_0011286_773_1693 295
37 3300053131 Ga0500652_002299 Ga0500652_002299_3427_4347 295
38 3300053139 Ga0500568_0016703 Ga0500568_0016703_1575_2495 295
39 3300053156 Ga0500622_0000198 Ga0500622_0000198_28430_29350 295
40 3300003215 JGI25153J46596_10009991 JGI25153J46596_100099912 296
41 3300026075 Ga0207708_10014475 Ga0207708_100144754 296
42 3300031730 Ga0307516_10020880 Ga0307516_100208806 296
43 3300046454 Ga0495592_0000711 Ga0495592_0000711_15682_16590 296
44 3300046516 Ga0495628_0001663 Ga0495628_0001663_11935_12843 296
45 3300046529 Ga0495652_0004318 Ga0495652_0004318_5332_6240 296
46 3300046543 Ga0495645_0001291 Ga0495645_0001291_11802_12710 296
47 3300046678 Ga0495599_0001351 Ga0495599_0001351_8441_9349 296
48 3300048927 Ga0496124_0000388 Ga0496124_0000388_35061_35978 296
49 3300048928 Ga0496125_0002865 Ga0496125_0002865_16200_17117 296
50 3300053077 Ga0495601_0005658 Ga0495601_0005658_5370_6278 296
51 3300002773 JGI25152J39213_1006758 JGI25152J39213_10067583 297
52 3300003771 Ga0055526_1000791 Ga0055526_10007912 297
53 3300005331 Ga0070670_100174279 Ga0070670_1001742793 297
54 3300005338 Ga0068868_100261501 Ga0068868_1002615012 297
55 3300005354 Ga0070675_100082190 Ga0070675_1000821903 297
56 3300005364 Ga0070673_100038828 Ga0070673_1000388282 297
57 3300005364 Ga0070673_100277950 Ga0070673_1002779502 297
58 3300005456 Ga0070678_100119933 Ga0070678_1001199333 297
59 3300005457 Ga0070662_100059013 Ga0070662_1000590133 297
60 3300005459 Ga0068867_100043708 Ga0068867_1000437083 297
61 3300005543 Ga0070672_100407876 Ga0070672_1004078762 297
62 3300005578 Ga0068854_100073461 Ga0068854_1000734613 297
63 3300005616 Ga0068852_100132697 Ga0068852_1001326973 297
64 3300005617 Ga0068859_100008419 Ga0068859_10000841911 297
65 3300005618 Ga0068864_100000633 Ga0068864_1000006333 297
66 3300005719 Ga0068861_100052391 Ga0068861_1000523912 297
67 3300005841 Ga0068863_100050165 Ga0068863_1000501653 297
68 3300005842 Ga0068858_100099422 Ga0068858_1000994223 297
69 3300006237 Ga0097621_100200380 Ga0097621_1002003802 297
70 3300006931 Ga0097620_100008419 Ga0097620_10000841911 297
71 3300009553 Ga0105249_10045426 Ga0105249_100454263 297
72 3300013297 Ga0157378_10066588 Ga0157378_100665883 297
73 3300013308 Ga0157375_10436874 Ga0157375_104368742 297
74 3300014325 Ga0163163_10029770 Ga0163163_100297705 297
75 3300014326 Ga0157380_10478839 Ga0157380_104788392 297
76 3300014968 Ga0157379_10061777 Ga0157379_100617773 297
77 3300014969 Ga0157376_10151848 Ga0157376_101518482 297
78 3300014969 Ga0157376_10215812 Ga0157376_102158122 297
79 3300017792 Ga0163161_10344441 Ga0163161_103444412 297
80 3300025245 Ga0207425_1000645 Ga0207425_10006453 297
81 3300025258 Ga0209129_1000158 Ga0209129_100015861 297
82 3300025295 Ga0209564_1000282 Ga0209564_100028261 297
83 3300025297 Ga0209758_1000630 Ga0209758_10006307 297
84 3300025907 Ga0207645_10019699 Ga0207645_100196993 297
85 3300025923 Ga0207681_10068400 Ga0207681_100684003 297
86 3300025923 Ga0207681_10163219 Ga0207681_101632192 297
87 3300025925 Ga0207650_10130247 Ga0207650_101302473 297
88 3300025926 Ga0207659_10089966 Ga0207659_100899663 297
89 3300025931 Ga0207644_10131865 Ga0207644_101318651 297
90 3300025933 Ga0207706_10305617 Ga0207706_103056172 297
91 3300025940 Ga0207691_10381145 Ga0207691_103811452 297
92 3300025945 Ga0207679_10338933 Ga0207679_103389332 297
93 3300025960 Ga0207651_10000489 Ga0207651_1000048917 297
94 3300025981 Ga0207640_10105533 Ga0207640_101055332 297
95 3300025986 Ga0207658_10540790 Ga0207658_105407901 297
96 3300026035 Ga0207703_10047851 Ga0207703_100478512 297
97 3300026067 Ga0207678_10115258 Ga0207678_101152582 297
98 3300026095 Ga0207676_10128234 Ga0207676_101282343 297
99 3300026118 Ga0207675_100197882 Ga0207675_1001978822 297
100 3300026121 Ga0207683_10003848 Ga0207683_100038483 297
101 3300033179 Ga0307507_10183739 Ga0307507_101837392 297
102 3300046681 Ga0495647_0057070 Ga0495647_0057070_160_1080 297
103 3300046683 Ga0495658_0021167 Ga0495658_0021167_1615_2535 297
