F462335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 549 | 318 | 535 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100092712|Ga0068856_1000927122 |
| Length | 349 |
| Sequence | MVEPLAASFRSGIDAMPGATNQHANMPTTMVRPRGARDDMTEQSILSVSKLHKAFGAGEQRVAIINDLSFALRPGECYGLLGPNGAGKTTTLRLCLGLATPDSGEIRLGGKVIPDQARAARKRVGVVPQADNLDPDFTVQENLLVFARYFGITDATMAQRIPELLEFANLTAKKDARIAELSGGMKRRLTLARALVNDPDLIFMDEPTTGLDPQARHMIWERLKNLLARGKTILLTTHFMDEAERLCDRLAVIDHGKMIAEGSPPDLIAQHIEAEVLEIYGENARSWAEQHGRSHASRVEYSGETVFCYTNDAQALLATLQHVQGVRYMHRPANLEDLFLKLTGREMRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 7 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 11 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 12 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 13 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 14 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 15 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 16 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 223 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 227 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 295 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 308 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 309 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 310 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.45 |
| Metatranscriptomes | 0 |
| Isolates | 2.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.38 |
| Nodule | 0.36 |
| Rhizoplane | 5.1 |
| Rhizosphere | 79.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000170 | 3300002704 | Bacteria | 28479 |
| 2 | JGI25155J39150_1000860 | 3300002704 | Bacteria | 4435 |
| 3 | JGI25156J39149_1000293 | 3300002705 | Bacteria | 33788 |
| 4 | JGI25156J39149_1004273 | 3300002705 | Bacteria | 4399 |
| 5 | JGI25154J39366_1000260 | 3300002738 | Bacteria | 33788 |
| 6 | JGI25154J39366_1000267 | 3300002738 | Bacteria | 32817 |
| 7 | JGI25157J39369_1000327 | 3300002741 | Bacteria | 33804 |
| 8 | JGI25152J39213_1006758 | 3300002773 | Bacteria | 3054 |
| 9 | JGI25153J46596_10009991 | 3300003215 | Bacteria | 4336 |
| 10 | Ga0055532_1000184 | 3300003758 | Bacteria | 52595 |
| 11 | Ga0055535_1015487 | 3300003761 | Bacteria | 1067 |
| 12 | Ga0055526_1000791 | 3300003771 | Bacteria | 23567 |
| 13 | Ga0055530_10005420 | 3300003791 | Bacteria | 6074 |
| 14 | Ga0065165_1001259 | 3300005262 | Bacteria | 28658 |
| 15 | Ga0070658_10208487 | 3300005327 | Bacteria | 1650 |
| 16 | Ga0070676_10007256 | 3300005328 | Bacteria | 5944 |
| 17 | Ga0070676_10255412 | 3300005328 | Bacteria | 1171 |
| 18 | Ga0070683_100034749 | 3300005329 | Bacteria | 4606 |
| 19 | Ga0070683_100137153 | 3300005329 | Bacteria | 2317 |
| 20 | Ga0070690_100055099 | 3300005330 | Bacteria | 2546 |
| 21 | Ga0070670_100174279 | 3300005331 | Bacteria | 1866 |
| 22 | Ga0070677_10073012 | 3300005333 | Bacteria | 1448 |
| 23 | Ga0070677_10151210 | 3300005333 | Bacteria | 1080 |
| 24 | Ga0068869_100006173 | 3300005334 | Bacteria | 7585 |
| 25 | Ga0070666_10112381 | 3300005335 | Bacteria | 1884 |
| 26 | Ga0070666_10219901 | 3300005335 | Bacteria | 1339 |
| 27 | Ga0070680_100040608 | 3300005336 | Bacteria | 3768 |
| 28 | Ga0070680_100320804 | 3300005336 | Bacteria | 1315 |
| 29 | Ga0070682_100001863 | 3300005337 | Bacteria | 11766 |
| 30 | Ga0068868_100005246 | 3300005338 | Bacteria | 9095 |
| 31 | Ga0068868_100014883 | 3300005338 | Bacteria | 5742 |
| 32 | Ga0068868_100261501 | 3300005338 | Bacteria | 1459 |
| 33 | Ga0070660_100001978 | 3300005339 | Bacteria | 14153 |
| 34 | Ga0070660_100135149 | 3300005339 | Bacteria | 1975 |
| 35 | Ga0070687_100058264 | 3300005343 | Bacteria | 2028 |
| 36 | Ga0070661_100024519 | 3300005344 | Bacteria | 4326 |
| 37 | Ga0070661_100044127 | 3300005344 | Bacteria | 3257 |
| 38 | Ga0070661_100250502 | 3300005344 | Bacteria | 1366 |
| 39 | Ga0070668_100020756 | 3300005347 | Bacteria | 4961 |
| 40 | Ga0070668_100092505 | 3300005347 | Bacteria | 2385 |
| 41 | Ga0070669_100011627 | 3300005353 | Bacteria | 6244 |
| 42 | Ga0070669_100297859 | 3300005353 | Bacteria | 1296 |
| 43 | Ga0070675_100026809 | 3300005354 | Bacteria | 4625 |
| 44 | Ga0070675_100030414 | 3300005354 | Bacteria | 4360 |
| 45 | Ga0070675_100056426 | 3300005354 | Bacteria | 3237 |
| 46 | Ga0070675_100082190 | 3300005354 | Bacteria | 2687 |
| 47 | Ga0070675_100144959 | 3300005354 | Bacteria | 2032 |
| 48 | Ga0070671_100001538 | 3300005355 | Bacteria | 17332 |
| 49 | Ga0070671_100136823 | 3300005355 | Bacteria | 2065 |
| 50 | Ga0070671_100261965 | 3300005355 | Bacteria | 1469 |
| 51 | Ga0070674_100134523 | 3300005356 | Bacteria | 1848 |
| 52 | Ga0070673_100038828 | 3300005364 | Bacteria | 3639 |
| 53 | Ga0070673_100048966 | 3300005364 | Bacteria | 3298 |
| 54 | Ga0070673_100086888 | 3300005364 | Bacteria | 2548 |
| 55 | Ga0070673_100277950 | 3300005364 | Bacteria | 1468 |
| 56 | Ga0070688_100014639 | 3300005365 | Bacteria | 4447 |
| 57 | Ga0070659_100001966 | 3300005366 | Bacteria | 14673 |
| 58 | Ga0070659_100107055 | 3300005366 | Bacteria | 2254 |
| 59 | Ga0070667_100014002 | 3300005367 | Bacteria | 6629 |
| 60 | Ga0070667_100373318 | 3300005367 | Bacteria | 1294 |
| 61 | Ga0070701_10032289 | 3300005438 | Bacteria | 2606 |
| 62 | Ga0070708_100469597 | 3300005445 | Bacteria | 1187 |
| 63 | Ga0070678_100119933 | 3300005456 | Bacteria | 2072 |
| 64 | Ga0070678_100154296 | 3300005456 | Bacteria | 1853 |
| 65 | Ga0070662_100038615 | 3300005457 | Bacteria | 3392 |
| 66 | Ga0070662_100047082 | 3300005457 | Bacteria | 3100 |
| 67 | Ga0070662_100059013 | 3300005457 | Bacteria | 2794 |
| 68 | Ga0070662_100061865 | 3300005457 | Bacteria | 2734 |
| 69 | Ga0070662_100140588 | 3300005457 | Bacteria | 1870 |
| 70 | Ga0070662_100226966 | 3300005457 | Bacteria | 1492 |
| 71 | Ga0070681_10134930 | 3300005458 | Bacteria | 2399 |
| 72 | Ga0068867_100043708 | 3300005459 | Bacteria | 3280 |
| 73 | Ga0068867_100469771 | 3300005459 | Bacteria | 1075 |
| 74 | Ga0070685_10047294 | 3300005466 | Bacteria | 2473 |
| 75 | Ga0070706_100007046 | 3300005467 | Bacteria | 10598 |
| 76 | Ga0070707_100161029 | 3300005468 | Bacteria | 2187 |
| 77 | Ga0070684_100498925 | 3300005535 | Bacteria | 1127 |
| 78 | Ga0070672_100006073 | 3300005543 | Bacteria | 8073 |
| 79 | Ga0070672_100012687 | 3300005543 | Bacteria | 5930 |
| 80 | Ga0070672_100142776 | 3300005543 | Bacteria | 1976 |
| 81 | Ga0070672_100407876 | 3300005543 | Bacteria | 1165 |
| 82 | Ga0070686_100112139 | 3300005544 | Bacteria | 1860 |
| 83 | Ga0070665_100026651 | 3300005548 | Bacteria | 5820 |
| 84 | Ga0070704_100036448 | 3300005549 | Bacteria | 3352 |
| 85 | Ga0068855_100035868 | 3300005563 | Bacteria | 5906 |
| 86 | Ga0068855_100083279 | 3300005563 | Bacteria | 3705 |
| 87 | Ga0068855_100138140 | 3300005563 | Bacteria | 2779 |
| 88 | Ga0070664_100000867 | 3300005564 | Bacteria | 23390 |
| 89 | Ga0070664_100005596 | 3300005564 | Bacteria | 10100 |
| 90 | Ga0070664_100111270 | 3300005564 | Bacteria | 2390 |
| 91 | Ga0070664_100144017 | 3300005564 | Bacteria | 2100 |
| 92 | Ga0068857_100006660 | 3300005577 | Bacteria | 9926 |
| 93 | Ga0068857_100368407 | 3300005577 | Bacteria | 1333 |
| 94 | Ga0068854_100073461 | 3300005578 | Bacteria | 2506 |
| 95 | Ga0068856_100028943 | 3300005614 | Bacteria | 5413 |
| 96 | Ga0068856_100086791 | 3300005614 | Bacteria | 3110 |
| 97 | Ga0068856_100092712 | 3300005614 | Bacteria | 3006 |
| 98 | Ga0068852_100007873 | 3300005616 | Bacteria | 7803 |
| 99 | Ga0068852_100038245 | 3300005616 | Bacteria | 4031 |
| 100 | Ga0068852_100132697 | 3300005616 | Bacteria | 2295 |
| 101 | Ga0068852_100178137 | 3300005616 | Bacteria | 1997 |
| 102 | Ga0068852_100210182 | 3300005616 | Bacteria | 1845 |
| 103 | Ga0068859_100008419 | 3300005617 | Bacteria | 10445 |
| 104 | Ga0068859_100121622 | 3300005617 | Bacteria | 2677 |
| 105 | Ga0068859_100132537 | 3300005617 | Bacteria | 2564 |
| 106 | Ga0068864_100000633 | 3300005618 | Bacteria | 29494 |
| 107 | Ga0068864_100015704 | 3300005618 | Bacteria | 6297 |
| 108 | Ga0068864_100107777 | 3300005618 | Bacteria | 2478 |
| 109 | Ga0068866_10034618 | 3300005718 | Bacteria | 2461 |
| 110 | Ga0068861_100012851 | 3300005719 | Bacteria | 5847 |
| 111 | Ga0068861_100023846 | 3300005719 | Bacteria | 4418 |
| 112 | Ga0068861_100052391 | 3300005719 | Bacteria | 3101 |
| 113 | Ga0068851_10029132 | 3300005834 | Bacteria | 2731 |
| 114 | Ga0068851_10032278 | 3300005834 | Bacteria | 2605 |
| 115 | Ga0068851_10033564 | 3300005834 | Bacteria | 2558 |
| 116 | Ga0068851_10109141 | 3300005834 | Bacteria | 1476 |
| 117 | Ga0068863_100050165 | 3300005841 | Bacteria | 3957 |
| 118 | Ga0068858_100028034 | 3300005842 | Bacteria | 5233 |
| 119 | Ga0068858_100028884 | 3300005842 | Bacteria | 5149 |
| 120 | Ga0068858_100063048 | 3300005842 | Bacteria | 3429 |
| 121 | Ga0068858_100099422 | 3300005842 | Bacteria | 2712 |
| 122 | Ga0068858_100105956 | 3300005842 | Bacteria | 2624 |
| 123 | Ga0068860_100024320 | 3300005843 | Bacteria | 5854 |
| 124 | Ga0068860_100226713 | 3300005843 | Bacteria | 1815 |
| 125 | Ga0068862_100022833 | 3300005844 | Bacteria | 5237 |
| 126 | Ga0075365_10106431 | 3300006038 | Bacteria | 1925 |
| 127 | Ga0075363_100022515 | 3300006048 | Bacteria | 3186 |
| 128 | Ga0075364_10003430 | 3300006051 | Bacteria | 9010 |
| 129 | Ga0070716_100004488 | 3300006173 | Bacteria | 6677 |
| 130 | Ga0075362_10000222 | 3300006177 | Bacteria | 15765 |