104 3300050507 nmdc:mga05p37_143415_c1 nmdc:mga05p37_143415_c1_1242_2168 297
105 3300006048 Ga0075363_100022515 Ga0075363_1000225153 298
106 3300006177 Ga0075362_10000222 Ga0075362_100002223 298
107 3300006178 Ga0075367_10037604 Ga0075367_100376043 298
108 3300006186 Ga0075369_10036217 Ga0075369_100362173 298
109 3300006353 Ga0075370_10015081 Ga0075370_100150812 298
110 3300031238 Ga0265332_10000006 Ga0265332_10000006249 298
111 3300031239 Ga0265328_10014789 Ga0265328_100147893 298
112 3300042012 Ga0439455_0022496 Ga0439455_0022496_232_1158 298
113 3300050496 nmdc:mga07m45_12786_c1 nmdc:mga07m45_12786_c1_2949_3893 298
114 3300031548 Ga0307408_100157002 Ga0307408_1001570022 299
115 3300032002 Ga0307416_100047868 Ga0307416_1000478683 299
116 3300049573 Ga0501037_0003806 Ga0501037_0003806_3598_4524 299
117 3300049574 Ga0501038_0113812 Ga0501038_0113812_1163_2089 299
118 3300049575 Ga0501039_0003932 Ga0501039_0003932_7396_8322 299
119 3300049576 Ga0501040_0079002 Ga0501040_0079002_1153_2079 299
120 3300049577 Ga0501041_0004135 Ga0501041_0004135_926_1852 299
121 3300049578 Ga0501042_0006414 Ga0501042_0006414_759_1685 299
122 3300049591 Ga0501075_0002497 Ga0501075_0002497_4521_5447 299
123 3300049592 Ga0501076_0002131 Ga0501076_0002131_5699_6625 299
124 3300049593 Ga0501077_0137181 Ga0501077_0137181_130_1056 299
125 3300049742 Ga0501080_0018160 Ga0501080_0018160_4841_5767 299
126 3300049743 Ga0501081_0000696 Ga0501081_0000696_7347_8273 299
127 3300049822 Ga0501035_0100607 Ga0501035_0100607_959_1885 299
128 3300053090 Ga0500646_0000869 Ga0500646_0000869_6234_7208 299
129 3300053151 Ga0500604_0000727 Ga0500604_0000727_913_1887 299
130 3300060353 Ga0501082_0000754 Ga0501082_0000754_7242_8168 299
131 3300030521 Ga0307511_10000653 Ga0307511_1000065331 300
132 iso_pu_bacteria 2585428057 2587725909 300
133 iso_pu_bacteria 2588253510 2588292878 300
134 iso_pu_bacteria 2643221592 2643967987 300
135 iso_pu_bacteria 2643221625 2644143113 300
136 iso_pu_bacteria 2643221644 2644247736 300
137 iso_pu_bacteria 2643221648 2644271799 300
138 3300005336 Ga0070680_100320804 Ga0070680_1003208041 301
139 3300005457 Ga0070662_100140588 Ga0070662_1001405882 301
140 3300005458 Ga0070681_10134930 Ga0070681_101349304 301
141 3300005535 Ga0070684_100498925 Ga0070684_1004989252 301
142 3300005563 Ga0068855_100035868 Ga0068855_1000358685 301
143 3300005577 Ga0068857_100006660 Ga0068857_10000666012 301
144 3300005842 Ga0068858_100105956 Ga0068858_1001059564 301
145 3300009174 Ga0105241_10003948 Ga0105241_100039485 301
146 3300025911 Ga0207654_10008208 Ga0207654_100082085 301
147 3300025912 Ga0207707_10117286 Ga0207707_101172862 301
148 3300025917 Ga0207660_10114646 Ga0207660_101146462 301
149 3300025949 Ga0207667_10028143 Ga0207667_100281438 301
150 3300026035 Ga0207703_10145801 Ga0207703_101458012 301
151 3300028381 Ga0268264_10352667 Ga0268264_103526672 301
152 3300005617 Ga0068859_100132537 Ga0068859_1001325374 302
153 3300005842 Ga0068858_100063048 Ga0068858_1000630482 302
154 3300006931 Ga0097620_100132541 Ga0097620_1001325414 302
155 3300026035 Ga0207703_10027828 Ga0207703_100278284 302
156 3300035695 Ga0373927_0033664 Ga0373927_0033664_2029_2937 302
157 3300005329 Ga0070683_100034749 Ga0070683_1000347495 303
158 3300005335 Ga0070666_10112381 Ga0070666_101123812 303
159 3300005338 Ga0068868_100005246 Ga0068868_1000052469 303
160 3300005344 Ga0070661_100044127 Ga0070661_1000441275 303
161 3300005353 Ga0070669_100297859 Ga0070669_1002978592 303
162 3300005354 Ga0070675_100030414 Ga0070675_1000304145 303
163 3300005364 Ga0070673_100048966 Ga0070673_1000489662 303
164 3300005364 Ga0070673_100086888 Ga0070673_1000868882 303
165 3300005365 Ga0070688_100014639 Ga0070688_1000146396 303
166 3300005367 Ga0070667_100373318 Ga0070667_1003733182 303
167 3300005438 Ga0070701_10032289 Ga0070701_100322893 303
168 3300005445 Ga0070708_100469597 Ga0070708_1004695972 303
169 3300005457 Ga0070662_100038615 Ga0070662_1000386155 303
170 3300005457 Ga0070662_100061865 Ga0070662_1000618654 303
171 3300005466 Ga0070685_10047294 Ga0070685_100472942 303