| 131 | Ga0075367_10037604 | 3300006178 | Bacteria | 2813 |
| 132 | Ga0075369_10036217 | 3300006186 | Bacteria | 2099 |
| 133 | Ga0075366_10048007 | 3300006195 | Bacteria | 2531 |
| 134 | Ga0075366_10070252 | 3300006195 | Bacteria | 2085 |
| 135 | Ga0097621_100101303 | 3300006237 | Bacteria | 2423 |
| 136 | Ga0097621_100135320 | 3300006237 | Bacteria | 2101 |
| 137 | Ga0097621_100200380 | 3300006237 | Bacteria | 1733 |
| 138 | Ga0097621_100253178 | 3300006237 | Bacteria | 1542 |
| 139 | Ga0097621_100261748 | 3300006237 | Bacteria | 1517 |
| 140 | Ga0097621_100280883 | 3300006237 | Bacteria | 1465 |
| 141 | Ga0075370_10015081 | 3300006353 | Bacteria | 4131 |
| 142 | Ga0068871_100020186 | 3300006358 | Bacteria | 5100 |
| 143 | Ga0068871_100053567 | 3300006358 | Bacteria | 3270 |
| 144 | Ga0068871_100066207 | 3300006358 | Bacteria | 2961 |
| 145 | Ga0068871_100178426 | 3300006358 | Bacteria | 1824 |
| 146 | Ga0075431_100000817 | 3300006847 | Bacteria | 27171 |
| 147 | Ga0075429_100003041 | 3300006880 | Bacteria | 14216 |
| 148 | Ga0068865_100029210 | 3300006881 | Bacteria | 3655 |
| 149 | Ga0068865_100036245 | 3300006881 | Bacteria | 3324 |
| 150 | Ga0097620_100008419 | 3300006931 | Bacteria | 10445 |
| 151 | Ga0097620_100121625 | 3300006931 | Bacteria | 2677 |
| 152 | Ga0097620_100132541 | 3300006931 | Bacteria | 2564 |
| 153 | Ga0099794_10012062 | 3300007265 | Bacteria | 3716 |
| 154 | Ga0105240_10001692 | 3300009093 | Bacteria | 37346 |
| 155 | Ga0111539_10263957 | 3300009094 | Bacteria | 2004 |
| 156 | Ga0105245_10131295 | 3300009098 | Bacteria | 2350 |
| 157 | Ga0105247_10144998 | 3300009101 | Bacteria | 1560 |
| 158 | Ga0105243_10040470 | 3300009148 | Bacteria | 3640 |
| 159 | Ga0105243_10060370 | 3300009148 | Bacteria | 3029 |
| 160 | Ga0105243_10101540 | 3300009148 | Bacteria | 2389 |
| 161 | Ga0105241_10003948 | 3300009174 | Bacteria | 10975 |
| 162 | Ga0105241_10006603 | 3300009174 | Bacteria | 8547 |
| 163 | Ga0105242_10101625 | 3300009176 | Bacteria | 2437 |
| 164 | Ga0105248_10047282 | 3300009177 | Bacteria | 4825 |
| 165 | Ga0105238_10003518 | 3300009551 | Bacteria | 15604 |
| 166 | Ga0105238_10013485 | 3300009551 | Bacteria | 8250 |
| 167 | Ga0105238_10054933 | 3300009551 | Bacteria | 3999 |
| 168 | Ga0105249_10045426 | 3300009553 | Bacteria | 3995 |
| 169 | Ga0105249_10101206 | 3300009553 | Bacteria | 2710 |
| 170 | Ga0105239_10391261 | 3300010375 | Bacteria | 1572 |
| 171 | Ga0157371_10122059 | 3300013102 | Bacteria | 1853 |
| 172 | Ga0157374_10003255 | 3300013296 | Bacteria | 13642 |
| 173 | Ga0157374_10027924 | 3300013296 | Bacteria | 5094 |
| 174 | Ga0157374_10083444 | 3300013296 | Bacteria | 3036 |
| 175 | Ga0157374_10263190 | 3300013296 | Bacteria | 1699 |
| 176 | Ga0157378_10040438 | 3300013297 | Bacteria | 4134 |
| 177 | Ga0157378_10066588 | 3300013297 | Bacteria | 3226 |
| 178 | Ga0163162_10027068 | 3300013306 | Bacteria | 5670 |
| 179 | Ga0163162_10041723 | 3300013306 | Bacteria | 4591 |
| 180 | Ga0163162_10525177 | 3300013306 | Bacteria | 1313 |
| 181 | Ga0157372_10018316 | 3300013307 | Bacteria | 7527 |
| 182 | Ga0157372_10329743 | 3300013307 | Bacteria | 1777 |
| 183 | Ga0157375_10025420 | 3300013308 | Bacteria | 5502 |
| 184 | Ga0157375_10025469 | 3300013308 | Bacteria | 5497 |
| 185 | Ga0157375_10436874 | 3300013308 | Bacteria | 1475 |
| 186 | Ga0157375_10438586 | 3300013308 | Bacteria | 1472 |
| 187 | Ga0157375_10699154 | 3300013308 | Bacteria | 1167 |
| 188 | Ga0163163_10029770 | 3300014325 | Bacteria | 5254 |
| 189 | Ga0163163_10405416 | 3300014325 | Bacteria | 1422 |
| 190 | Ga0163163_10556325 | 3300014325 | Bacteria | 1210 |
| 191 | Ga0157380_10032136 | 3300014326 | Bacteria | 4035 |
| 192 | Ga0157380_10478839 | 3300014326 | Bacteria | 1203 |
| 193 | Ga0157380_10485663 | 3300014326 | Bacteria | 1196 |
| 194 | Ga0157377_10006752 | 3300014745 | Bacteria | 5497 |
| 195 | Ga0157379_10023823 | 3300014968 | Bacteria | 5434 |
| 196 | Ga0157379_10061777 | 3300014968 | Bacteria | 3351 |
| 197 | Ga0157379_10162939 | 3300014968 | Bacteria | 2013 |
| 198 | Ga0157376_10011011 | 3300014969 | Bacteria | 6646 |
| 199 | Ga0157376_10018794 | 3300014969 | Bacteria | 5310 |
| 200 | Ga0157376_10045026 | 3300014969 | Bacteria | 3630 |
| 201 | Ga0157376_10151848 | 3300014969 | Bacteria | 2089 |
| 202 | Ga0157376_10215812 | 3300014969 | Bacteria | 1774 |
| 203 | Ga0157376_10277505 | 3300014969 | Bacteria | 1577 |
| 204 | Ga0163161_10011712 | 3300017792 | Bacteria | 6085 |
| 205 | Ga0163161_10083159 | 3300017792 | Bacteria | 2359 |
| 206 | Ga0163161_10167152 | 3300017792 | Bacteria | 1680 |
| 207 | Ga0163161_10344441 | 3300017792 | Bacteria | 1183 |
| 208 | Ga0213876_10065952 | 3300021384 | Bacteria | 1911 |
| 209 | Ga0209435_100079 | 3300025206 | Bacteria | 51612 |
| 210 | Ga0209435_100137 | 3300025206 | Bacteria | 24597 |
| 211 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 212 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 213 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 214 | Ga0207425_1000645 | 3300025245 | Bacteria | 19440 |
| 215 | Ga0209646_1000265 | 3300025246 | Bacteria | 50897 |
| 216 | Ga0209646_1000290 | 3300025246 | Bacteria | 42743 |
| 217 | Ga0209026_1000330 | 3300025250 | Bacteria | 47453 |
| 218 | Ga0209026_1002521 | 3300025250 | Bacteria | 6784 |
| 219 | Ga0209759_1000473 | 3300025256 | Bacteria | 44908 |
| 220 | Ga0209759_1000485 | 3300025256 | Bacteria | 43802 |
| 221 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 222 | Ga0209673_1002375 | 3300025273 | Bacteria | 13220 |
| 223 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 224 | Ga0209758_1000500 | 3300025297 | Bacteria | 63618 |
| 225 | Ga0209758_1000630 | 3300025297 | Bacteria | 54005 |
| 226 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 227 | Ga0207656_10061803 | 3300025321 | Bacteria | 1645 |
| 228 | Ga0207656_10084165 | 3300025321 | Bacteria | 1434 |
| 229 | Ga0207682_10002051 | 3300025893 | Bacteria | 9121 |
| 230 | Ga0207682_10037907 | 3300025893 | Bacteria | 1954 |
| 231 | Ga0207682_10069187 | 3300025893 | Bacteria | 1493 |
| 232 | Ga0207682_10137616 | 3300025893 | Bacteria | 1094 |
| 233 | Ga0207642_10016791 | 3300025899 | Bacteria | 2768 |
| 234 | Ga0207688_10004075 | 3300025901 | Bacteria | 7962 |
| 235 | Ga0207645_10011438 | 3300025907 | Bacteria | 6058 |
| 236 | Ga0207645_10014310 | 3300025907 | Bacteria | 5313 |
| 237 | Ga0207645_10019699 | 3300025907 | Bacteria | 4422 |
| 238 | Ga0207645_10252519 | 3300025907 | Bacteria | 1167 |
| 239 | Ga0207643_10030995 | 3300025908 | Bacteria | 2979 |
| 240 | Ga0207705_10213044 | 3300025909 | Bacteria | 1466 |
| 241 | Ga0207654_10008208 | 3300025911 | Bacteria | 5267 |
| 242 | Ga0207707_10117286 | 3300025912 | Bacteria | 2327 |
| 243 | Ga0207695_10036426 | 3300025913 | Bacteria | 5319 |
| 244 | Ga0207660_10067331 | 3300025917 | Bacteria | 2593 |
| 245 | Ga0207660_10114646 | 3300025917 | Bacteria | 2033 |
| 246 | Ga0207657_10001495 | 3300025919 | Bacteria | 25015 |
| 247 | Ga0207649_10010050 | 3300025920 | Bacteria | 5192 |
| 248 | Ga0207649_10085933 | 3300025920 | Bacteria | 2048 |
| 249 | Ga0207652_10109760 | 3300025921 | Bacteria | 2446 |
| 250 | Ga0207681_10003786 | 3300025923 | Bacteria | 9387 |
| 251 | Ga0207681_10068400 | 3300025923 | Bacteria | 2466 |
| 252 | Ga0207681_10107862 | 3300025923 | Bacteria | 2020 |
| 253 | Ga0207681_10163219 | 3300025923 | Bacteria | 1681 |
| 254 | Ga0207681_10360772 | 3300025923 | Bacteria | 1165 |
| 255 | Ga0207694_10140276 | 3300025924 | Bacteria | 1943 |
| 256 | Ga0207650_10013932 | 3300025925 | Bacteria | 5578 |
| 257 | Ga0207650_10053911 | 3300025925 | Bacteria | 2981 |
| 258 | Ga0207650_10116213 | 3300025925 | Bacteria | 2077 |
| 259 | Ga0207650_10130247 | 3300025925 | Bacteria | 1968 |
| 260 | Ga0207659_10052955 | 3300025926 | Bacteria | 2893 |
| 261 | Ga0207659_10089966 | 3300025926 | Bacteria | 2290 |
| 262 | Ga0207659_10092702 | 3300025926 | Bacteria | 2259 |
| 263 | Ga0207659_10143128 | 3300025926 | Bacteria | 1858 |
| 264 | Ga0207659_10162463 | 3300025926 | Bacteria | 1755 |
| 265 | Ga0207687_10100982 | 3300025927 | Bacteria | 2123 |
| 266 | Ga0207644_10009771 | 3300025931 | Bacteria | 6307 |
| 267 | Ga0207644_10131865 | 3300025931 | Bacteria | 1914 |
| 268 | Ga0207644_10222249 | 3300025931 | Bacteria | 1497 |
| 269 | Ga0207690_10000959 | 3300025932 | Bacteria | 18469 |
| 270 | Ga0207706_10002668 | 3300025933 | Bacteria | 17378 |
| 271 | Ga0207706_10022195 | 3300025933 | Bacteria | 5697 |
| 272 | Ga0207706_10039197 | 3300025933 | Bacteria | 4200 |
| 273 | Ga0207706_10221364 | 3300025933 | Bacteria | 1657 |
| 274 | Ga0207706_10305617 | 3300025933 | Bacteria | 1385 |
| 275 | Ga0207686_10018193 | 3300025934 | Bacteria | 3974 |
| 276 | Ga0207686_10077514 | 3300025934 | Bacteria | 2158 |
| 277 | Ga0207709_10008638 | 3300025935 | Bacteria | 5627 |
| 278 | Ga0207669_10012975 | 3300025937 | Bacteria | 4120 |
| 279 | Ga0207669_10174888 | 3300025937 | Bacteria | 1532 |
| 280 | Ga0207704_10003079 | 3300025938 | Bacteria | 7535 |
| 281 | Ga0207665_10047695 | 3300025939 | Bacteria | 2873 |
| 282 | Ga0207691_10000612 | 3300025940 | Bacteria | 35502 |
| 283 | Ga0207691_10003129 | 3300025940 | Bacteria | 16168 |
| 284 | Ga0207691_10172788 | 3300025940 | Bacteria | 1892 |
| 285 | Ga0207691_10381145 | 3300025940 | Bacteria | 1204 |