172 3300005467 Ga0070706_100007046 Ga0070706_1000070467 303
173 3300005468 Ga0070707_100161029 Ga0070707_1001610293 303
174 3300005543 Ga0070672_100006073 Ga0070672_1000060737 303
175 3300005548 Ga0070665_100026651 Ga0070665_1000266512 303
176 3300005549 Ga0070704_100036448 Ga0070704_1000364484 303
177 3300005616 Ga0068852_100178137 Ga0068852_1001781372 303
178 3300005618 Ga0068864_100107777 Ga0068864_1001077774 303
179 3300005718 Ga0068866_10034618 Ga0068866_100346183 303
180 3300005842 Ga0068858_100028034 Ga0068858_1000280344 303
181 3300006173 Ga0070716_100004488 Ga0070716_1000044885 303
182 3300006237 Ga0097621_100261748 Ga0097621_1002617482 303
183 3300006358 Ga0068871_100066207 Ga0068871_1000662072 303
184 3300006881 Ga0068865_100036245 Ga0068865_1000362452 303
185 3300007265 Ga0099794_10012062 Ga0099794_100120622 303
186 3300009094 Ga0111539_10263957 Ga0111539_102639572 303
187 3300009101 Ga0105247_10144998 Ga0105247_101449982 303
188 3300009148 Ga0105243_10040470 Ga0105243_100404705 303
189 3300009148 Ga0105243_10101540 Ga0105243_101015403 303
190 3300009174 Ga0105241_10006603 Ga0105241_100066033 303
191 3300009551 Ga0105238_10013485 Ga0105238_100134856 303
192 3300013297 Ga0157378_10040438 Ga0157378_100404385 303
193 3300013307 Ga0157372_10329743 Ga0157372_103297432 303
194 3300013308 Ga0157375_10699154 Ga0157375_106991541 303
195 3300014325 Ga0163163_10405416 Ga0163163_104054161 303
196 3300014325 Ga0163163_10556325 Ga0163163_105563252 303
197 3300014968 Ga0157379_10023823 Ga0157379_100238235 303
198 3300017792 Ga0163161_10083159 Ga0163161_100831592 303
199 3300025893 Ga0207682_10002051 Ga0207682_100020517 303
200 3300025899 Ga0207642_10016791 Ga0207642_100167912 303
201 3300025901 Ga0207688_10004075 Ga0207688_100040755 303
202 3300025907 Ga0207645_10014310 Ga0207645_100143105 303
203 3300025925 Ga0207650_10053911 Ga0207650_100539115 303
204 3300025926 Ga0207659_10143128 Ga0207659_101431282 303
205 3300025933 Ga0207706_10022195 Ga0207706_100221953 303
206 3300025933 Ga0207706_10221364 Ga0207706_102213642 303
207 3300025934 Ga0207686_10077514 Ga0207686_100775142 303
208 3300025940 Ga0207691_10003129 Ga0207691_1000312911 303
209 3300025942 Ga0207689_10049766 Ga0207689_100497664 303
210 3300025945 Ga0207679_10162565 Ga0207679_101625652 303
211 3300025960 Ga0207651_10036899 Ga0207651_100368995 303
212 3300026067 Ga0207678_10070084 Ga0207678_100700843 303
213 3300026075 Ga0207708_10285724 Ga0207708_102857242 303
214 3300026088 Ga0207641_10037951 Ga0207641_100379515 303
215 3300026088 Ga0207641_10076735 Ga0207641_100767354 303
216 3300026089 Ga0207648_10017883 Ga0207648_100178832 303
217 3300026089 Ga0207648_10057476 Ga0207648_100574763 303
218 3300026089 Ga0207648_10093989 Ga0207648_100939892 303
219 3300026095 Ga0207676_10038339 Ga0207676_100383395 303
220 3300026116 Ga0207674_10025008 Ga0207674_100250085 303
221 3300026118 Ga0207675_100162699 Ga0207675_1001626992 303
222 3300026121 Ga0207683_10024424 Ga0207683_100244248 303
223 3300026121 Ga0207683_10025278 Ga0207683_100252785 303
224 3300026142 Ga0207698_10227613 Ga0207698_102276132 303
225 3300027360 Ga0209969_1007197 Ga0209969_10071972 303
226 3300027671 Ga0209588_1017153 Ga0209588_10171533 303
227 3300028381 Ga0268264_10014837 Ga0268264_100148372 303
228 3300028577 Ga0265318_10003181 Ga0265318_100031817 303
229 3300031235 Ga0265330_10017894 Ga0265330_100178944 303
230 3300031238 Ga0265332_10006768 Ga0265332_100067686 303
231 3300031239 Ga0265328_10005040 Ga0265328_100050405 303
232 3300031250 Ga0265331_10005912 Ga0265331_100059126 303
233 3300031250 Ga0265331_10022712 Ga0265331_100227122 303
234 3300031344 Ga0265316_10003730 Ga0265316_100037305 303
235 3300031711 Ga0265314_10003019 Ga0265314_1000301910 303
236 3300031711 Ga0265314_10043878 Ga0265314_100438785 303
237 3300044683 Ga0466965_0009563 Ga0466965_0009563_2878_3795 303
238 3300044684 Ga0466966_0018973 Ga0466966_0018973_3437_4354 303
239 3300044693 Ga0466961_0087899 Ga0466961_0087899_1020_1937 303
240 3300045051 Ga0451576_0156515 Ga0451576_0156515_131_1042 303
241 3300046528 Ga0495642_0050647 Ga0495642_0050647_150_1061 303
242 3300046537 Ga0495598_0012181 Ga0495598_0012181_517_1428 303
243 3300046683 Ga0495658_0008655 Ga0495658_0008655_3242_4153 303
244 3300048903 Ga0496100_0027113 Ga0496100_0027113_307_1218 303
245 3300048913 Ga0496110_0405563 Ga0496110_0405563_180_1091 303
246 3300048917 Ga0496114_0317999 Ga0496114_0317999_324_1235 303
247 3300048924 Ga0496121_0002479 Ga0496121_0002479_19744_20661 303
248 3300050511 nmdc:mga08y16_14875_c2 nmdc:mga08y16_14875_c2_3951_4862 303
249 3300061719 Ga0466962_0000421 Ga0466962_0000421_13657_14574 303
250 3300005327 Ga0070658_10208487 Ga0070658_102084873 304
251 3300005328 Ga0070676_10007256 Ga0070676_100072566 304
252 3300005328 Ga0070676_10255412 Ga0070676_102554121 304
253 3300005329 Ga0070683_100137153 Ga0070683_1001371533 304
254 3300005330 Ga0070690_100055099 Ga0070690_1000550992 304
255 3300005333 Ga0070677_10073012 Ga0070677_100730122 304
256 3300005333 Ga0070677_10151210 Ga0070677_101512102 304
257 3300005334 Ga0068869_100006173 Ga0068869_1000061733 304
258 3300005335 Ga0070666_10219901 Ga0070666_102199012 304
259 3300005336 Ga0070680_100040608 Ga0070680_1000406083 304
260 3300005338 Ga0068868_100014883 Ga0068868_1000148838 304
261 3300005339 Ga0070660_100135149 Ga0070660_1001351492 304
262 3300005343 Ga0070687_100058264 Ga0070687_1000582643 304
263 3300005344 Ga0070661_100250502 Ga0070661_1002505022 304
264 3300005347 Ga0070668_100020756 Ga0070668_1000207564 304
265 3300005353 Ga0070669_100011627 Ga0070669_1000116273 304
266 3300005354 Ga0070675_100026809 Ga0070675_1000268094 304
267 3300005354 Ga0070675_100056426 Ga0070675_1000564262 304
268 3300005354 Ga0070675_100144959 Ga0070675_1001449592 304
269 3300005355 Ga0070671_100001538 Ga0070671_10000153815 304
270 3300005355 Ga0070671_100136823 Ga0070671_1001368232 304
271 3300005355 Ga0070671_100261965 Ga0070671_1002619652 304
272 3300005356 Ga0070674_100134523 Ga0070674_1001345232 304
273 3300005366 Ga0070659_100107055 Ga0070659_1001070551 304
274 3300005367 Ga0070667_100014002 Ga0070667_1000140023 304
275 3300005456 Ga0070678_100154296 Ga0070678_1001542962 304
276 3300005457 Ga0070662_100047082 Ga0070662_1000470822 304
277 3300005457 Ga0070662_100226966 Ga0070662_1002269661 304
278 3300005459 Ga0068867_100469771 Ga0068867_1004697711 304
279 3300005543 Ga0070672_100012687 Ga0070672_1000126876 304
280 3300005543 Ga0070672_100142776 Ga0070672_1001427762 304
281 3300005544 Ga0070686_100112139 Ga0070686_1001121392 304
282 3300005563 Ga0068855_100083279 Ga0068855_1000832793 304
283 3300005564 Ga0070664_100144017 Ga0070664_1001440171 304
284 3300005577 Ga0068857_100368407 Ga0068857_1003684072 304
285 3300005614 Ga0068856_100028943 Ga0068856_1000289436 304
286 3300005614 Ga0068856_100086791 Ga0068856_1000867913 304
287 3300005616 Ga0068852_100038245 Ga0068852_1000382454 304
288 3300005616 Ga0068852_100210182 Ga0068852_1002101822 304
289 3300005617 Ga0068859_100121622 Ga0068859_1001216223 304
290 3300005618 Ga0068864_100015704 Ga0068864_1000157046 304
291 3300005719 Ga0068861_100012851 Ga0068861_1000128513 304
292 3300005719 Ga0068861_100023846 Ga0068861_1000238463 304
293 3300005834 Ga0068851_10029132 Ga0068851_100291323 304
294 3300005834 Ga0068851_10032278 Ga0068851_100322785 304
295 3300005834 Ga0068851_10033564 Ga0068851_100335643 304
296 3300005834 Ga0068851_10109141 Ga0068851_101091412 304
297 3300005842 Ga0068858_100028884 Ga0068858_1000288845 304
298 3300005843 Ga0068860_100024320 Ga0068860_1000243203 304
299 3300005843 Ga0068860_100226713 Ga0068860_1002267132 304
300 3300006237 Ga0097621_100101303 Ga0097621_1001013033 304
301 3300006237 Ga0097621_100135320 Ga0097621_1001353202 304
302 3300006237 Ga0097621_100253178 Ga0097621_1002531782 304
303 3300006237 Ga0097621_100280883 Ga0097621_1002808832 304
304 3300006358 Ga0068871_100020186 Ga0068871_1000201865 304
305 3300006358 Ga0068871_100053567 Ga0068871_1000535673 304
306 3300006358 Ga0068871_100178426 Ga0068871_1001784262 304