| 286 | Ga0207711_10122650 | 3300025941 | Bacteria | 2321 |
| 287 | Ga0207689_10005225 | 3300025942 | Bacteria | 11645 |
| 288 | Ga0207689_10006428 | 3300025942 | Bacteria | 10390 |
| 289 | Ga0207689_10049766 | 3300025942 | Bacteria | 3457 |
| 290 | Ga0207661_10350277 | 3300025944 | Bacteria | 1332 |
| 291 | Ga0207679_10009097 | 3300025945 | Bacteria | 6347 |
| 292 | Ga0207679_10089699 | 3300025945 | Bacteria | 2374 |
| 293 | Ga0207679_10162565 | 3300025945 | Bacteria | 1829 |
| 294 | Ga0207679_10210253 | 3300025945 | Bacteria | 1631 |
| 295 | Ga0207679_10338933 | 3300025945 | Bacteria | 1307 |
| 296 | Ga0207667_10028143 | 3300025949 | Bacteria | 6105 |
| 297 | Ga0207667_10049848 | 3300025949 | Bacteria | 4420 |
| 298 | Ga0207651_10000489 | 3300025960 | Bacteria | 16657 |
| 299 | Ga0207651_10036899 | 3300025960 | Bacteria | 3196 |
| 300 | Ga0207651_10045570 | 3300025960 | Bacteria | 2942 |
| 301 | Ga0207712_10064682 | 3300025961 | Bacteria | 2609 |
| 302 | Ga0207668_10026546 | 3300025972 | Bacteria | 3761 |
| 303 | Ga0207640_10095834 | 3300025981 | Bacteria | 2067 |
| 304 | Ga0207640_10105533 | 3300025981 | Bacteria | 1985 |
| 305 | Ga0207658_10002481 | 3300025986 | Bacteria | 13444 |
| 306 | Ga0207658_10154926 | 3300025986 | Bacteria | 1871 |
| 307 | Ga0207658_10540790 | 3300025986 | Bacteria | 1041 |
| 308 | Ga0207677_10014782 | 3300026023 | Bacteria | 4570 |
| 309 | Ga0207677_10199016 | 3300026023 | Bacteria | 1591 |
| 310 | Ga0207703_10002613 | 3300026035 | Bacteria | 15539 |
| 311 | Ga0207703_10006418 | 3300026035 | Bacteria | 9400 |
| 312 | Ga0207703_10027828 | 3300026035 | Bacteria | 4453 |
| 313 | Ga0207703_10047851 | 3300026035 | Bacteria | 3449 |
| 314 | Ga0207703_10145801 | 3300026035 | Bacteria | 2059 |
| 315 | Ga0207639_10148138 | 3300026041 | Bacteria | 1963 |
| 316 | Ga0207678_10070084 | 3300026067 | Bacteria | 3006 |
| 317 | Ga0207678_10115258 | 3300026067 | Bacteria | 2292 |
| 318 | Ga0207708_10014475 | 3300026075 | Bacteria | 5904 |
| 319 | Ga0207708_10285724 | 3300026075 | Bacteria | 1338 |
| 320 | Ga0207702_10080387 | 3300026078 | Bacteria | 2828 |
| 321 | Ga0207702_10205850 | 3300026078 | Bacteria | 1827 |
| 322 | Ga0207641_10037951 | 3300026088 | Bacteria | 4025 |
| 323 | Ga0207641_10076735 | 3300026088 | Bacteria | 2890 |
| 324 | Ga0207648_10017883 | 3300026089 | Bacteria | 6432 |
| 325 | Ga0207648_10038273 | 3300026089 | Bacteria | 4221 |
| 326 | Ga0207648_10057476 | 3300026089 | Bacteria | 3394 |
| 327 | Ga0207648_10078189 | 3300026089 | Bacteria | 2886 |
| 328 | Ga0207648_10093989 | 3300026089 | Bacteria | 2622 |
| 329 | Ga0207676_10038339 | 3300026095 | Bacteria | 3656 |
| 330 | Ga0207676_10128234 | 3300026095 | Bacteria | 2152 |
| 331 | Ga0207674_10025008 | 3300026116 | Bacteria | 6374 |
| 332 | Ga0207674_10086172 | 3300026116 | Bacteria | 3135 |
| 333 | Ga0207675_100003397 | 3300026118 | Bacteria | 15561 |
| 334 | Ga0207675_100032838 | 3300026118 | Bacteria | 4836 |
| 335 | Ga0207675_100162699 | 3300026118 | Bacteria | 2130 |
| 336 | Ga0207675_100197882 | 3300026118 | Bacteria | 1929 |
| 337 | Ga0207683_10003848 | 3300026121 | Bacteria | 13019 |
| 338 | Ga0207683_10024424 | 3300026121 | Bacteria | 5206 |
| 339 | Ga0207683_10025278 | 3300026121 | Bacteria | 5122 |
| 340 | Ga0207698_10024234 | 3300026142 | Bacteria | 4256 |
| 341 | Ga0207698_10045989 | 3300026142 | Bacteria | 3292 |
| 342 | Ga0207698_10227613 | 3300026142 | Bacteria | 1690 |
| 343 | Ga0209969_1007197 | 3300027360 | Bacteria | 1571 |
| 344 | Ga0209588_1017153 | 3300027671 | Bacteria | 2242 |
| 345 | Ga0209813_10036632 | 3300027866 | Bacteria | 1475 |
| 346 | Ga0268265_10118265 | 3300028380 | Bacteria | 2178 |
| 347 | Ga0268264_10002070 | 3300028381 | Bacteria | 17906 |
| 348 | Ga0268264_10014837 | 3300028381 | Bacteria | 6398 |
| 349 | Ga0268264_10352667 | 3300028381 | Bacteria | 1401 |
| 350 | Ga0265318_10003181 | 3300028577 | Bacteria | 8385 |
| 351 | Ga0307511_10000653 | 3300030521 | Bacteria | 37038 |
| 352 | Ga0265330_10017894 | 3300031235 | Bacteria | 3259 |
| 353 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 354 | Ga0265332_10006768 | 3300031238 | Bacteria | 5193 |
| 355 | Ga0265328_10005040 | 3300031239 | Bacteria | 5691 |
| 356 | Ga0265328_10014789 | 3300031239 | Bacteria | 3066 |
| 357 | Ga0265331_10005912 | 3300031250 | Bacteria | 7315 |
| 358 | Ga0265331_10022712 | 3300031250 | Bacteria | 3198 |
| 359 | Ga0265316_10003730 | 3300031344 | Bacteria | 15309 |
| 360 | Ga0307408_100050016 | 3300031548 | Bacteria | 3004 |
| 361 | Ga0307408_100157002 | 3300031548 | Bacteria | 1803 |
| 362 | Ga0265314_10003019 | 3300031711 | Bacteria | 16634 |
| 363 | Ga0265314_10043878 | 3300031711 | Bacteria | 3174 |
| 364 | Ga0307516_10020880 | 3300031730 | Bacteria | 6759 |
| 365 | Ga0307405_10032089 | 3300031731 | Bacteria | 3100 |
| 366 | Ga0307405_10075710 | 3300031731 | Bacteria | 2181 |
| 367 | Ga0307413_10098085 | 3300031824 | Bacteria | 1928 |
| 368 | Ga0307406_10039274 | 3300031901 | Bacteria | 2935 |
| 369 | Ga0307412_10020585 | 3300031911 | Bacteria | 4017 |
| 370 | Ga0307412_10187815 | 3300031911 | Bacteria | 1560 |
| 371 | Ga0307409_100000577 | 3300031995 | Bacteria | 15970 |
| 372 | Ga0307409_100002540 | 3300031995 | Bacteria | 9574 |
| 373 | Ga0307416_100002818 | 3300032002 | Bacteria | 10112 |
| 374 | Ga0307416_100044859 | 3300032002 | Bacteria | 3475 |
| 375 | Ga0307416_100047868 | 3300032002 | Bacteria | 3388 |
| 376 | Ga0307411_10018344 | 3300032005 | Bacteria | 4011 |
| 377 | Ga0307415_100006508 | 3300032126 | Bacteria | 6311 |
| 378 | Ga0307415_100085923 | 3300032126 | Bacteria | 2262 |
| 379 | Ga0307507_10183739 | 3300033179 | Bacteria | 1488 |
| 380 | Ga0373959_0007456 | 3300034820 | Bacteria | 1839 |
| 381 | Ga0373941_0019332 | 3300035115 | Bacteria | 1895 |
| 382 | Ga0373945_0106511 | 3300035116 | Bacteria | 1103 |
| 383 | Ga0373943_0042059 | 3300035170 | Bacteria | 2213 |
| 384 | Ga0373943_0119210 | 3300035170 | Bacteria | 1401 |
| 385 | Ga0373962_0008890 | 3300035242 | Bacteria | 2481 |
| 386 | Ga0373927_0033664 | 3300035695 | Bacteria | 3336 |
| 387 | Ga0373937_0135845 | 3300036401 | Bacteria | 2299 |
| 388 | Ga0373925_0182611 | 3300037068 | Bacteria | 1661 |
| 389 | Ga0395899_0002882 | 3300037312 | Bacteria | 13815 |
| 390 | Ga0395899_0003628 | 3300037312 | Bacteria | 12217 |
| 391 | Ga0395900_0022527 | 3300037418 | Bacteria | 6445 |
| 392 | Ga0395900_0075864 | 3300037418 | Bacteria | 3456 |
| 393 | Ga0395900_0253805 | 3300037418 | Bacteria | 1759 |
| 394 | Ga0395898_0006001 | 3300037466 | Bacteria | 13041 |
| 395 | Ga0395905_0000549 | 3300037471 | Bacteria | 51321 |
| 396 | Ga0395905_0001262 | 3300037471 | Bacteria | 31273 |
| 397 | Ga0395905_0001839 | 3300037471 | Bacteria | 24502 |
| 398 | Ga0395905_0003586 | 3300037471 | Bacteria | 16519 |
| 399 | Ga0395905_0006051 | 3300037471 | Bacteria | 12254 |
| 400 | Ga0395905_0015392 | 3300037471 | Bacteria | 7269 |
| 401 | Ga0395905_0306319 | 3300037471 | Bacteria | 1477 |
| 402 | Ga0395901_0038998 | 3300038443 | Bacteria | 4914 |
| 403 | Ga0395901_0542918 | 3300038443 | Bacteria | 1179 |
| 404 | Ga0436365_1691899 | 3300039437 | Bacteria | 2172 |
| 405 | Ga0451789_0590955 | 3300041443 | Bacteria | 2789 |
| 406 | Ga0451798_0468504 | 3300041458 | Bacteria | 2075 |
| 407 | Ga0451804_0553210 | 3300041463 | Bacteria | 5112 |
| 408 | Ga0439441_017807 | 3300042001 | Bacteria | 1280 |
| 409 | Ga0439455_0022496 | 3300042012 | Bacteria | 1511 |
| 410 | Ga0451577_0023827 | 3300042876 | Bacteria | 5575 |
| 411 | Ga0466972_0000140 | 3300044658 | Bacteria | 59505 |
| 412 | Ga0466972_0018698 | 3300044658 | Bacteria | 3465 |
| 413 | Ga0466972_0032616 | 3300044658 | Bacteria | 2557 |
| 414 | Ga0466965_0000818 | 3300044683 | Bacteria | 11733 |
| 415 | Ga0466965_0009563 | 3300044683 | Bacteria | 4507 |
| 416 | Ga0466965_0096169 | 3300044683 | Bacteria | 1511 |
| 417 | Ga0466966_0018973 | 3300044684 | Bacteria | 4532 |
| 418 | Ga0466966_0021631 | 3300044684 | Bacteria | 4223 |
| 419 | Ga0466961_0087899 | 3300044693 | Bacteria | 1963 |
| 420 | Ga0453684_0033105 | 3300044712 | Bacteria | 7212 |
| 421 | Ga0466968_0010668 | 3300044735 | Bacteria | 3567 |
| 422 | Ga0466968_0031187 | 3300044735 | Bacteria | 2210 |
| 423 | Ga0466968_0044342 | 3300044735 | Bacteria | 1884 |
| 424 | Ga0466970_0040382 | 3300044765 | Bacteria | 2478 |
| 425 | Ga0466959_0229485 | 3300045049 | Bacteria | 1285 |
| 426 | Ga0451576_0156515 | 3300045051 | Bacteria | 2377 |
| 427 | Ga0495592_0000711 | 3300046454 | Bacteria | 23301 |
| 428 | Ga0495580_0186785 | 3300046472 | Bacteria | 1430 |
| 429 | Ga0495606_0004241 | 3300046507 | Bacteria | 14500 |
| 430 | Ga0495628_0001663 | 3300046516 | Bacteria | 20314 |
| 431 | Ga0495632_0009180 | 3300046519 | Bacteria | 5977 |
| 432 | Ga0495643_0045162 | 3300046522 | Bacteria | 2392 |
| 433 | Ga0495642_0006014 | 3300046528 | Bacteria | 4661 |
| 434 | Ga0495642_0041153 | 3300046528 | Bacteria | 1879 |
| 435 | Ga0495642_0050647 | 3300046528 | Bacteria | 1708 |
| 436 | Ga0495652_0004318 | 3300046529 | Bacteria | 13622 |
| 437 | Ga0495598_0012181 | 3300046537 | Bacteria | 2103 |
| 438 | Ga0495598_0062177 | 3300046537 | Bacteria | 1155 |
| 439 | Ga0495598_0065497 | 3300046537 | Bacteria | 1131 |
| 440 | Ga0495621_0015334 | 3300046539 | Bacteria | 2443 |
| 441 | Ga0495597_0067070 | 3300046542 | Bacteria | 1553 |
| 442 | Ga0495645_0001291 | 3300046543 | Bacteria | 17090 |
| 443 | Ga0495645_0020885 | 3300046543 | Bacteria | 4732 |
| 444 | Ga0495668_0165523 | 3300046616 | Bacteria | 1211 |
| 445 | Ga0495625_0009260 | 3300046660 | Bacteria | 8262 |
| 446 | Ga0495661_0001479 | 3300046665 | Bacteria | 19638 |
| 447 | Ga0495657_0072554 | 3300046675 | Bacteria | 2245 |
| 448 | Ga0495599_0001351 | 3300046678 | Bacteria | 14001 |
| 449 | Ga0495647_0057070 | 3300046681 | Bacteria | 1532 |
| 450 | Ga0495658_0008655 | 3300046683 | Bacteria | 5051 |
| 451 | Ga0495658_0021167 | 3300046683 | Bacteria | 3426 |
| 452 | Ga0495613_0128053 | 3300046689 | Bacteria | 1819 |
| 453 | Ga0495636_0012687 | 3300047318 | Bacteria | 3337 |
| 454 | Ga0495687_026256 | 3300047443 | Bacteria | 2744 |
| 455 | Ga0496100_0027113 | 3300048903 | Bacteria | 3520 |
| 456 | Ga0496100_0356114 | 3300048903 | Bacteria | 1106 |
| 457 | Ga0496100_0565310 | 3300048903 | Bacteria | 881 |
| 458 | Ga0496101_0030214 | 3300048904 | Bacteria | 3797 |
| 459 | Ga0496102_0003567 | 3300048905 | Bacteria | 13187 |
| 460 | Ga0496102_0388129 | 3300048905 | Bacteria | 1314 |
| 461 | Ga0496103_0034885 | 3300048906 | Bacteria | 3078 |
| 462 | Ga0496104_0061232 | 3300048907 | Bacteria | 3568 |
| 463 | Ga0496104_0113113 | 3300048907 | Bacteria | 2603 |
| 464 | Ga0496104_0231159 | 3300048907 | Bacteria | 1761 |
| 465 | Ga0496105_0025340 | 3300048908 | Bacteria | 4828 |
| 466 | Ga0496105_0125301 | 3300048908 | Bacteria | 2117 |
| 467 | Ga0496105_0133511 | 3300048908 | Bacteria | 2045 |
| 468 | Ga0496106_0044158 | 3300048909 | Bacteria | 3345 |
| 469 | Ga0496107_0104654 | 3300048910 | Bacteria | 2077 |
| 470 | Ga0496108_0034865 | 3300048911 | Bacteria | 4181 |
| 471 | Ga0496108_0142882 | 3300048911 | Bacteria | 2062 |
| 472 | Ga0496109_0110004 | 3300048912 | Bacteria | 2561 |
| 473 | Ga0496109_0194210 | 3300048912 | Bacteria | 1907 |
| 474 | Ga0496110_0129671 | 3300048913 | Bacteria | 2276 |
| 475 | Ga0496110_0405563 | 3300048913 | Bacteria | 1243 |
| 476 | Ga0496111_0010469 | 3300048914 | Bacteria | 6225 |
| 477 | Ga0496114_0234041 | 3300048917 | Bacteria | 1614 |
| 478 | Ga0496114_0317999 | 3300048917 | Bacteria | 1375 |
| 479 | Ga0496114_0563849 | 3300048917 | Bacteria | 1006 |
| 480 | Ga0496121_0002479 | 3300048924 | Bacteria | 28114 |
| 481 | Ga0496121_0095272 | 3300048924 | Bacteria | 2314 |
| 482 | Ga0496122_0000968 | 3300048925 | Bacteria | 51537 |
| 483 | Ga0496123_0004825 | 3300048926 | Bacteria | 13907 |
| 484 | Ga0496124_0000388 | 3300048927 | Bacteria | 80485 |
| 485 | Ga0496125_0002865 | 3300048928 | Bacteria | 21711 |
| 486 | Ga0496125_0003499 | 3300048928 | Bacteria | 18978 |
| 487 | Ga0496125_0027904 | 3300048928 | Bacteria | 5107 |
| 488 | Ga0501292_001319 | 3300049515 | Bacteria | 3051 |
| 489 | Ga0501031_0019753 | 3300049568 | Bacteria | 4390 |
| 490 | Ga0501032_0048570 | 3300049569 | Bacteria | 2865 |
| 491 | Ga0501033_0002339 | 3300049570 | Bacteria | 16164 |
| 492 | Ga0501034_0143198 | 3300049571 | Bacteria | 2369 |
| 493 | Ga0501037_0003806 | 3300049573 | Bacteria | 10947 |
| 494 | Ga0501038_0113812 | 3300049574 | Bacteria | 2238 |
| 495 | Ga0501039_0003932 | 3300049575 | Bacteria | 11168 |
| 496 | Ga0501040_0079002 | 3300049576 | Bacteria | 2277 |
| 497 | Ga0501041_0004135 | 3300049577 | Bacteria | 8394 |
| 498 | Ga0501042_0006414 | 3300049578 | Bacteria | 7630 |
| 499 | Ga0501047_0000477 | 3300049581 | Bacteria | 43621 |
| 500 | Ga0501075_0002497 | 3300049591 | Bacteria | 12252 |
| 501 | Ga0501076_0002131 | 3300049592 | Bacteria | 13585 |
| 502 | Ga0501077_0137181 | 3300049593 | Bacteria | 1551 |
| 503 | Ga0501080_0018160 | 3300049742 | Bacteria | 6510 |
| 504 | Ga0501081_0000696 | 3300049743 | Bacteria | 19414 |
| 505 | Ga0501035_0004651 | 3300049822 | Bacteria | 13025 |
| 506 | Ga0501035_0100607 | 3300049822 | Bacteria | 2538 |
| 507 | Ga0501044_0000987 | 3300049823 | Bacteria | 34197 |
| 508 | nmdc:mga03683_75369_c1 | 3300050489 | Bacteria | 1449 |
| 509 | nmdc:mga03n38_173962_c1 | 3300050490 | Bacteria | 1099 |
| 510 | nmdc:mga00v17_8359_c1 | 3300050491 | Bacteria | 5568 |
| 511 | nmdc:mga0yw44_7154_c1 | 3300050492 | Bacteria | 5465 |
| 512 | nmdc:mga0k408_24801_c1 | 3300050493 | Bacteria | 3393 |
| 513 | nmdc:mga0k408_35918_c1 | 3300050493 | Bacteria | 2842 |
| 514 | nmdc:mga06z11_32248_c1 | 3300050494 | Bacteria | 2554 |
| 515 | nmdc:mga07m45_12786_c1 | 3300050496 | Bacteria | 4440 |
| 516 | nmdc:mga05p37_143415_c1 | 3300050507 | Bacteria | 2925 |
| 517 | nmdc:mga09592_24148_c1 | 3300050508 | Bacteria | 5026 |
| 518 | nmdc:mga0qj67_101315_c1 | 3300050509 | Bacteria | 2322 |
| 519 | nmdc:mga06r32_4702_c1 | 3300050510 | Bacteria | 12267 |
| 520 | nmdc:mga08y16_14875_c2 | 3300050511 | Bacteria | 6017 |
| 521 | Ga0495601_0005658 | 3300053077 | Bacteria | 7289 |
| 522 | Ga0495601_0054774 | 3300053077 | Bacteria | 2524 |
| 523 | Ga0500578_0000292 | 3300053086 | Bacteria | 61943 |
| 524 | Ga0500578_0105274 | 3300053086 | Bacteria | 1782 |
| 525 | Ga0500646_0000869 | 3300053090 | Bacteria | 8331 |
| 526 | Ga0500651_0000274 | 3300053093 | Bacteria | 30518 |
| 527 | Ga0500618_012093 | 3300053125 | Bacteria | 2270 |
| 528 | Ga0500642_0011286 | 3300053130 | Bacteria | 3189 |
| 529 | Ga0500652_002299 | 3300053131 | Bacteria | 5743 |
| 530 | Ga0500568_0016703 | 3300053139 | Bacteria | 3254 |
| 531 | Ga0500604_0000727 | 3300053151 | Bacteria | 9013 |
| 532 | Ga0500622_0000198 | 3300053156 | Bacteria | 63633 |
| 533 | Ga0500645_001196 | 3300053730 | Bacteria | 13804 |
| 534 | Ga0501082_0000754 | 3300060353 | Bacteria | 28420 |
| 535 | Ga0466962_0000421 | 3300061719 | Bacteria | 18318 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0565310 | Ga0496100_0565310_58_870 | 264 |
| 2 | 3300046542 | Ga0495597_0067070 | Ga0495597_0067070_695_1543 | 282 |
| 3 | 3300050509 | nmdc:mga0qj67_101315_c1 | nmdc:mga0qj67_101315_c1_65_925 | 286 |
| 4 | 3300005347 | Ga0070668_100092505 | Ga0070668_1000925052 | 288 |
| 5 | 3300005844 | Ga0068862_100022833 | Ga0068862_1000228335 | 288 |
| 6 | 3300025321 | Ga0207656_10061803 | Ga0207656_100618032 | 288 |
| 7 | 3300026089 | Ga0207648_10038273 | Ga0207648_100382733 | 288 |
| 8 | 3300028380 | Ga0268265_10118265 | Ga0268265_101182653 | 288 |
| 9 | 3300046537 | Ga0495598_0065497 | Ga0495598_0065497_23_943 | 288 |
| 10 | 3300047318 | Ga0495636_0012687 | Ga0495636_0012687_1768_2673 | 291 |
| 11 | 3300035170 | Ga0373943_0119210 | Ga0373943_0119210_261_1178 | 292 |
| 12 | 3300037471 | Ga0395905_0001262 | Ga0395905_0001262_3062_4030 | 292 |
| 13 | 3300048907 | Ga0496104_0113113 | Ga0496104_0113113_1088_2005 | 292 |
| 14 | 3300048908 | Ga0496105_0133511 | Ga0496105_0133511_313_1230 | 292 |
| 15 | 3300048917 | Ga0496114_0563849 | Ga0496114_0563849_37_954 | 292 |
| 16 | 3300037418 | Ga0395900_0253805 | Ga0395900_0253805_616_1587 | 293 |
| 17 | 3300037471 | Ga0395905_0003586 | Ga0395905_0003586_14099_15070 | 293 |
| 18 | 3300037471 | Ga0395905_0015392 | Ga0395905_0015392_927_1898 | 293 |
| 19 | 3300003791 | Ga0055530_10005420 | Ga0055530_100054202 | 295 |
| 20 | 3300005262 | Ga0065165_1001259 | Ga0065165_100125914 | 295 |
| 21 | 3300006195 | Ga0075366_10070252 | Ga0075366_100702522 | 295 |
| 22 | 3300013296 | Ga0157374_10003255 | Ga0157374_100032555 | 295 |
| 23 | 3300013308 | Ga0157375_10438586 | Ga0157375_104385862 | 295 |
| 24 | 3300025273 | Ga0209673_1002375 | Ga0209673_100237515 | 295 |
| 25 | 3300025297 | Ga0209758_1000500 | Ga0209758_10005007 | 295 |
| 26 | 3300025298 | Ga0209050_1000223 | Ga0209050_100022383 | 295 |
| 27 | 3300041443 | Ga0451789_0590955 | Ga0451789_0590955_766_1686 | 295 |
| 28 | 3300041458 | Ga0451798_0468504 | Ga0451798_0468504_1003_1923 | 295 |
| 29 | 3300041463 | Ga0451804_0553210 | Ga0451804_0553210_842_1762 | 295 |
| 30 | 3300044735 | Ga0466968_0031187 | Ga0466968_0031187_1014_1934 | 295 |
| 31 | 3300046519 | Ga0495632_0009180 | Ga0495632_0009180_221_1141 | 295 |
| 32 | 3300048905 | Ga0496102_0003567 | Ga0496102_0003567_9481_10401 | 295 |
| 33 | 3300050493 | nmdc:mga0k408_35918_c1 | nmdc:mga0k408_35918_c1_1117_2034 | 295 |
| 34 | 3300053086 | Ga0500578_0000292 | Ga0500578_0000292_52930_53847 | 295 |
| 35 | 3300053093 | Ga0500651_0000274 | Ga0500651_0000274_5561_6481 | 295 |
| 36 | 3300053130 | Ga0500642_0011286 | Ga0500642_0011286_773_1693 | 295 |
| 37 | 3300053131 | Ga0500652_002299 | Ga0500652_002299_3427_4347 | 295 |
| 38 | 3300053139 | Ga0500568_0016703 | Ga0500568_0016703_1575_2495 | 295 |
| 39 | 3300053156 | Ga0500622_0000198 | Ga0500622_0000198_28430_29350 | 295 |
| 40 | 3300003215 | JGI25153J46596_10009991 | JGI25153J46596_100099912 | 296 |
| 41 | 3300026075 | Ga0207708_10014475 | Ga0207708_100144754 | 296 |
| 42 | 3300031730 | Ga0307516_10020880 | Ga0307516_100208806 | 296 |
| 43 | 3300046454 | Ga0495592_0000711 | Ga0495592_0000711_15682_16590 | 296 |
| 44 | 3300046516 | Ga0495628_0001663 | Ga0495628_0001663_11935_12843 | 296 |
| 45 | 3300046529 | Ga0495652_0004318 | Ga0495652_0004318_5332_6240 | 296 |
| 46 | 3300046543 | Ga0495645_0001291 | Ga0495645_0001291_11802_12710 | 296 |
| 47 | 3300046678 | Ga0495599_0001351 | Ga0495599_0001351_8441_9349 | 296 |
| 48 | 3300048927 | Ga0496124_0000388 | Ga0496124_0000388_35061_35978 | 296 |
| 49 | 3300048928 | Ga0496125_0002865 | Ga0496125_0002865_16200_17117 | 296 |
| 50 | 3300053077 | Ga0495601_0005658 | Ga0495601_0005658_5370_6278 | 296 |