307 3300006881 Ga0068865_100029210 Ga0068865_1000292103 304
308 3300006931 Ga0097620_100121625 Ga0097620_1001216252 304
309 3300009098 Ga0105245_10131295 Ga0105245_101312952 304
310 3300009148 Ga0105243_10060370 Ga0105243_100603703 304
311 3300009176 Ga0105242_10101625 Ga0105242_101016252 304
312 3300009177 Ga0105248_10047282 Ga0105248_100472823 304
313 3300009551 Ga0105238_10003518 Ga0105238_100035185 304
314 3300009553 Ga0105249_10101206 Ga0105249_101012063 304
315 3300013102 Ga0157371_10122059 Ga0157371_101220593 304
316 3300013296 Ga0157374_10027924 Ga0157374_100279245 304
317 3300013296 Ga0157374_10263190 Ga0157374_102631902 304
318 3300013306 Ga0163162_10041723 Ga0163162_100417234 304
319 3300013306 Ga0163162_10525177 Ga0163162_105251772 304
320 3300013307 Ga0157372_10018316 Ga0157372_100183167 304
321 3300013308 Ga0157375_10025420 Ga0157375_100254201 304
322 3300013308 Ga0157375_10025469 Ga0157375_100254693 304
323 3300014326 Ga0157380_10032136 Ga0157380_100321363 304
324 3300014326 Ga0157380_10485663 Ga0157380_104856632 304
325 3300014745 Ga0157377_10006752 Ga0157377_100067523 304
326 3300014968 Ga0157379_10162939 Ga0157379_101629392 304
327 3300014969 Ga0157376_10018794 Ga0157376_100187943 304
328 3300014969 Ga0157376_10045026 Ga0157376_100450263 304
329 3300017792 Ga0163161_10011712 Ga0163161_100117122 304
330 3300017792 Ga0163161_10167152 Ga0163161_101671522 304
331 3300021384 Ga0213876_10065952 Ga0213876_100659523 304
332 3300025321 Ga0207656_10084165 Ga0207656_100841652 304
333 3300025893 Ga0207682_10037907 Ga0207682_100379073 304
334 3300025893 Ga0207682_10069187 Ga0207682_100691872 304
335 3300025893 Ga0207682_10137616 Ga0207682_101376162 304
336 3300025907 Ga0207645_10011438 Ga0207645_100114389 304
337 3300025907 Ga0207645_10252519 Ga0207645_102525191 304
338 3300025908 Ga0207643_10030995 Ga0207643_100309953 304
339 3300025909 Ga0207705_10213044 Ga0207705_102130442 304
340 3300025917 Ga0207660_10067331 Ga0207660_100673312 304
341 3300025920 Ga0207649_10085933 Ga0207649_100859333 304
342 3300025921 Ga0207652_10109760 Ga0207652_101097602 304
343 3300025923 Ga0207681_10003786 Ga0207681_100037866 304
344 3300025923 Ga0207681_10107862 Ga0207681_101078623 304
345 3300025923 Ga0207681_10360772 Ga0207681_103607722 304
346 3300025924 Ga0207694_10140276 Ga0207694_101402762 304
347 3300025925 Ga0207650_10013932 Ga0207650_100139323 304
348 3300025925 Ga0207650_10116213 Ga0207650_101162133 304
349 3300025926 Ga0207659_10052955 Ga0207659_100529553 304
350 3300025926 Ga0207659_10092702 Ga0207659_100927023 304
351 3300025926 Ga0207659_10162463 Ga0207659_101624632 304
352 3300025927 Ga0207687_10100982 Ga0207687_101009822 304
353 3300025931 Ga0207644_10009771 Ga0207644_100097713 304
354 3300025931 Ga0207644_10222249 Ga0207644_102222492 304
355 3300025933 Ga0207706_10002668 Ga0207706_1000266813 304
356 3300025933 Ga0207706_10039197 Ga0207706_100391972 304
357 3300025934 Ga0207686_10018193 Ga0207686_100181934 304
358 3300025935 Ga0207709_10008638 Ga0207709_100086383 304
359 3300025937 Ga0207669_10012975 Ga0207669_100129753 304
360 3300025937 Ga0207669_10174888 Ga0207669_101748882 304
361 3300025938 Ga0207704_10003079 Ga0207704_100030793 304
362 3300025939 Ga0207665_10047695 Ga0207665_100476954 304
363 3300025940 Ga0207691_10000612 Ga0207691_100006122 304
364 3300025940 Ga0207691_10172788 Ga0207691_101727881 304
365 3300025941 Ga0207711_10122650 Ga0207711_101226502 304
366 3300025942 Ga0207689_10005225 Ga0207689_100052259 304
367 3300025942 Ga0207689_10006428 Ga0207689_100064289 304
368 3300025944 Ga0207661_10350277 Ga0207661_103502772 304
369 3300025945 Ga0207679_10089699 Ga0207679_100896993 304
370 3300025945 Ga0207679_10210253 Ga0207679_102102532 304
371 3300025960 Ga0207651_10045570 Ga0207651_100455703 304
372 3300025961 Ga0207712_10064682 Ga0207712_100646823 304
373 3300025972 Ga0207668_10026546 Ga0207668_100265463 304
374 3300025981 Ga0207640_10095834 Ga0207640_100958341 304
375 3300025986 Ga0207658_10002481 Ga0207658_1000248121 304
376 3300025986 Ga0207658_10154926 Ga0207658_101549263 304
377 3300026023 Ga0207677_10014782 Ga0207677_100147822 304
378 3300026023 Ga0207677_10199016 Ga0207677_101990162 304
379 3300026035 Ga0207703_10002613 Ga0207703_1000261316 304
380 3300026035 Ga0207703_10006418 Ga0207703_100064183 304
381 3300026041 Ga0207639_10148138 Ga0207639_101481382 304
382 3300026078 Ga0207702_10205850 Ga0207702_102058502 304
383 3300026089 Ga0207648_10078189 Ga0207648_100781893 304
384 3300026116 Ga0207674_10086172 Ga0207674_100861723 304
385 3300026118 Ga0207675_100003397 Ga0207675_1000033973 304
386 3300026118 Ga0207675_100032838 Ga0207675_1000328384 304
387 3300026142 Ga0207698_10024234 Ga0207698_100242343 304
388 3300026142 Ga0207698_10045989 Ga0207698_100459893 304
389 3300028381 Ga0268264_10002070 Ga0268264_100020706 304
390 3300031548 Ga0307408_100050016 Ga0307408_1000500163 304
391 3300031731 Ga0307405_10032089 Ga0307405_100320893 304
392 3300031731 Ga0307405_10075710 Ga0307405_100757102 304
393 3300031824 Ga0307413_10098085 Ga0307413_100980852 304
394 3300031901 Ga0307406_10039274 Ga0307406_100392743 304
395 3300031911 Ga0307412_10020585 Ga0307412_100205853 304
396 3300031911 Ga0307412_10187815 Ga0307412_101878152 304
397 3300031995 Ga0307409_100000577 Ga0307409_1000005777 304
398 3300031995 Ga0307409_100002540 Ga0307409_1000025403 304
399 3300032002 Ga0307416_100002818 Ga0307416_1000028184 304
400 3300032002 Ga0307416_100044859 Ga0307416_1000448593 304
401 3300032005 Ga0307411_10018344 Ga0307411_100183444 304
402 3300032126 Ga0307415_100006508 Ga0307415_1000065083 304
403 3300032126 Ga0307415_100085923 Ga0307415_1000859232 304
404 3300034820 Ga0373959_0007456 Ga0373959_0007456_831_1751 304
405 3300035115 Ga0373941_0019332 Ga0373941_0019332_240_1160 304
406 3300035116 Ga0373945_0106511 Ga0373945_0106511_46_966 304
407 3300035170 Ga0373943_0042059 Ga0373943_0042059_1264_2184 304
408 3300035242 Ga0373962_0008890 Ga0373962_0008890_835_1755 304
409 3300036401 Ga0373937_0135845 Ga0373937_0135845_843_1763 304
410 3300037068 Ga0373925_0182611 Ga0373925_0182611_671_1591 304
411 3300039437 Ga0436365_1691899 Ga0436365_1691899_825_1745 304
412 3300046472 Ga0495580_0186785 Ga0495580_0186785_176_1096 304
413 3300046537 Ga0495598_0062177 Ga0495598_0062177_46_966 304
414 3300046543 Ga0495645_0020885 Ga0495645_0020885_3155_4075 304
415 3300046675 Ga0495657_0072554 Ga0495657_0072554_981_1901 304
416 3300046689 Ga0495613_0128053 Ga0495613_0128053_516_1436 304
417 3300048904 Ga0496101_0030214 Ga0496101_0030214_2171_3091 304
418 3300048907 Ga0496104_0061232 Ga0496104_0061232_2536_3456 304
419 3300048908 Ga0496105_0125301 Ga0496105_0125301_645_1565 304
420 3300048910 Ga0496107_0104654 Ga0496107_0104654_413_1333 304
421 3300048911 Ga0496108_0142882 Ga0496108_0142882_777_1697 304
422 3300048917 Ga0496114_0234041 Ga0496114_0234041_336_1256 304
423 3300049515 Ga0501292_001319 Ga0501292_001319_596_1516 304
424 3300053077 Ga0495601_0054774 Ga0495601_0054774_1092_2012 304
425 3300053086 Ga0500578_0105274 Ga0500578_0105274_551_1471 304
426 3300053730 Ga0500645_001196 Ga0500645_001196_11597_12517 304
427 3300006847 Ga0075431_100000817 Ga0075431_1000008178 305
428 3300006880 Ga0075429_100003041 Ga0075429_10000304113 305
429 3300013296 Ga0157374_10083444 Ga0157374_100834443 305
430 3300013306 Ga0163162_10027068 Ga0163162_100270683 305
431 3300014969 Ga0157376_10011011 Ga0157376_100110115 305
432 3300044712 Ga0453684_0033105 Ga0453684_0033105_6252_7175 305
433 3300048912 Ga0496109_0110004 Ga0496109_0110004_736_1653 305
434 3300042876 Ga0451577_0023827 Ga0451577_0023827_3595_4545 306
435 3300049568 Ga0501031_0019753 Ga0501031_0019753_609_1553 306
436 3300049569 Ga0501032_0048570 Ga0501032_0048570_881_1831 306
437 3300049570 Ga0501033_0002339 Ga0501033_0002339_11099_12049 306
438 3300049581 Ga0501047_0000477 Ga0501047_0000477_23375_24325 306
439 3300049822 Ga0501035_0004651 Ga0501035_0004651_3756_4706 306
440 3300049823 Ga0501044_0000987 Ga0501044_0000987_29955_30905 306
441 3300050491 nmdc:mga00v17_8359_c1 nmdc:mga00v17_8359_c1_958_1914 306