| 51 | 3300002773 | JGI25152J39213_1006758 | JGI25152J39213_10067583 | 297 |
| 52 | 3300003771 | Ga0055526_1000791 | Ga0055526_10007912 | 297 |
| 53 | 3300005331 | Ga0070670_100174279 | Ga0070670_1001742793 | 297 |
| 54 | 3300005338 | Ga0068868_100261501 | Ga0068868_1002615012 | 297 |
| 55 | 3300005354 | Ga0070675_100082190 | Ga0070675_1000821903 | 297 |
| 56 | 3300005364 | Ga0070673_100038828 | Ga0070673_1000388282 | 297 |
| 57 | 3300005364 | Ga0070673_100277950 | Ga0070673_1002779502 | 297 |
| 58 | 3300005456 | Ga0070678_100119933 | Ga0070678_1001199333 | 297 |
| 59 | 3300005457 | Ga0070662_100059013 | Ga0070662_1000590133 | 297 |
| 60 | 3300005459 | Ga0068867_100043708 | Ga0068867_1000437083 | 297 |
| 61 | 3300005543 | Ga0070672_100407876 | Ga0070672_1004078762 | 297 |
| 62 | 3300005578 | Ga0068854_100073461 | Ga0068854_1000734613 | 297 |
| 63 | 3300005616 | Ga0068852_100132697 | Ga0068852_1001326973 | 297 |
| 64 | 3300005617 | Ga0068859_100008419 | Ga0068859_10000841911 | 297 |
| 65 | 3300005618 | Ga0068864_100000633 | Ga0068864_1000006333 | 297 |
| 66 | 3300005719 | Ga0068861_100052391 | Ga0068861_1000523912 | 297 |
| 67 | 3300005841 | Ga0068863_100050165 | Ga0068863_1000501653 | 297 |
| 68 | 3300005842 | Ga0068858_100099422 | Ga0068858_1000994223 | 297 |
| 69 | 3300006237 | Ga0097621_100200380 | Ga0097621_1002003802 | 297 |
| 70 | 3300006931 | Ga0097620_100008419 | Ga0097620_10000841911 | 297 |
| 71 | 3300009553 | Ga0105249_10045426 | Ga0105249_100454263 | 297 |
| 72 | 3300013297 | Ga0157378_10066588 | Ga0157378_100665883 | 297 |
| 73 | 3300013308 | Ga0157375_10436874 | Ga0157375_104368742 | 297 |
| 74 | 3300014325 | Ga0163163_10029770 | Ga0163163_100297705 | 297 |
| 75 | 3300014326 | Ga0157380_10478839 | Ga0157380_104788392 | 297 |
| 76 | 3300014968 | Ga0157379_10061777 | Ga0157379_100617773 | 297 |
| 77 | 3300014969 | Ga0157376_10151848 | Ga0157376_101518482 | 297 |
| 78 | 3300014969 | Ga0157376_10215812 | Ga0157376_102158122 | 297 |
| 79 | 3300017792 | Ga0163161_10344441 | Ga0163161_103444412 | 297 |
| 80 | 3300025245 | Ga0207425_1000645 | Ga0207425_10006453 | 297 |
| 81 | 3300025258 | Ga0209129_1000158 | Ga0209129_100015861 | 297 |
| 82 | 3300025295 | Ga0209564_1000282 | Ga0209564_100028261 | 297 |
| 83 | 3300025297 | Ga0209758_1000630 | Ga0209758_10006307 | 297 |
| 84 | 3300025907 | Ga0207645_10019699 | Ga0207645_100196993 | 297 |
| 85 | 3300025923 | Ga0207681_10068400 | Ga0207681_100684003 | 297 |
| 86 | 3300025923 | Ga0207681_10163219 | Ga0207681_101632192 | 297 |
| 87 | 3300025925 | Ga0207650_10130247 | Ga0207650_101302473 | 297 |
| 88 | 3300025926 | Ga0207659_10089966 | Ga0207659_100899663 | 297 |
| 89 | 3300025931 | Ga0207644_10131865 | Ga0207644_101318651 | 297 |
| 90 | 3300025933 | Ga0207706_10305617 | Ga0207706_103056172 | 297 |
| 91 | 3300025940 | Ga0207691_10381145 | Ga0207691_103811452 | 297 |
| 92 | 3300025945 | Ga0207679_10338933 | Ga0207679_103389332 | 297 |
| 93 | 3300025960 | Ga0207651_10000489 | Ga0207651_1000048917 | 297 |
| 94 | 3300025981 | Ga0207640_10105533 | Ga0207640_101055332 | 297 |
| 95 | 3300025986 | Ga0207658_10540790 | Ga0207658_105407901 | 297 |
| 96 | 3300026035 | Ga0207703_10047851 | Ga0207703_100478512 | 297 |
| 97 | 3300026067 | Ga0207678_10115258 | Ga0207678_101152582 | 297 |
| 98 | 3300026095 | Ga0207676_10128234 | Ga0207676_101282343 | 297 |
| 99 | 3300026118 | Ga0207675_100197882 | Ga0207675_1001978822 | 297 |
| 100 | 3300026121 | Ga0207683_10003848 | Ga0207683_100038483 | 297 |
| 101 | 3300033179 | Ga0307507_10183739 | Ga0307507_101837392 | 297 |
| 102 | 3300046681 | Ga0495647_0057070 | Ga0495647_0057070_160_1080 | 297 |
| 103 | 3300046683 | Ga0495658_0021167 | Ga0495658_0021167_1615_2535 | 297 |
| 104 | 3300050507 | nmdc:mga05p37_143415_c1 | nmdc:mga05p37_143415_c1_1242_2168 | 297 |
| 105 | 3300006048 | Ga0075363_100022515 | Ga0075363_1000225153 | 298 |
| 106 | 3300006177 | Ga0075362_10000222 | Ga0075362_100002223 | 298 |
| 107 | 3300006178 | Ga0075367_10037604 | Ga0075367_100376043 | 298 |
| 108 | 3300006186 | Ga0075369_10036217 | Ga0075369_100362173 | 298 |
| 109 | 3300006353 | Ga0075370_10015081 | Ga0075370_100150812 | 298 |
| 110 | 3300031238 | Ga0265332_10000006 | Ga0265332_10000006249 | 298 |
| 111 | 3300031239 | Ga0265328_10014789 | Ga0265328_100147893 | 298 |
| 112 | 3300042012 | Ga0439455_0022496 | Ga0439455_0022496_232_1158 | 298 |
| 113 | 3300050496 | nmdc:mga07m45_12786_c1 | nmdc:mga07m45_12786_c1_2949_3893 | 298 |
| 114 | 3300031548 | Ga0307408_100157002 | Ga0307408_1001570022 | 299 |
| 115 | 3300032002 | Ga0307416_100047868 | Ga0307416_1000478683 | 299 |
| 116 | 3300049573 | Ga0501037_0003806 | Ga0501037_0003806_3598_4524 | 299 |
| 117 | 3300049574 | Ga0501038_0113812 | Ga0501038_0113812_1163_2089 | 299 |
| 118 | 3300049575 | Ga0501039_0003932 | Ga0501039_0003932_7396_8322 | 299 |
| 119 | 3300049576 | Ga0501040_0079002 | Ga0501040_0079002_1153_2079 | 299 |
| 120 | 3300049577 | Ga0501041_0004135 | Ga0501041_0004135_926_1852 | 299 |
| 121 | 3300049578 | Ga0501042_0006414 | Ga0501042_0006414_759_1685 | 299 |
| 122 | 3300049591 | Ga0501075_0002497 | Ga0501075_0002497_4521_5447 | 299 |
| 123 | 3300049592 | Ga0501076_0002131 | Ga0501076_0002131_5699_6625 | 299 |
| 124 | 3300049593 | Ga0501077_0137181 | Ga0501077_0137181_130_1056 | 299 |
| 125 | 3300049742 | Ga0501080_0018160 | Ga0501080_0018160_4841_5767 | 299 |
| 126 | 3300049743 | Ga0501081_0000696 | Ga0501081_0000696_7347_8273 | 299 |
| 127 | 3300049822 | Ga0501035_0100607 | Ga0501035_0100607_959_1885 | 299 |
| 128 | 3300053090 | Ga0500646_0000869 | Ga0500646_0000869_6234_7208 | 299 |
| 129 | 3300053151 | Ga0500604_0000727 | Ga0500604_0000727_913_1887 | 299 |
| 130 | 3300060353 | Ga0501082_0000754 | Ga0501082_0000754_7242_8168 | 299 |
| 131 | 3300030521 | Ga0307511_10000653 | Ga0307511_1000065331 | 300 |
| 132 | iso_pu_bacteria | 2585428057 | 2587725909 | 300 |
| 133 | iso_pu_bacteria | 2588253510 | 2588292878 | 300 |
| 134 | iso_pu_bacteria | 2643221592 | 2643967987 | 300 |
| 135 | iso_pu_bacteria | 2643221625 | 2644143113 | 300 |
| 136 | iso_pu_bacteria | 2643221644 | 2644247736 | 300 |
| 137 | iso_pu_bacteria | 2643221648 | 2644271799 | 300 |
| 138 | 3300005336 | Ga0070680_100320804 | Ga0070680_1003208041 | 301 |
| 139 | 3300005457 | Ga0070662_100140588 | Ga0070662_1001405882 | 301 |
| 140 | 3300005458 | Ga0070681_10134930 | Ga0070681_101349304 | 301 |
| 141 | 3300005535 | Ga0070684_100498925 | Ga0070684_1004989252 | 301 |
| 142 | 3300005563 | Ga0068855_100035868 | Ga0068855_1000358685 | 301 |
| 143 | 3300005577 | Ga0068857_100006660 | Ga0068857_10000666012 | 301 |
| 144 | 3300005842 | Ga0068858_100105956 | Ga0068858_1001059564 | 301 |
| 145 | 3300009174 | Ga0105241_10003948 | Ga0105241_100039485 | 301 |
| 146 | 3300025911 | Ga0207654_10008208 | Ga0207654_100082085 | 301 |
| 147 | 3300025912 | Ga0207707_10117286 | Ga0207707_101172862 | 301 |
| 148 | 3300025917 | Ga0207660_10114646 | Ga0207660_101146462 | 301 |
| 149 | 3300025949 | Ga0207667_10028143 | Ga0207667_100281438 | 301 |
| 150 | 3300026035 | Ga0207703_10145801 | Ga0207703_101458012 | 301 |
| 151 | 3300028381 | Ga0268264_10352667 | Ga0268264_103526672 | 301 |
| 152 | 3300005617 | Ga0068859_100132537 | Ga0068859_1001325374 | 302 |
| 153 | 3300005842 | Ga0068858_100063048 | Ga0068858_1000630482 | 302 |
| 154 | 3300006931 | Ga0097620_100132541 | Ga0097620_1001325414 | 302 |
| 155 | 3300026035 | Ga0207703_10027828 | Ga0207703_100278284 | 302 |
| 156 | 3300035695 | Ga0373927_0033664 | Ga0373927_0033664_2029_2937 | 302 |
| 157 | 3300005329 | Ga0070683_100034749 | Ga0070683_1000347495 | 303 |
| 158 | 3300005335 | Ga0070666_10112381 | Ga0070666_101123812 | 303 |
| 159 | 3300005338 | Ga0068868_100005246 | Ga0068868_1000052469 | 303 |
| 160 | 3300005344 | Ga0070661_100044127 | Ga0070661_1000441275 | 303 |
| 161 | 3300005353 | Ga0070669_100297859 | Ga0070669_1002978592 | 303 |
| 162 | 3300005354 | Ga0070675_100030414 | Ga0070675_1000304145 | 303 |
| 163 | 3300005364 | Ga0070673_100048966 | Ga0070673_1000489662 | 303 |
| 164 | 3300005364 | Ga0070673_100086888 | Ga0070673_1000868882 | 303 |
| 165 | 3300005365 | Ga0070688_100014639 | Ga0070688_1000146396 | 303 |
| 166 | 3300005367 | Ga0070667_100373318 | Ga0070667_1003733182 | 303 |
| 167 | 3300005438 | Ga0070701_10032289 | Ga0070701_100322893 | 303 |
| 168 | 3300005445 | Ga0070708_100469597 | Ga0070708_1004695972 | 303 |
| 169 | 3300005457 | Ga0070662_100038615 | Ga0070662_1000386155 | 303 |
| 170 | 3300005457 | Ga0070662_100061865 | Ga0070662_1000618654 | 303 |
| 171 | 3300005466 | Ga0070685_10047294 | Ga0070685_100472942 | 303 |
| 172 | 3300005467 | Ga0070706_100007046 | Ga0070706_1000070467 | 303 |
| 173 | 3300005468 | Ga0070707_100161029 | Ga0070707_1001610293 | 303 |
| 174 | 3300005543 | Ga0070672_100006073 | Ga0070672_1000060737 | 303 |
| 175 | 3300005548 | Ga0070665_100026651 | Ga0070665_1000266512 | 303 |
| 176 | 3300005549 | Ga0070704_100036448 | Ga0070704_1000364484 | 303 |
| 177 | 3300005616 | Ga0068852_100178137 | Ga0068852_1001781372 | 303 |
| 178 | 3300005618 | Ga0068864_100107777 | Ga0068864_1001077774 | 303 |
| 179 | 3300005718 | Ga0068866_10034618 | Ga0068866_100346183 | 303 |
| 180 | 3300005842 | Ga0068858_100028034 | Ga0068858_1000280344 | 303 |
| 181 | 3300006173 | Ga0070716_100004488 | Ga0070716_1000044885 | 303 |
| 182 | 3300006237 | Ga0097621_100261748 | Ga0097621_1002617482 | 303 |