442 iso_pu_bacteria 2511231003 2511247467 306
443 iso_pu_bacteria 2548876994 2550696671 306
444 iso_pu_bacteria 2818991445 2819594338 306
445 iso_pu_bacteria 2884811622 2884811943 306
446 iso_pu_bacteria 2884836552 2884840735 306
447 iso_pu_bacteria 2884852848 2884857669 306
448 iso_pu_bacteria 2896154374 2896158609 306
449 3300014969 Ga0157376_10277505 Ga0157376_102775052 307
450 3300002704 JGI25155J39150_1000860 JGI25155J39150_10008602 310
451 3300002705 JGI25156J39149_1004273 JGI25156J39149_10042732 310
452 3300002738 JGI25154J39366_1000267 JGI25154J39366_10002672 310
453 3300005337 Ga0070682_100001863 Ga0070682_10000186310 310
454 3300005339 Ga0070660_100001978 Ga0070660_10000197818 310
455 3300005344 Ga0070661_100024519 Ga0070661_1000245194 310
456 3300005366 Ga0070659_100001966 Ga0070659_1000019669 310
457 3300005563 Ga0068855_100138140 Ga0068855_1001381402 310
458 3300005564 Ga0070664_100005596 Ga0070664_1000055964 310
459 3300005616 Ga0068852_100007873 Ga0068852_1000078732 310
460 3300006038 Ga0075365_10106431 Ga0075365_101064311 310
461 3300006195 Ga0075366_10048007 Ga0075366_100480073 310
462 3300010375 Ga0105239_10391261 Ga0105239_103912612 310
463 3300025206 Ga0209435_100137 Ga0209435_1001377 310
464 3300025233 Ga0209437_100081 Ga0209437_100081241 310
465 3300025246 Ga0209646_1000290 Ga0209646_100029035 310
466 3300025250 Ga0209026_1002521 Ga0209026_10025212 310
467 3300025256 Ga0209759_1000485 Ga0209759_10004858 310
468 3300025913 Ga0207695_10036426 Ga0207695_100364264 310
469 3300025919 Ga0207657_10001495 Ga0207657_1000149516 310
470 3300025920 Ga0207649_10010050 Ga0207649_100100503 310
471 3300025932 Ga0207690_10000959 Ga0207690_1000095930 310
472 3300025945 Ga0207679_10009097 Ga0207679_100090978 310
473 3300025949 Ga0207667_10049848 Ga0207667_100498482 310
474 3300037312 Ga0395899_0002882 Ga0395899_0002882_6439_7371 310
475 3300037312 Ga0395899_0003628 Ga0395899_0003628_8445_9377 310
476 3300037418 Ga0395900_0022527 Ga0395900_0022527_226_1158 310
477 3300037466 Ga0395898_0006001 Ga0395898_0006001_3133_4065 310
478 3300037471 Ga0395905_0000549 Ga0395905_0000549_16323_17255 310
479 3300037471 Ga0395905_0006051 Ga0395905_0006051_7271_8203 310
480 3300037471 Ga0395905_0306319 Ga0395905_0306319_479_1411 310
481 3300038443 Ga0395901_0038998 Ga0395901_0038998_567_1499 310
482 3300042001 Ga0439441_017807 Ga0439441_017807_102_1034 310
483 3300044658 Ga0466972_0000140 Ga0466972_0000140_49598_50530 310
484 3300044658 Ga0466972_0018698 Ga0466972_0018698_871_1803 310
485 3300044658 Ga0466972_0032616 Ga0466972_0032616_488_1420 310
486 3300044683 Ga0466965_0000818 Ga0466965_0000818_900_1832 310
487 3300044683 Ga0466965_0096169 Ga0466965_0096169_554_1486 310
488 3300044684 Ga0466966_0021631 Ga0466966_0021631_1875_2807 310
489 3300044735 Ga0466968_0010668 Ga0466968_0010668_2392_3324 310
490 3300044735 Ga0466968_0044342 Ga0466968_0044342_659_1591 310
491 3300044765 Ga0466970_0040382 Ga0466970_0040382_53_985 310
492 3300045049 Ga0466959_0229485 Ga0466959_0229485_266_1198 310
493 3300046528 Ga0495642_0041153 Ga0495642_0041153_909_1841 310
494 3300046539 Ga0495621_0015334 Ga0495621_0015334_878_1810 310
495 3300047443 Ga0495687_026256 Ga0495687_026256_329_1261 310
496 3300048903 Ga0496100_0356114 Ga0496100_0356114_19_951 310
497 3300048905 Ga0496102_0388129 Ga0496102_0388129_189_1121 310
498 3300048906 Ga0496103_0034885 Ga0496103_0034885_940_1872 310
499 3300048907 Ga0496104_0231159 Ga0496104_0231159_683_1615 310
500 3300048908 Ga0496105_0025340 Ga0496105_0025340_3416_4348 310
501 3300048909 Ga0496106_0044158 Ga0496106_0044158_628_1560 310
502 3300048911 Ga0496108_0034865 Ga0496108_0034865_2079_3011 310
503 3300048912 Ga0496109_0194210 Ga0496109_0194210_824_1756 310
504 3300048913 Ga0496110_0129671 Ga0496110_0129671_474_1406 310
505 3300048914 Ga0496111_0010469 Ga0496111_0010469_1512_2444 310
506 3300048924 Ga0496121_0095272 Ga0496121_0095272_843_1775 310
507 3300048925 Ga0496122_0000968 Ga0496122_0000968_11179_12111 310
508 3300048926 Ga0496123_0004825 Ga0496123_0004825_9056_9988 310
509 3300048928 Ga0496125_0003499 Ga0496125_0003499_5657_6589 310
510 3300048928 Ga0496125_0027904 Ga0496125_0027904_962_1894 310
511 3300049571 Ga0501034_0143198 Ga0501034_0143198_1338_2270 310
512 iso_pu_bacteria 2643221603 2644026952 310
513 3300046507 Ga0495606_0004241 Ga0495606_0004241_1581_2516 311
514 3300050508 nmdc:mga09592_24148_c1 nmdc:mga09592_24148_c1_2833_3768 311
515 3300050510 nmdc:mga06r32_4702_c1 nmdc:mga06r32_4702_c1_11054_11989 311
516 3300005564 Ga0070664_100000867 Ga0070664_1000008673 314
517 3300005564 Ga0070664_100111270 Ga0070664_1001112701 314
518 3300027866 Ga0209813_10036632 Ga0209813_100366322 314
519 3300050489 nmdc:mga03683_75369_c1 nmdc:mga03683_75369_c1_112_1092 314
520 3300050490 nmdc:mga03n38_173962_c1 nmdc:mga03n38_173962_c1_100_1080 314
521 3300050492 nmdc:mga0yw44_7154_c1 nmdc:mga0yw44_7154_c1_2402_3382 314
522 3300050493 nmdc:mga0k408_24801_c1 nmdc:mga0k408_24801_c1_985_1965 314
523 3300050494 nmdc:mga06z11_32248_c1 nmdc:mga06z11_32248_c1_1431_2411 314
524 3300037418 Ga0395900_0075864 Ga0395900_0075864_221_1258 315
525 3300037471 Ga0395905_0001839 Ga0395905_0001839_21417_22454 315
526 3300038443 Ga0395901_0542918 Ga0395901_0542918_49_1032 315
527 3300006051 Ga0075364_10003430 Ga0075364_100034304 316
528 3300053125 Ga0500618_012093 Ga0500618_012093_340_1338 316
529 3300046522 Ga0495643_0045162 Ga0495643_0045162_628_1671 317
530 3300046528 Ga0495642_0006014 Ga0495642_0006014_913_1956 317
531 3300046616 Ga0495668_0165523 Ga0495668_0165523_40_1083 317
532 3300046665 Ga0495661_0001479 Ga0495661_0001479_10654_11697 317
533 3300002704 JGI25155J39150_1000170 JGI25155J39150_10001702 320
534 3300002705 JGI25156J39149_1000293 JGI25156J39149_100029332 320
535 3300002738 JGI25154J39366_1000260 JGI25154J39366_100026032 320
536 3300002741 JGI25157J39369_1000327 JGI25157J39369_100032732 320
537 3300003758 Ga0055532_1000184 Ga0055532_100018432 320
538 3300003761 Ga0055535_1015487 Ga0055535_10154871 320
539 3300005614 Ga0068856_100092712 Ga0068856_1000927122 320
540 3300009093 Ga0105240_10001692 Ga0105240_100016924 320
541 3300009551 Ga0105238_10054933 Ga0105238_100549334 320
542 3300025206 Ga0209435_100079 Ga0209435_10007937 320
543 3300025229 Ga0209147_100060 Ga0209147_100060210 320
544 3300025242 Ga0209258_100141 Ga0209258_10014126 320
545 3300025246 Ga0209646_1000265 Ga0209646_100026528 320
546 3300025250 Ga0209026_1000330 Ga0209026_100033028 320
547 3300025256 Ga0209759_1000473 Ga0209759_100047316 320
548 3300026078 Ga0207702_10080387 Ga0207702_100803872 320
549 3300046660 Ga0495625_0009260 Ga0495625_0009260_1696_2841 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

65

209

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

111

238

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9388 15 234
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9372 16 241
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9337 13 234
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.933 15 237
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9317 16 228
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9683 17 241 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9663 12 241 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 15 241 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9644 15 242 3.40.50.300
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 10 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9776 15 200 GO:0005524
GO:0016887
AF-A0A7S1AQ71-F1-model_v4 ABC transporter domain-containing protein 0.9723 17 162 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A2W7B2T3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9711 15 224 GO:0005524
GO:0016887
AF-A0A0D1P4L1-F1-model_v4 deleted 0.9639 11 241
AF-A0A1L8R8A0-F1-model_v4 Quaternary amine transport ATP-binding protein (EC 7.6.2.9) 0.9615 15 241 GO:0005524
GO:0005886
GO:0006865
GO:0016887
GO:0031460

Feature Viewer

pLDDT pTM Quality
89.43 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map