| 183 | 3300006358 | Ga0068871_100066207 | Ga0068871_1000662072 | 303 |
| 184 | 3300006881 | Ga0068865_100036245 | Ga0068865_1000362452 | 303 |
| 185 | 3300007265 | Ga0099794_10012062 | Ga0099794_100120622 | 303 |
| 186 | 3300009094 | Ga0111539_10263957 | Ga0111539_102639572 | 303 |
| 187 | 3300009101 | Ga0105247_10144998 | Ga0105247_101449982 | 303 |
| 188 | 3300009148 | Ga0105243_10040470 | Ga0105243_100404705 | 303 |
| 189 | 3300009148 | Ga0105243_10101540 | Ga0105243_101015403 | 303 |
| 190 | 3300009174 | Ga0105241_10006603 | Ga0105241_100066033 | 303 |
| 191 | 3300009551 | Ga0105238_10013485 | Ga0105238_100134856 | 303 |
| 192 | 3300013297 | Ga0157378_10040438 | Ga0157378_100404385 | 303 |
| 193 | 3300013307 | Ga0157372_10329743 | Ga0157372_103297432 | 303 |
| 194 | 3300013308 | Ga0157375_10699154 | Ga0157375_106991541 | 303 |
| 195 | 3300014325 | Ga0163163_10405416 | Ga0163163_104054161 | 303 |
| 196 | 3300014325 | Ga0163163_10556325 | Ga0163163_105563252 | 303 |
| 197 | 3300014968 | Ga0157379_10023823 | Ga0157379_100238235 | 303 |
| 198 | 3300017792 | Ga0163161_10083159 | Ga0163161_100831592 | 303 |
| 199 | 3300025893 | Ga0207682_10002051 | Ga0207682_100020517 | 303 |
| 200 | 3300025899 | Ga0207642_10016791 | Ga0207642_100167912 | 303 |
| 201 | 3300025901 | Ga0207688_10004075 | Ga0207688_100040755 | 303 |
| 202 | 3300025907 | Ga0207645_10014310 | Ga0207645_100143105 | 303 |
| 203 | 3300025925 | Ga0207650_10053911 | Ga0207650_100539115 | 303 |
| 204 | 3300025926 | Ga0207659_10143128 | Ga0207659_101431282 | 303 |
| 205 | 3300025933 | Ga0207706_10022195 | Ga0207706_100221953 | 303 |
| 206 | 3300025933 | Ga0207706_10221364 | Ga0207706_102213642 | 303 |
| 207 | 3300025934 | Ga0207686_10077514 | Ga0207686_100775142 | 303 |
| 208 | 3300025940 | Ga0207691_10003129 | Ga0207691_1000312911 | 303 |
| 209 | 3300025942 | Ga0207689_10049766 | Ga0207689_100497664 | 303 |
| 210 | 3300025945 | Ga0207679_10162565 | Ga0207679_101625652 | 303 |
| 211 | 3300025960 | Ga0207651_10036899 | Ga0207651_100368995 | 303 |
| 212 | 3300026067 | Ga0207678_10070084 | Ga0207678_100700843 | 303 |
| 213 | 3300026075 | Ga0207708_10285724 | Ga0207708_102857242 | 303 |
| 214 | 3300026088 | Ga0207641_10037951 | Ga0207641_100379515 | 303 |
| 215 | 3300026088 | Ga0207641_10076735 | Ga0207641_100767354 | 303 |
| 216 | 3300026089 | Ga0207648_10017883 | Ga0207648_100178832 | 303 |
| 217 | 3300026089 | Ga0207648_10057476 | Ga0207648_100574763 | 303 |
| 218 | 3300026089 | Ga0207648_10093989 | Ga0207648_100939892 | 303 |
| 219 | 3300026095 | Ga0207676_10038339 | Ga0207676_100383395 | 303 |
| 220 | 3300026116 | Ga0207674_10025008 | Ga0207674_100250085 | 303 |
| 221 | 3300026118 | Ga0207675_100162699 | Ga0207675_1001626992 | 303 |
| 222 | 3300026121 | Ga0207683_10024424 | Ga0207683_100244248 | 303 |
| 223 | 3300026121 | Ga0207683_10025278 | Ga0207683_100252785 | 303 |
| 224 | 3300026142 | Ga0207698_10227613 | Ga0207698_102276132 | 303 |
| 225 | 3300027360 | Ga0209969_1007197 | Ga0209969_10071972 | 303 |
| 226 | 3300027671 | Ga0209588_1017153 | Ga0209588_10171533 | 303 |
| 227 | 3300028381 | Ga0268264_10014837 | Ga0268264_100148372 | 303 |
| 228 | 3300028577 | Ga0265318_10003181 | Ga0265318_100031817 | 303 |
| 229 | 3300031235 | Ga0265330_10017894 | Ga0265330_100178944 | 303 |
| 230 | 3300031238 | Ga0265332_10006768 | Ga0265332_100067686 | 303 |
| 231 | 3300031239 | Ga0265328_10005040 | Ga0265328_100050405 | 303 |
| 232 | 3300031250 | Ga0265331_10005912 | Ga0265331_100059126 | 303 |
| 233 | 3300031250 | Ga0265331_10022712 | Ga0265331_100227122 | 303 |
| 234 | 3300031344 | Ga0265316_10003730 | Ga0265316_100037305 | 303 |
| 235 | 3300031711 | Ga0265314_10003019 | Ga0265314_1000301910 | 303 |
| 236 | 3300031711 | Ga0265314_10043878 | Ga0265314_100438785 | 303 |
| 237 | 3300044683 | Ga0466965_0009563 | Ga0466965_0009563_2878_3795 | 303 |
| 238 | 3300044684 | Ga0466966_0018973 | Ga0466966_0018973_3437_4354 | 303 |
| 239 | 3300044693 | Ga0466961_0087899 | Ga0466961_0087899_1020_1937 | 303 |
| 240 | 3300045051 | Ga0451576_0156515 | Ga0451576_0156515_131_1042 | 303 |
| 241 | 3300046528 | Ga0495642_0050647 | Ga0495642_0050647_150_1061 | 303 |
| 242 | 3300046537 | Ga0495598_0012181 | Ga0495598_0012181_517_1428 | 303 |
| 243 | 3300046683 | Ga0495658_0008655 | Ga0495658_0008655_3242_4153 | 303 |
| 244 | 3300048903 | Ga0496100_0027113 | Ga0496100_0027113_307_1218 | 303 |
| 245 | 3300048913 | Ga0496110_0405563 | Ga0496110_0405563_180_1091 | 303 |
| 246 | 3300048917 | Ga0496114_0317999 | Ga0496114_0317999_324_1235 | 303 |
| 247 | 3300048924 | Ga0496121_0002479 | Ga0496121_0002479_19744_20661 | 303 |
| 248 | 3300050511 | nmdc:mga08y16_14875_c2 | nmdc:mga08y16_14875_c2_3951_4862 | 303 |
| 249 | 3300061719 | Ga0466962_0000421 | Ga0466962_0000421_13657_14574 | 303 |
| 250 | 3300005327 | Ga0070658_10208487 | Ga0070658_102084873 | 304 |
| 251 | 3300005328 | Ga0070676_10007256 | Ga0070676_100072566 | 304 |
| 252 | 3300005328 | Ga0070676_10255412 | Ga0070676_102554121 | 304 |
| 253 | 3300005329 | Ga0070683_100137153 | Ga0070683_1001371533 | 304 |
| 254 | 3300005330 | Ga0070690_100055099 | Ga0070690_1000550992 | 304 |
| 255 | 3300005333 | Ga0070677_10073012 | Ga0070677_100730122 | 304 |
| 256 | 3300005333 | Ga0070677_10151210 | Ga0070677_101512102 | 304 |
| 257 | 3300005334 | Ga0068869_100006173 | Ga0068869_1000061733 | 304 |
| 258 | 3300005335 | Ga0070666_10219901 | Ga0070666_102199012 | 304 |
| 259 | 3300005336 | Ga0070680_100040608 | Ga0070680_1000406083 | 304 |
| 260 | 3300005338 | Ga0068868_100014883 | Ga0068868_1000148838 | 304 |
| 261 | 3300005339 | Ga0070660_100135149 | Ga0070660_1001351492 | 304 |
| 262 | 3300005343 | Ga0070687_100058264 | Ga0070687_1000582643 | 304 |
| 263 | 3300005344 | Ga0070661_100250502 | Ga0070661_1002505022 | 304 |
| 264 | 3300005347 | Ga0070668_100020756 | Ga0070668_1000207564 | 304 |
| 265 | 3300005353 | Ga0070669_100011627 | Ga0070669_1000116273 | 304 |
| 266 | 3300005354 | Ga0070675_100026809 | Ga0070675_1000268094 | 304 |
| 267 | 3300005354 | Ga0070675_100056426 | Ga0070675_1000564262 | 304 |
| 268 | 3300005354 | Ga0070675_100144959 | Ga0070675_1001449592 | 304 |
| 269 | 3300005355 | Ga0070671_100001538 | Ga0070671_10000153815 | 304 |
| 270 | 3300005355 | Ga0070671_100136823 | Ga0070671_1001368232 | 304 |
| 271 | 3300005355 | Ga0070671_100261965 | Ga0070671_1002619652 | 304 |
| 272 | 3300005356 | Ga0070674_100134523 | Ga0070674_1001345232 | 304 |
| 273 | 3300005366 | Ga0070659_100107055 | Ga0070659_1001070551 | 304 |
| 274 | 3300005367 | Ga0070667_100014002 | Ga0070667_1000140023 | 304 |
| 275 | 3300005456 | Ga0070678_100154296 | Ga0070678_1001542962 | 304 |
| 276 | 3300005457 | Ga0070662_100047082 | Ga0070662_1000470822 | 304 |
| 277 | 3300005457 | Ga0070662_100226966 | Ga0070662_1002269661 | 304 |
| 278 | 3300005459 | Ga0068867_100469771 | Ga0068867_1004697711 | 304 |
| 279 | 3300005543 | Ga0070672_100012687 | Ga0070672_1000126876 | 304 |
| 280 | 3300005543 | Ga0070672_100142776 | Ga0070672_1001427762 | 304 |
| 281 | 3300005544 | Ga0070686_100112139 | Ga0070686_1001121392 | 304 |
| 282 | 3300005563 | Ga0068855_100083279 | Ga0068855_1000832793 | 304 |
| 283 | 3300005564 | Ga0070664_100144017 | Ga0070664_1001440171 | 304 |
| 284 | 3300005577 | Ga0068857_100368407 | Ga0068857_1003684072 | 304 |
| 285 | 3300005614 | Ga0068856_100028943 | Ga0068856_1000289436 | 304 |
| 286 | 3300005614 | Ga0068856_100086791 | Ga0068856_1000867913 | 304 |
| 287 | 3300005616 | Ga0068852_100038245 | Ga0068852_1000382454 | 304 |
| 288 | 3300005616 | Ga0068852_100210182 | Ga0068852_1002101822 | 304 |
| 289 | 3300005617 | Ga0068859_100121622 | Ga0068859_1001216223 | 304 |
| 290 | 3300005618 | Ga0068864_100015704 | Ga0068864_1000157046 | 304 |
| 291 | 3300005719 | Ga0068861_100012851 | Ga0068861_1000128513 | 304 |
| 292 | 3300005719 | Ga0068861_100023846 | Ga0068861_1000238463 | 304 |
| 293 | 3300005834 | Ga0068851_10029132 | Ga0068851_100291323 | 304 |
| 294 | 3300005834 | Ga0068851_10032278 | Ga0068851_100322785 | 304 |
| 295 | 3300005834 | Ga0068851_10033564 | Ga0068851_100335643 | 304 |
| 296 | 3300005834 | Ga0068851_10109141 | Ga0068851_101091412 | 304 |
| 297 | 3300005842 | Ga0068858_100028884 | Ga0068858_1000288845 | 304 |
| 298 | 3300005843 | Ga0068860_100024320 | Ga0068860_1000243203 | 304 |
| 299 | 3300005843 | Ga0068860_100226713 | Ga0068860_1002267132 | 304 |
| 300 | 3300006237 | Ga0097621_100101303 | Ga0097621_1001013033 | 304 |
| 301 | 3300006237 | Ga0097621_100135320 | Ga0097621_1001353202 | 304 |
| 302 | 3300006237 | Ga0097621_100253178 | Ga0097621_1002531782 | 304 |
| 303 | 3300006237 | Ga0097621_100280883 | Ga0097621_1002808832 | 304 |
| 304 | 3300006358 | Ga0068871_100020186 | Ga0068871_1000201865 | 304 |
| 305 | 3300006358 | Ga0068871_100053567 | Ga0068871_1000535673 | 304 |
| 306 | 3300006358 | Ga0068871_100178426 | Ga0068871_1001784262 | 304 |
| 307 | 3300006881 | Ga0068865_100029210 | Ga0068865_1000292103 | 304 |
| 308 | 3300006931 | Ga0097620_100121625 | Ga0097620_1001216252 | 304 |
| 309 | 3300009098 | Ga0105245_10131295 | Ga0105245_101312952 | 304 |
| 310 | 3300009148 | Ga0105243_10060370 | Ga0105243_100603703 | 304 |
| 311 | 3300009176 | Ga0105242_10101625 | Ga0105242_101016252 | 304 |
| 312 | 3300009177 | Ga0105248_10047282 | Ga0105248_100472823 | 304 |
| 313 | 3300009551 | Ga0105238_10003518 | Ga0105238_100035185 | 304 |
| 314 | 3300009553 | Ga0105249_10101206 | Ga0105249_101012063 | 304 |
| 315 | 3300013102 | Ga0157371_10122059 | Ga0157371_101220593 | 304 |
| 316 | 3300013296 | Ga0157374_10027924 | Ga0157374_100279245 | 304 |
| 317 | 3300013296 | Ga0157374_10263190 | Ga0157374_102631902 | 304 |
| 318 | 3300013306 | Ga0163162_10041723 | Ga0163162_100417234 | 304 |
| 319 | 3300013306 | Ga0163162_10525177 | Ga0163162_105251772 | 304 |
| 320 | 3300013307 | Ga0157372_10018316 | Ga0157372_100183167 | 304 |
| 321 | 3300013308 | Ga0157375_10025420 | Ga0157375_100254201 | 304 |
| 322 | 3300013308 | Ga0157375_10025469 | Ga0157375_100254693 | 304 |
| 323 | 3300014326 | Ga0157380_10032136 | Ga0157380_100321363 | 304 |
| 324 | 3300014326 | Ga0157380_10485663 | Ga0157380_104856632 | 304 |
| 325 | 3300014745 | Ga0157377_10006752 | Ga0157377_100067523 | 304 |
| 326 | 3300014968 | Ga0157379_10162939 | Ga0157379_101629392 | 304 |
| 327 | 3300014969 | Ga0157376_10018794 | Ga0157376_100187943 | 304 |
| 328 | 3300014969 | Ga0157376_10045026 | Ga0157376_100450263 | 304 |
| 329 | 3300017792 | Ga0163161_10011712 | Ga0163161_100117122 | 304 |
| 330 | 3300017792 | Ga0163161_10167152 | Ga0163161_101671522 | 304 |
| 331 | 3300021384 | Ga0213876_10065952 | Ga0213876_100659523 | 304 |
| 332 | 3300025321 | Ga0207656_10084165 | Ga0207656_100841652 | 304 |
| 333 | 3300025893 | Ga0207682_10037907 | Ga0207682_100379073 | 304 |
| 334 | 3300025893 | Ga0207682_10069187 | Ga0207682_100691872 | 304 |
| 335 | 3300025893 | Ga0207682_10137616 | Ga0207682_101376162 | 304 |
| 336 | 3300025907 | Ga0207645_10011438 | Ga0207645_100114389 | 304 |
| 337 | 3300025907 | Ga0207645_10252519 | Ga0207645_102525191 | 304 |
| 338 | 3300025908 | Ga0207643_10030995 | Ga0207643_100309953 | 304 |
| 339 | 3300025909 | Ga0207705_10213044 | Ga0207705_102130442 | 304 |
| 340 | 3300025917 | Ga0207660_10067331 | Ga0207660_100673312 | 304 |
| 341 | 3300025920 | Ga0207649_10085933 | Ga0207649_100859333 | 304 |
| 342 | 3300025921 | Ga0207652_10109760 | Ga0207652_101097602 | 304 |
| 343 | 3300025923 | Ga0207681_10003786 | Ga0207681_100037866 | 304 |
| 344 | 3300025923 | Ga0207681_10107862 | Ga0207681_101078623 | 304 |
| 345 | 3300025923 | Ga0207681_10360772 | Ga0207681_103607722 | 304 |
| 346 | 3300025924 | Ga0207694_10140276 | Ga0207694_101402762 | 304 |
| 347 | 3300025925 | Ga0207650_10013932 | Ga0207650_100139323 | 304 |
| 348 | 3300025925 | Ga0207650_10116213 | Ga0207650_101162133 | 304 |
| 349 | 3300025926 | Ga0207659_10052955 | Ga0207659_100529553 | 304 |
| 350 | 3300025926 | Ga0207659_10092702 | Ga0207659_100927023 | 304 |
| 351 | 3300025926 | Ga0207659_10162463 | Ga0207659_101624632 | 304 |
| 352 | 3300025927 | Ga0207687_10100982 | Ga0207687_101009822 | 304 |
| 353 | 3300025931 | Ga0207644_10009771 | Ga0207644_100097713 | 304 |
| 354 | 3300025931 | Ga0207644_10222249 | Ga0207644_102222492 | 304 |
| 355 | 3300025933 | Ga0207706_10002668 | Ga0207706_1000266813 | 304 |
| 356 | 3300025933 | Ga0207706_10039197 | Ga0207706_100391972 | 304 |
| 357 | 3300025934 | Ga0207686_10018193 | Ga0207686_100181934 | 304 |
| 358 | 3300025935 | Ga0207709_10008638 | Ga0207709_100086383 | 304 |
| 359 | 3300025937 | Ga0207669_10012975 | Ga0207669_100129753 | 304 |
| 360 | 3300025937 | Ga0207669_10174888 | Ga0207669_101748882 | 304 |
| 361 | 3300025938 | Ga0207704_10003079 | Ga0207704_100030793 | 304 |
| 362 | 3300025939 | Ga0207665_10047695 | Ga0207665_100476954 | 304 |
| 363 | 3300025940 | Ga0207691_10000612 | Ga0207691_100006122 | 304 |
| 364 | 3300025940 | Ga0207691_10172788 | Ga0207691_101727881 | 304 |
| 365 | 3300025941 | Ga0207711_10122650 | Ga0207711_101226502 | 304 |
| 366 | 3300025942 | Ga0207689_10005225 | Ga0207689_100052259 | 304 |
| 367 | 3300025942 | Ga0207689_10006428 | Ga0207689_100064289 | 304 |
| 368 | 3300025944 | Ga0207661_10350277 | Ga0207661_103502772 | 304 |
| 369 | 3300025945 | Ga0207679_10089699 | Ga0207679_100896993 | 304 |
| 370 | 3300025945 | Ga0207679_10210253 | Ga0207679_102102532 | 304 |
| 371 | 3300025960 | Ga0207651_10045570 | Ga0207651_100455703 | 304 |
| 372 | 3300025961 | Ga0207712_10064682 | Ga0207712_100646823 | 304 |
| 373 | 3300025972 | Ga0207668_10026546 | Ga0207668_100265463 | 304 |
| 374 | 3300025981 | Ga0207640_10095834 | Ga0207640_100958341 | 304 |
| 375 | 3300025986 | Ga0207658_10002481 | Ga0207658_1000248121 | 304 |
| 376 | 3300025986 | Ga0207658_10154926 | Ga0207658_101549263 | 304 |
| 377 | 3300026023 | Ga0207677_10014782 | Ga0207677_100147822 | 304 |
| 378 | 3300026023 | Ga0207677_10199016 | Ga0207677_101990162 | 304 |
| 379 | 3300026035 | Ga0207703_10002613 | Ga0207703_1000261316 | 304 |
| 380 | 3300026035 | Ga0207703_10006418 | Ga0207703_100064183 | 304 |
| 381 | 3300026041 | Ga0207639_10148138 | Ga0207639_101481382 | 304 |
| 382 | 3300026078 | Ga0207702_10205850 | Ga0207702_102058502 | 304 |
| 383 | 3300026089 | Ga0207648_10078189 | Ga0207648_100781893 | 304 |
| 384 | 3300026116 | Ga0207674_10086172 | Ga0207674_100861723 | 304 |
| 385 | 3300026118 | Ga0207675_100003397 | Ga0207675_1000033973 | 304 |
| 386 | 3300026118 | Ga0207675_100032838 | Ga0207675_1000328384 | 304 |
| 387 | 3300026142 | Ga0207698_10024234 | Ga0207698_100242343 | 304 |
| 388 | 3300026142 | Ga0207698_10045989 | Ga0207698_100459893 | 304 |
| 389 | 3300028381 | Ga0268264_10002070 | Ga0268264_100020706 | 304 |
| 390 | 3300031548 | Ga0307408_100050016 | Ga0307408_1000500163 | 304 |
| 391 | 3300031731 | Ga0307405_10032089 | Ga0307405_100320893 | 304 |
| 392 | 3300031731 | Ga0307405_10075710 | Ga0307405_100757102 | 304 |
| 393 | 3300031824 | Ga0307413_10098085 | Ga0307413_100980852 | 304 |
| 394 | 3300031901 | Ga0307406_10039274 | Ga0307406_100392743 | 304 |
| 395 | 3300031911 | Ga0307412_10020585 | Ga0307412_100205853 | 304 |
| 396 | 3300031911 | Ga0307412_10187815 | Ga0307412_101878152 | 304 |
| 397 | 3300031995 | Ga0307409_100000577 | Ga0307409_1000005777 | 304 |
| 398 | 3300031995 | Ga0307409_100002540 | Ga0307409_1000025403 | 304 |
| 399 | 3300032002 | Ga0307416_100002818 | Ga0307416_1000028184 | 304 |
| 400 | 3300032002 | Ga0307416_100044859 | Ga0307416_1000448593 | 304 |
| 401 | 3300032005 | Ga0307411_10018344 | Ga0307411_100183444 | 304 |
| 402 | 3300032126 | Ga0307415_100006508 | Ga0307415_1000065083 | 304 |
| 403 | 3300032126 | Ga0307415_100085923 | Ga0307415_1000859232 | 304 |
| 404 | 3300034820 | Ga0373959_0007456 | Ga0373959_0007456_831_1751 | 304 |
| 405 | 3300035115 | Ga0373941_0019332 | Ga0373941_0019332_240_1160 | 304 |
| 406 | 3300035116 | Ga0373945_0106511 | Ga0373945_0106511_46_966 | 304 |
| 407 | 3300035170 | Ga0373943_0042059 | Ga0373943_0042059_1264_2184 | 304 |
| 408 | 3300035242 | Ga0373962_0008890 | Ga0373962_0008890_835_1755 | 304 |
| 409 | 3300036401 | Ga0373937_0135845 | Ga0373937_0135845_843_1763 | 304 |
| 410 | 3300037068 | Ga0373925_0182611 | Ga0373925_0182611_671_1591 | 304 |
| 411 | 3300039437 | Ga0436365_1691899 | Ga0436365_1691899_825_1745 | 304 |
| 412 | 3300046472 | Ga0495580_0186785 | Ga0495580_0186785_176_1096 | 304 |
| 413 | 3300046537 | Ga0495598_0062177 | Ga0495598_0062177_46_966 | 304 |
| 414 | 3300046543 | Ga0495645_0020885 | Ga0495645_0020885_3155_4075 | 304 |
| 415 | 3300046675 | Ga0495657_0072554 | Ga0495657_0072554_981_1901 | 304 |
| 416 | 3300046689 | Ga0495613_0128053 | Ga0495613_0128053_516_1436 | 304 |
| 417 | 3300048904 | Ga0496101_0030214 | Ga0496101_0030214_2171_3091 | 304 |
| 418 | 3300048907 | Ga0496104_0061232 | Ga0496104_0061232_2536_3456 | 304 |
| 419 | 3300048908 | Ga0496105_0125301 | Ga0496105_0125301_645_1565 | 304 |
| 420 | 3300048910 | Ga0496107_0104654 | Ga0496107_0104654_413_1333 | 304 |
| 421 | 3300048911 | Ga0496108_0142882 | Ga0496108_0142882_777_1697 | 304 |
| 422 | 3300048917 | Ga0496114_0234041 | Ga0496114_0234041_336_1256 | 304 |
| 423 | 3300049515 | Ga0501292_001319 | Ga0501292_001319_596_1516 | 304 |
| 424 | 3300053077 | Ga0495601_0054774 | Ga0495601_0054774_1092_2012 | 304 |
| 425 | 3300053086 | Ga0500578_0105274 | Ga0500578_0105274_551_1471 | 304 |
| 426 | 3300053730 | Ga0500645_001196 | Ga0500645_001196_11597_12517 | 304 |
| 427 | 3300006847 | Ga0075431_100000817 | Ga0075431_1000008178 | 305 |
| 428 | 3300006880 | Ga0075429_100003041 | Ga0075429_10000304113 | 305 |
| 429 | 3300013296 | Ga0157374_10083444 | Ga0157374_100834443 | 305 |
| 430 | 3300013306 | Ga0163162_10027068 | Ga0163162_100270683 | 305 |
| 431 | 3300014969 | Ga0157376_10011011 | Ga0157376_100110115 | 305 |
| 432 | 3300044712 | Ga0453684_0033105 | Ga0453684_0033105_6252_7175 | 305 |
| 433 | 3300048912 | Ga0496109_0110004 | Ga0496109_0110004_736_1653 | 305 |
| 434 | 3300042876 | Ga0451577_0023827 | Ga0451577_0023827_3595_4545 | 306 |
| 435 | 3300049568 | Ga0501031_0019753 | Ga0501031_0019753_609_1553 | 306 |
| 436 | 3300049569 | Ga0501032_0048570 | Ga0501032_0048570_881_1831 | 306 |
| 437 | 3300049570 | Ga0501033_0002339 | Ga0501033_0002339_11099_12049 | 306 |
| 438 | 3300049581 | Ga0501047_0000477 | Ga0501047_0000477_23375_24325 | 306 |
| 439 | 3300049822 | Ga0501035_0004651 | Ga0501035_0004651_3756_4706 | 306 |
| 440 | 3300049823 | Ga0501044_0000987 | Ga0501044_0000987_29955_30905 | 306 |
| 441 | 3300050491 | nmdc:mga00v17_8359_c1 | nmdc:mga00v17_8359_c1_958_1914 | 306 |
| 442 | iso_pu_bacteria | 2511231003 | 2511247467 | 306 |
| 443 | iso_pu_bacteria | 2548876994 | 2550696671 | 306 |
| 444 | iso_pu_bacteria | 2818991445 | 2819594338 | 306 |
| 445 | iso_pu_bacteria | 2884811622 | 2884811943 | 306 |
| 446 | iso_pu_bacteria | 2884836552 | 2884840735 | 306 |
| 447 | iso_pu_bacteria | 2884852848 | 2884857669 | 306 |
| 448 | iso_pu_bacteria | 2896154374 | 2896158609 | 306 |
| 449 | 3300014969 | Ga0157376_10277505 | Ga0157376_102775052 | 307 |
| 450 | 3300002704 | JGI25155J39150_1000860 | JGI25155J39150_10008602 | 310 |
| 451 | 3300002705 | JGI25156J39149_1004273 | JGI25156J39149_10042732 | 310 |
| 452 | 3300002738 | JGI25154J39366_1000267 | JGI25154J39366_10002672 | 310 |
| 453 | 3300005337 | Ga0070682_100001863 | Ga0070682_10000186310 | 310 |
| 454 | 3300005339 | Ga0070660_100001978 | Ga0070660_10000197818 | 310 |
| 455 | 3300005344 | Ga0070661_100024519 | Ga0070661_1000245194 | 310 |
| 456 | 3300005366 | Ga0070659_100001966 | Ga0070659_1000019669 | 310 |
| 457 | 3300005563 | Ga0068855_100138140 | Ga0068855_1001381402 | 310 |
| 458 | 3300005564 | Ga0070664_100005596 | Ga0070664_1000055964 | 310 |
| 459 | 3300005616 | Ga0068852_100007873 | Ga0068852_1000078732 | 310 |
| 460 | 3300006038 | Ga0075365_10106431 | Ga0075365_101064311 | 310 |
| 461 | 3300006195 | Ga0075366_10048007 | Ga0075366_100480073 | 310 |
| 462 | 3300010375 | Ga0105239_10391261 | Ga0105239_103912612 | 310 |
| 463 | 3300025206 | Ga0209435_100137 | Ga0209435_1001377 | 310 |
| 464 | 3300025233 | Ga0209437_100081 | Ga0209437_100081241 | 310 |
| 465 | 3300025246 | Ga0209646_1000290 | Ga0209646_100029035 | 310 |
| 466 | 3300025250 | Ga0209026_1002521 | Ga0209026_10025212 | 310 |
| 467 | 3300025256 | Ga0209759_1000485 | Ga0209759_10004858 | 310 |
| 468 | 3300025913 | Ga0207695_10036426 | Ga0207695_100364264 | 310 |
| 469 | 3300025919 | Ga0207657_10001495 | Ga0207657_1000149516 | 310 |
| 470 | 3300025920 | Ga0207649_10010050 | Ga0207649_100100503 | 310 |
| 471 | 3300025932 | Ga0207690_10000959 | Ga0207690_1000095930 | 310 |
| 472 | 3300025945 | Ga0207679_10009097 | Ga0207679_100090978 | 310 |
| 473 | 3300025949 | Ga0207667_10049848 | Ga0207667_100498482 | 310 |
| 474 | 3300037312 | Ga0395899_0002882 | Ga0395899_0002882_6439_7371 | 310 |
| 475 | 3300037312 | Ga0395899_0003628 | Ga0395899_0003628_8445_9377 | 310 |
| 476 | 3300037418 | Ga0395900_0022527 | Ga0395900_0022527_226_1158 | 310 |
| 477 | 3300037466 | Ga0395898_0006001 | Ga0395898_0006001_3133_4065 | 310 |
| 478 | 3300037471 | Ga0395905_0000549 | Ga0395905_0000549_16323_17255 | 310 |
| 479 | 3300037471 | Ga0395905_0006051 | Ga0395905_0006051_7271_8203 | 310 |
| 480 | 3300037471 | Ga0395905_0306319 | Ga0395905_0306319_479_1411 | 310 |
| 481 | 3300038443 | Ga0395901_0038998 | Ga0395901_0038998_567_1499 | 310 |
| 482 | 3300042001 | Ga0439441_017807 | Ga0439441_017807_102_1034 | 310 |
| 483 | 3300044658 | Ga0466972_0000140 | Ga0466972_0000140_49598_50530 | 310 |
| 484 | 3300044658 | Ga0466972_0018698 | Ga0466972_0018698_871_1803 | 310 |
| 485 | 3300044658 | Ga0466972_0032616 | Ga0466972_0032616_488_1420 | 310 |
| 486 | 3300044683 | Ga0466965_0000818 | Ga0466965_0000818_900_1832 | 310 |
| 487 | 3300044683 | Ga0466965_0096169 | Ga0466965_0096169_554_1486 | 310 |
| 488 | 3300044684 | Ga0466966_0021631 | Ga0466966_0021631_1875_2807 | 310 |
| 489 | 3300044735 | Ga0466968_0010668 | Ga0466968_0010668_2392_3324 | 310 |
| 490 | 3300044735 | Ga0466968_0044342 | Ga0466968_0044342_659_1591 | 310 |
| 491 | 3300044765 | Ga0466970_0040382 | Ga0466970_0040382_53_985 | 310 |
| 492 | 3300045049 | Ga0466959_0229485 | Ga0466959_0229485_266_1198 | 310 |
| 493 | 3300046528 | Ga0495642_0041153 | Ga0495642_0041153_909_1841 | 310 |
| 494 | 3300046539 | Ga0495621_0015334 | Ga0495621_0015334_878_1810 | 310 |
| 495 | 3300047443 | Ga0495687_026256 | Ga0495687_026256_329_1261 | 310 |
| 496 | 3300048903 | Ga0496100_0356114 | Ga0496100_0356114_19_951 | 310 |
| 497 | 3300048905 | Ga0496102_0388129 | Ga0496102_0388129_189_1121 | 310 |
| 498 | 3300048906 | Ga0496103_0034885 | Ga0496103_0034885_940_1872 | 310 |
| 499 | 3300048907 | Ga0496104_0231159 | Ga0496104_0231159_683_1615 | 310 |
| 500 | 3300048908 | Ga0496105_0025340 | Ga0496105_0025340_3416_4348 | 310 |
| 501 | 3300048909 | Ga0496106_0044158 | Ga0496106_0044158_628_1560 | 310 |
| 502 | 3300048911 | Ga0496108_0034865 | Ga0496108_0034865_2079_3011 | 310 |
| 503 | 3300048912 | Ga0496109_0194210 | Ga0496109_0194210_824_1756 | 310 |
| 504 | 3300048913 | Ga0496110_0129671 | Ga0496110_0129671_474_1406 | 310 |
| 505 | 3300048914 | Ga0496111_0010469 | Ga0496111_0010469_1512_2444 | 310 |
| 506 | 3300048924 | Ga0496121_0095272 | Ga0496121_0095272_843_1775 | 310 |
| 507 | 3300048925 | Ga0496122_0000968 | Ga0496122_0000968_11179_12111 | 310 |
| 508 | 3300048926 | Ga0496123_0004825 | Ga0496123_0004825_9056_9988 | 310 |
| 509 | 3300048928 | Ga0496125_0003499 | Ga0496125_0003499_5657_6589 | 310 |
| 510 | 3300048928 | Ga0496125_0027904 | Ga0496125_0027904_962_1894 | 310 |
| 511 | 3300049571 | Ga0501034_0143198 | Ga0501034_0143198_1338_2270 | 310 |
| 512 | iso_pu_bacteria | 2643221603 | 2644026952 | 310 |
| 513 | 3300046507 | Ga0495606_0004241 | Ga0495606_0004241_1581_2516 | 311 |
| 514 | 3300050508 | nmdc:mga09592_24148_c1 | nmdc:mga09592_24148_c1_2833_3768 | 311 |
| 515 | 3300050510 | nmdc:mga06r32_4702_c1 | nmdc:mga06r32_4702_c1_11054_11989 | 311 |
| 516 | 3300005564 | Ga0070664_100000867 | Ga0070664_1000008673 | 314 |
| 517 | 3300005564 | Ga0070664_100111270 | Ga0070664_1001112701 | 314 |
| 518 | 3300027866 | Ga0209813_10036632 | Ga0209813_100366322 | 314 |
| 519 | 3300050489 | nmdc:mga03683_75369_c1 | nmdc:mga03683_75369_c1_112_1092 | 314 |
| 520 | 3300050490 | nmdc:mga03n38_173962_c1 | nmdc:mga03n38_173962_c1_100_1080 | 314 |
| 521 | 3300050492 | nmdc:mga0yw44_7154_c1 | nmdc:mga0yw44_7154_c1_2402_3382 | 314 |
| 522 | 3300050493 | nmdc:mga0k408_24801_c1 | nmdc:mga0k408_24801_c1_985_1965 | 314 |
| 523 | 3300050494 | nmdc:mga06z11_32248_c1 | nmdc:mga06z11_32248_c1_1431_2411 | 314 |
| 524 | 3300037418 | Ga0395900_0075864 | Ga0395900_0075864_221_1258 | 315 |
| 525 | 3300037471 | Ga0395905_0001839 | Ga0395905_0001839_21417_22454 | 315 |
| 526 | 3300038443 | Ga0395901_0542918 | Ga0395901_0542918_49_1032 | 315 |
| 527 | 3300006051 | Ga0075364_10003430 | Ga0075364_100034304 | 316 |
| 528 | 3300053125 | Ga0500618_012093 | Ga0500618_012093_340_1338 | 316 |
| 529 | 3300046522 | Ga0495643_0045162 | Ga0495643_0045162_628_1671 | 317 |
| 530 | 3300046528 | Ga0495642_0006014 | Ga0495642_0006014_913_1956 | 317 |
| 531 | 3300046616 | Ga0495668_0165523 | Ga0495668_0165523_40_1083 | 317 |
| 532 | 3300046665 | Ga0495661_0001479 | Ga0495661_0001479_10654_11697 | 317 |
| 533 | 3300002704 | JGI25155J39150_1000170 | JGI25155J39150_10001702 | 320 |
| 534 | 3300002705 | JGI25156J39149_1000293 | JGI25156J39149_100029332 | 320 |
| 535 | 3300002738 | JGI25154J39366_1000260 | JGI25154J39366_100026032 | 320 |
| 536 | 3300002741 | JGI25157J39369_1000327 | JGI25157J39369_100032732 | 320 |
| 537 | 3300003758 | Ga0055532_1000184 | Ga0055532_100018432 | 320 |
| 538 | 3300003761 | Ga0055535_1015487 | Ga0055535_10154871 | 320 |
| 539 | 3300005614 | Ga0068856_100092712 | Ga0068856_1000927122 | 320 |
| 540 | 3300009093 | Ga0105240_10001692 | Ga0105240_100016924 | 320 |
| 541 | 3300009551 | Ga0105238_10054933 | Ga0105238_100549334 | 320 |
| 542 | 3300025206 | Ga0209435_100079 | Ga0209435_10007937 | 320 |
| 543 | 3300025229 | Ga0209147_100060 | Ga0209147_100060210 | 320 |
| 544 | 3300025242 | Ga0209258_100141 | Ga0209258_10014126 | 320 |
| 545 | 3300025246 | Ga0209646_1000265 | Ga0209646_100026528 | 320 |
| 546 | 3300025250 | Ga0209026_1000330 | Ga0209026_100033028 | 320 |
| 547 | 3300025256 | Ga0209759_1000473 | Ga0209759_100047316 | 320 |
| 548 | 3300026078 | Ga0207702_10080387 | Ga0207702_100803872 | 320 |
| 549 | 3300046660 | Ga0495625_0009260 | Ga0495625_0009260_1696_2841 | 320 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9388 | 15 | 234 |
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9372 | 16 | 241 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9337 | 13 | 234 |
| 7nnu-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs | 0.933 | 15 | 237 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9317 | 16 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9683 | 17 | 241 | 3.40.50.300 |
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9663 | 12 | 241 | 3.40.50.300 |
| af_P36879_1_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9661 | 15 | 241 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9644 | 15 | 242 | 3.40.50.300 |
| af_Q8T5Z7_540_794_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9634 | 10 | 242 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A511X0H7-F1-model_v4 | ABC transporter domain-containing protein | 0.9776 | 15 | 200 |
GO:0005524
GO:0016887 |
| AF-A0A7S1AQ71-F1-model_v4 | ABC transporter domain-containing protein | 0.9723 | 17 | 162 |
GO:0005319
GO:0005524 GO:0016020 GO:0016887 GO:0043231 GO:0140359 |
| AF-A0A2W7B2T3-F1-model_v4 | Multidrug ABC transporter ATP-binding protein | 0.9711 | 15 | 224 |
GO:0005524
GO:0016887 |
| AF-A0A0D1P4L1-F1-model_v4 | deleted | 0.9639 | 11 | 241 |
|
| AF-A0A1L8R8A0-F1-model_v4 | Quaternary amine transport ATP-binding protein (EC 7.6.2.9) | 0.9615 | 15 | 241 |
GO:0005524
GO:0005886 GO:0006865 GO:0016887 GO:0031460 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar