F462333

General Info

Members Datasets Scaffolds Average Seq Length
549 233 544 341

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100104687|Ga0070664_1001046871
Length 378
Sequence MKALQSSNLCEGSSLKPDKGFLFSPYPFADNFAAVELIAVCLQIIFYSLTMNIPKFSGIHHSFHKELKAKIGEYFLEVGSSTTGNYKLFLKAVILMVSFTVVYIHLVFFTPAVSWQVLESILLGGLVAAIGFNVMHDGAHGSFSKYKWINRLAAFSLNILGGNTFMWNMKHNIIHHAYTNIDGVDDDIDIQPWLRMSTTQKKYRMHKYQHLYFWILYSMLYIFWVFLLDYQKYFNRRIGNMPVKKMNWSDHLIFWGFKLFHLFLFIGLPVYKVGFESWLIAFPVANAETGNMEDEWAIHQLKTTANFATKNKVVTWLIGGLNFQIEHHLFPKISHIHYPALHDILRKVCEERGLNYIEYKNVRFAIASHVAFLRQMGQ

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
199 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
200 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
203 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
218 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.55
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0.55
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017736 3300001979 Bacteria 2538
2 JGI24751J29686_10001206 3300002459 Bacteria 5477
3 JGI25406J46586_10004539 3300003203 Bacteria 6465
4 rootH2_10018154 3300003320 Bacteria 24243
5 rootH2_10054060 3300003320 Bacteria 9404
6 rootH2_10059512 3300003320 Bacteria 4603
7 rootH2_10173704 3300003320 Bacteria 4095
8 rootL2_10254500 3300003322 Bacteria 1721
9 rootL2_10312626 3300003322 Bacteria 2728
10 rootH1_10011481 3300003323 Bacteria 18162
11 rootH1_10148454 3300003323 Bacteria 4937
12 JGI25160J50197_1010888 3300003354 Bacteria 3260
13 Ga0065712_10137454 3300005290 Bacteria 1483
14 Ga0065707_10162810 3300005295 Bacteria 1548
15 Ga0070658_10069420 3300005327 Bacteria 2883
16 Ga0070676_10144875 3300005328 Bacteria 1515
17 Ga0070683_100000286 3300005329 Bacteria 34774
18 Ga0070683_100046056 3300005329 Bacteria 4027
19 Ga0070683_100050964 3300005329 Bacteria 3834
20 Ga0070683_100169319 3300005329 Bacteria 2073
21 Ga0070690_100025529 3300005330 Bacteria 3639
22 Ga0070670_100109431 3300005331 Bacteria 2381
23 Ga0070670_100229580 3300005331 Bacteria 1615
24 Ga0068869_100018905 3300005334 Bacteria 4697
25 Ga0068869_100163862 3300005334 Bacteria 1732
26 Ga0068869_100269403 3300005334 Bacteria 1366
27 Ga0070666_10000135 3300005335 Bacteria 51126
28 Ga0070666_10025453 3300005335 Bacteria 3858
29 Ga0070682_100027228 3300005337 Bacteria 3429
30 Ga0068868_100001462 3300005338 Bacteria 16301
31 Ga0068868_100015057 3300005338 Bacteria 5712
32 Ga0068868_100023876 3300005338 Bacteria 4633
33 Ga0068868_100063507 3300005338 Bacteria 2929
34 Ga0070660_100005869 3300005339 Bacteria 8498
35 Ga0070660_100327542 3300005339 Bacteria 1259
36 Ga0070691_10013653 3300005341 Bacteria 3723
37 Ga0070691_10060478 3300005341 Bacteria 1821
38 Ga0070661_100000587 3300005344 Bacteria 27509
39 Ga0070661_100037944 3300005344 Bacteria 3506
40 Ga0070668_100022068 3300005347 Unclassified 4812
41 Ga0070668_100302736 3300005347 Bacteria 1341
42 Ga0070669_100130702 3300005353 Bacteria 1926
43 Ga0070675_100009802 3300005354 Bacteria 7463
44 Ga0070675_100080758 3300005354 Bacteria 2711
45 Ga0070675_100259974 3300005354 Bacteria 1521
46 Ga0070671_100015192 3300005355 Bacteria 6219
47 Ga0070671_100350031 3300005355 Bacteria 1261
48 Ga0070674_100195774 3300005356 Bacteria 1557
49 Ga0070673_100034526 3300005364 Bacteria 3828
50 Ga0070673_100040582 3300005364 Bacteria 3571
51 Ga0070673_100053086 3300005364 Bacteria 3182
52 Ga0070673_100065753 3300005364 Unclassified 2894
53 Ga0070673_100190184 3300005364 Bacteria 1762
54 Ga0070673_100200000 3300005364 Bacteria 1721
55 Ga0070688_100069143 3300005365 Bacteria 2254
56 Ga0070659_100004142 3300005366 Bacteria 10339
57 Ga0070659_100079423 3300005366 Unclassified 2619
58 Ga0070667_100007115 3300005367 Bacteria 9303
59 Ga0070667_100026170 3300005367 Bacteria 4852
60 Ga0070667_100038061 3300005367 Bacteria 4033
61 Ga0070667_100071321 3300005367 Bacteria 2959
62 Ga0070667_100087878 3300005367 Bacteria 2668
63 Ga0070678_100019430 3300005456 Unclassified 4429
64 Ga0070662_100033889 3300005457 Bacteria 3599
65 Ga0070662_100047095 3300005457 Unclassified 3100
66 Ga0070662_100054582 3300005457 Bacteria 2896
67 Ga0070662_100074155 3300005457 Bacteria 2516
68 Ga0070662_100087843 3300005457 Bacteria 2329
69 Ga0068867_100041789 3300005459 Bacteria 3351
70 Ga0068867_100058992 3300005459 Bacteria 2844
71 Ga0068867_100270748 3300005459 Bacteria 1388
72 Ga0070698_100001497 3300005471 Bacteria 25950
73 Ga0070698_100010867 3300005471 Bacteria 9686
74 Ga0070698_100091935 3300005471 Bacteria 3016
75 Ga0070684_100000500 3300005535 Bacteria 26969
76 Ga0070684_100001699 3300005535 Bacteria 16028
77 Ga0070684_100012410 3300005535 Bacteria 6828
78 Ga0070684_100022651 3300005535 Bacteria 5243
79 Ga0070684_100077250 3300005535 Bacteria 2940
80 Ga0068853_100000675 3300005539 Bacteria 23525
81 Ga0068853_100008829 3300005539 Bacteria 8107
82 Ga0068853_100015298 3300005539 Bacteria 6306
83 Ga0068853_100020744 3300005539 Bacteria 5465
84 Ga0068853_100175180 3300005539 Bacteria 1943
85 Ga0068853_100181447 3300005539 Bacteria 1909
86 Ga0070672_100288642 3300005543 Unclassified 1389
87 Ga0070665_100000001 3300005548 Bacteria 1083363
88 Ga0070665_100116956 3300005548 Bacteria 2669
89 Ga0068855_100000089 3300005563 Bacteria 110845
90 Ga0068855_100007823 3300005563 Bacteria 12912
91 Ga0068855_100029591 3300005563 Bacteria 6547
92 Ga0068855_100178309 3300005563 Bacteria 2403
93 Ga0070664_100009022 3300005564 Bacteria 8090
94 Ga0070664_100034828 3300005564 Bacteria 4225
95 Ga0070664_100104687 3300005564 Bacteria 2464
96 Ga0070664_100114800 3300005564 Bacteria 2353
97 Ga0068857_100002744 3300005577 Bacteria 14466
98 Ga0068857_100178860 3300005577 Bacteria 1930
99 Ga0068854_100038918 3300005578 Bacteria 3347
100 Ga0068854_100061642 3300005578 Bacteria 2717
101 Ga0068854_100075950 3300005578 Bacteria 2468
102 Ga0068854_100275389 3300005578 Bacteria 1353
103 Ga0068856_100100991 3300005614 Bacteria 2878
104 Ga0068856_100117066 3300005614 Bacteria 2665
105 Ga0068856_100352985 3300005614 Bacteria 1489
106 Ga0068852_100003713 3300005616 Bacteria 10697
107 Ga0068852_100004864 3300005616 Bacteria 9542
108 Ga0068852_100050545 3300005616 Bacteria 3562
109 Ga0068852_100053779 3300005616 Bacteria 3467
110 Ga0068852_100065071 3300005616 Bacteria 3180
111 Ga0068852_100114339 3300005616 Unclassified 2459
112 Ga0068852_100228746 3300005616 Bacteria 1772
113 Ga0068859_100000127 3300005617 Bacteria 72136
114 Ga0068859_100020688 3300005617 Bacteria 6603
115 Ga0068859_100061172 3300005617 Bacteria 3794
116 Ga0068859_100065804 3300005617 Bacteria 3658
117 Ga0068859_100278856 3300005617 Bacteria 1764
118 Ga0068859_100354358 3300005617 Bacteria 1562
119 Ga0068859_100599706 3300005617 Bacteria 1194
120 Ga0068864_100056928 3300005618 Bacteria 3377
121 Ga0068864_100057779 3300005618 Bacteria 3352
122 Ga0068864_100080607 3300005618 Bacteria 2852
123 Ga0068864_100104838 3300005618 Bacteria 2512
124 Ga0068864_100269616 3300005618 Bacteria 1586
125 Ga0068866_10031840 3300005718 Bacteria 2544
126 Ga0068866_10101401 3300005718 Bacteria 1588
127 Ga0068861_100016204 3300005719 Bacteria 5269
128 Ga0068851_10019688 3300005834 Bacteria 3262
129 Ga0068851_10036193 3300005834 Unclassified 2471
130 Ga0068851_10103630 3300005834 Bacteria 1512
131 Ga0068863_100001425 3300005841 Bacteria 23686
132 Ga0068863_100189534 3300005841 Bacteria 1976
133 Ga0068863_100312084 3300005841 Unclassified 1526
134 Ga0068863_100347784 3300005841 Bacteria 1443
135 Ga0068858_100130092 3300005842 Unclassified 2360
136 Ga0068860_100000111 3300005843 Bacteria 131004
137 Ga0068860_100002119 3300005843 Bacteria 20918
138 Ga0068860_100013041 3300005843 Bacteria 8157
139 Ga0068860_100014120 3300005843 Bacteria 7833
140 Ga0068860_100018651 3300005843 Bacteria 6747
141 Ga0068862_100132990 3300005844 Bacteria 2202
142 Ga0081539_10000910 3300005985 Bacteria 55996
143 Ga0081539_10045078 3300005985 Unclassified 2539
144 Ga0075366_10044326 3300006195 Bacteria 2636
145 Ga0075366_10173865 3300006195 Bacteria 1307
146 Ga0097621_100002660 3300006237 Bacteria 12228
147 Ga0097621_100062398 3300006237 Bacteria 3060
148 Ga0097621_100077860 3300006237 Bacteria 2753
149 Ga0068871_100059370 3300006358 Unclassified 3116
150 Ga0068871_100068598 3300006358 Bacteria 2912
151 Ga0068871_100099509 3300006358 Bacteria 2434
152 Ga0068871_100109732 3300006358 Bacteria 2320
153 Ga0068871_100133752 3300006358 Bacteria 2104
154 Ga0068871_100318726 3300006358 Bacteria 1368
155 Ga0075428_100061991 3300006844 Bacteria 4095
156 Ga0075428_100216409 3300006844 Unclassified 2069
157 Ga0075430_100015730 3300006846 Bacteria 6444
158 Ga0075431_100359144 3300006847 Unclassified 1463
159 Ga0075429_100002013 3300006880 Bacteria 16893
160 Ga0097620_100000127 3300006931 Bacteria 72136
161 Ga0097620_100020689 3300006931 Bacteria 6603
162 Ga0097620_100061176 3300006931 Bacteria 3794
163 Ga0097620_100065800 3300006931 Bacteria 3658
164 Ga0097620_100278854 3300006931 Bacteria 1764
165 Ga0097620_100354394 3300006931 Bacteria 1562
166 Ga0097620_100599736 3300006931 Bacteria 1194
167 Ga0105240_10000074 3300009093 Bacteria 199611
168 Ga0105240_10000513 3300009093 Bacteria 71427
169 Ga0105240_10001630 3300009093 Bacteria 38080
170 Ga0105240_10003016 3300009093 Bacteria 26478
171 Ga0105240_10013866 3300009093 Bacteria 11038
172 Ga0105240_10036376 3300009093 Bacteria 6335
173 Ga0105240_10042091 3300009093 Bacteria 5823
174 Ga0105240_10076125 3300009093 Bacteria 4138
175 Ga0105240_10087359 3300009093 Bacteria 3819
176 Ga0105245_10168278 3300009098 Bacteria 2085
177 Ga0105247_10004365 3300009101 Bacteria 9034
178 Ga0114129_10004521 3300009147 Bacteria 19629
179 Ga0114129_10154899 3300009147 Unclassified 3134
180 Ga0105243_10132994 3300009148 Bacteria 2113
181 Ga0105241_10001544 3300009174 Bacteria 17662
182 Ga0105241_10195770 3300009174 Bacteria 1685
183 Ga0105241_10196900 3300009174 Unclassified 1681
184 Ga0105241_10404235 3300009174 Bacteria 1198
185 Ga0105242_10145295 3300009176 Bacteria 2063
186 Ga0105237_10000528 3300009545 Bacteria 53756
187 Ga0105237_10000959 3300009545 Bacteria 38808
188 Ga0105237_10001503 3300009545 Bacteria 30687
189 Ga0105237_10014968 3300009545 Bacteria 8085
190 Ga0105237_10021302 3300009545 Bacteria 6666
191 Ga0105237_10026382 3300009545 Bacteria 5938
192 Ga0105237_10116470 3300009545 Bacteria 2665
193 Ga0105238_10001119 3300009551 Bacteria 27090
194 Ga0105238_10045942 3300009551 Bacteria 4410
195 Ga0105249_10004091 3300009553 Bacteria 12592
196 Ga0105249_10013937 3300009553 Bacteria 7106
197 Ga0105249_10019556 3300009553 Bacteria 6043
198 Ga0105249_10020018 3300009553 Bacteria 5975
199 Ga0105249_10071328 3300009553 Bacteria 3209
200 Ga0105239_10000048 3300010375 Bacteria 177855
201 Ga0105239_10000314 3300010375 Bacteria 71313
202 Ga0105239_10000853 3300010375 Bacteria 43358
203 Ga0105239_10003942 3300010375 Bacteria 17981
204 Ga0105239_10005365 3300010375 Bacteria 15050
205 Ga0105239_10007377 3300010375 Bacteria 12632
206 Ga0105239_10044414 3300010375 Bacteria 4872
207 Ga0105239_10102864 3300010375 Bacteria 3161
208 Ga0105239_10171663 3300010375 Bacteria 2425
209 Ga0105239_10234421 3300010375 Unclassified 2060
210 Ga0105246_10010437 3300011119 Bacteria 5748
211 Ga0105246_10102753 3300011119 Bacteria 2084
212 Ga0105246_10326199 3300011119 Bacteria 1250
213 Ga0105246_10480046 3300011119 Bacteria 1051
214 Ga0157373_10009280 3300013100 Bacteria 7273
215 Ga0157373_10035500 3300013100 Bacteria 3579
216 Ga0157373_10055805 3300013100 Bacteria 2806
217 Ga0157371_10001020 3300013102 Bacteria 30696
218 Ga0157371_10028492 3300013102 Bacteria 4044
219 Ga0157371_10037354 3300013102 Bacteria 3476
220 Ga0157371_10057839 3300013102 Bacteria 2750
221 Ga0157371_10120156 3300013102 Bacteria 1868
222 Ga0157371_10138006 3300013102 Unclassified 1737
223 Ga0157370_10001415 3300013104 Bacteria 29777
224 Ga0157370_10041237 3300013104 Bacteria 4455
225 Ga0157370_10069622 3300013104 Bacteria 3322
226 Ga0157370_10184598 3300013104 Bacteria 1937
227 Ga0157369_10006103 3300013105 Bacteria 13988
228 Ga0157369_10027153 3300013105 Bacteria 6348
229 Ga0157369_10030133 3300013105 Bacteria 5986
230 Ga0157369_10040391 3300013105 Bacteria 5093
231 Ga0157369_10071400 3300013105 Bacteria 3727
232 Ga0157374_10000001 3300013296 Bacteria 1077351
233 Ga0157374_10003011 3300013296 Bacteria 14108
234 Ga0157374_10003032 3300013296 Bacteria 14074
235 Ga0157374_10062178 3300013296 Bacteria 3498
236 Ga0157374_10131353 3300013296 Bacteria 2424
237 Ga0157374_10219037 3300013296 Bacteria 1867
238 Ga0157378_10007196 3300013297 Bacteria 9719
239 Ga0157378_10023654 3300013297 Bacteria 5404
240 Ga0157378_10036254 3300013297 Bacteria 4365
241 Ga0157378_10039467 3300013297 Bacteria 4187
242 Ga0157378_10067150 3300013297 Bacteria 3213
243 Ga0157378_10100844 3300013297 Unclassified 2636
244 Ga0157378_10409050 3300013297 Unclassified 1339
245 Ga0163162_10000101 3300013306 Bacteria 77114
246 Ga0163162_10001972 3300013306 Bacteria 19287
247 Ga0163162_10006817 3300013306 Bacteria 11081
248 Ga0163162_10009348 3300013306 Bacteria 9533
249 Ga0163162_10048158 3300013306 Unclassified 4270
250 Ga0163162_10052382 3300013306 Bacteria 4099
251 Ga0163162_10240382 3300013306 Bacteria 1942
252 Ga0163162_10260490 3300013306 Bacteria 1866
253 Ga0163162_10378333 3300013306 Bacteria 1549
254 Ga0157372_10000804 3300013307 Bacteria 34050
255 Ga0157372_10006994 3300013307 Bacteria 12017
256 Ga0157372_10053241 3300013307 Bacteria 4510
257 Ga0157372_10062681 3300013307 Bacteria 4167
258 Ga0157372_10087013 3300013307 Bacteria 3545
259 Ga0157372_10103722 3300013307 Bacteria 3250
260 Ga0157372_10365602 3300013307 Unclassified 1681
261 Ga0157372_10476882 3300013307 Bacteria 1454
262 Ga0157372_10533126 3300013307 Bacteria 1368
263 Ga0157372_10683193 3300013307 Unclassified 1195
264 Ga0157375_10014733 3300013308 Bacteria 6987
265 Ga0157375_10029657 3300013308 Bacteria 5148
266 Ga0157375_10029793 3300013308 Bacteria 5137
267 Ga0157375_10046139 3300013308 Bacteria 4246
268 Ga0157375_10065040 3300013308 Bacteria 3634
269 Ga0157375_10084355 3300013308 Bacteria 3225
270 Ga0157375_10129201 3300013308 Bacteria 2645
271 Ga0163163_10000814 3300014325 Bacteria 26541
272 Ga0163163_10066226 3300014325 Bacteria 3587
273 Ga0163163_10107139 3300014325 Bacteria 2821
274 Ga0163163_10172362 3300014325 Bacteria 2210
275 Ga0163163_10230350 3300014325 Bacteria 1902
276 Ga0157380_10032056 3300014326 Bacteria 4039
277 Ga0157380_10248440 3300014326 Bacteria 1609
278 Ga0157377_10059084 3300014745 Bacteria 2185
279 Ga0157379_10045049 3300014968 Bacteria 3938
280 Ga0157379_10063775 3300014968 Bacteria 3294
281 Ga0157379_10321746 3300014968 Bacteria 1412
282 Ga0157376_10000873 3300014969 Bacteria 19768
283 Ga0157376_10001271 3300014969 Bacteria 16567
284 Ga0157376_10003428 3300014969 Bacteria 10916
285 Ga0157376_10044788 3300014969 Bacteria 3639
286 Ga0157376_10102982 3300014969 Bacteria 2498
287 Ga0157376_10111960 3300014969 Bacteria 2404
288 Ga0157376_10151058 3300014969 Bacteria 2095
289 Ga0157376_10168720 3300014969 Bacteria 1991
290 Ga0157376_10175414 3300014969 Bacteria 1955
291 Ga0157376_10227606 3300014969 Unclassified 1730
292 Ga0157376_10360415 3300014969 Bacteria 1394
293 Ga0163161_10004936 3300017792 Bacteria 9279
294 Ga0163161_10055715 3300017792 Bacteria 2870
295 Ga0197907_11473226 3300020069 Bacteria 1426
296 Ga0206352_10291238 3300020078 Bacteria 1699
297 Ga0213876_10038630 3300021384 Bacteria 2520
298 Ga0209646_1005703 3300025246 Bacteria 2147
299 Ga0207426_1000093 3300025302 Bacteria 277663
300 Ga0207697_10026104 3300025315 Unclassified 2389
301 Ga0207656_10040412 3300025321 Bacteria 1977
302 Ga0207710_10006884 3300025900 Bacteria 4838
303 Ga0207688_10009233 3300025901 Bacteria 5373
304 Ga0207680_10000057 3300025903 Bacteria 50978
305 Ga0207647_10006207 3300025904 Bacteria 8710
306 Ga0207647_10014996 3300025904 Bacteria 5326
307 Ga0207647_10031509 3300025904 Bacteria 3412
308 Ga0207654_10004238 3300025911 Bacteria 7233
309 Ga0207654_10094308 3300025911 Unclassified 1831
310 Ga0207654_10134176 3300025911 Bacteria 1570
311 Ga0207695_10000071 3300025913 Bacteria 315568
312 Ga0207695_10000084 3300025913 Bacteria 282392
313 Ga0207695_10000323 3300025913 Bacteria 114265
314 Ga0207695_10001425 3300025913 Bacteria 40250
315 Ga0207695_10054570 3300025913 Bacteria 4172
316 Ga0207695_10065612 3300025913 Bacteria 3732
317 Ga0207695_10065774 3300025913 Bacteria 3726
318 Ga0207695_10091022 3300025913 Bacteria 3065
319 Ga0207671_10001538 3300025914 Bacteria 26445
320 Ga0207671_10002788 3300025914 Bacteria 18238
321 Ga0207671_10002808 3300025914 Bacteria 18119
322 Ga0207671_10033043 3300025914 Bacteria 3851
323 Ga0207671_10089518 3300025914 Bacteria 2316
324 Ga0207671_10141997 3300025914 Bacteria 1850
325 Ga0207657_10000998 3300025919 Bacteria 30073
326 Ga0207657_10069151 3300025919 Unclassified 2997
327 Ga0207657_10175233 3300025919 Bacteria 1736
328 Ga0207657_10305677 3300025919 Bacteria 1259
329 Ga0207649_10039453 3300025920 Bacteria 2864
330 Ga0207649_10069932 3300025920 Bacteria 2237
331 Ga0207649_10080125 3300025920 Bacteria 2111
332 Ga0207694_10007044 3300025924 Bacteria 8534
333 Ga0207650_10017976 3300025925 Bacteria 4955
334 Ga0207650_10032543 3300025925 Bacteria 3771
335 Ga0207659_10064248 3300025926 Bacteria 2655
336 Ga0207659_10170224 3300025926 Bacteria 1718
337 Ga0207644_10172419 3300025931 Bacteria 1690
338 Ga0207690_10021469 3300025932 Bacteria 4005
339 Ga0207690_10167908 3300025932 Bacteria 1641
340 Ga0207706_10002905 3300025933 Bacteria 16574
341 Ga0207706_10011699 3300025933 Bacteria 8001
342 Ga0207706_10131472 3300025933 Bacteria 2201
343 Ga0207706_10165066 3300025933 Bacteria 1946
344 Ga0207686_10069603 3300025934 Bacteria 2258
345 Ga0207686_10125901 3300025934 Bacteria 1751
346 Ga0207704_10100571 3300025938 Bacteria 1926
347 Ga0207691_10158489 3300025940 Bacteria 1987
348 Ga0207689_10000359 3300025942 Bacteria 42877
349 Ga0207689_10000482 3300025942 Bacteria 37605
350 Ga0207689_10002539 3300025942 Bacteria 16945
351 Ga0207689_10002620 3300025942 Bacteria 16648
352 Ga0207689_10003101 3300025942 Bacteria 15285
353 Ga0207689_10029184 3300025942 Bacteria 4609
354 Ga0207689_10263463 3300025942 Bacteria 1426
355 Ga0207661_10002246 3300025944 Bacteria 13325
356 Ga0207661_10009997 3300025944 Bacteria 6818
357 Ga0207661_10021969 3300025944 Bacteria 4793
358 Ga0207661_10096932 3300025944 Bacteria 2468
359 Ga0207661_10103111 3300025944 Bacteria 2400
360 Ga0207679_10000363 3300025945 Bacteria 32874
361 Ga0207679_10007257 3300025945 Bacteria 7023
362 Ga0207679_10201914 3300025945 Bacteria 1661
363 Ga0207667_10000135 3300025949 Bacteria 111565
364 Ga0207667_10000177 3300025949 Bacteria 92852
365 Ga0207667_10013458 3300025949 Bacteria 9363
366 Ga0207667_10036693 3300025949 Bacteria 5249
367 Ga0207667_10227610 3300025949 Bacteria 1910
368 Ga0207651_10017211 3300025960 Bacteria 4263
369 Ga0207651_10028310 3300025960 Bacteria 3533
370 Ga0207651_10098369 3300025960 Bacteria 2163
371 Ga0207712_10001348 3300025961 Bacteria 16806
372 Ga0207712_10003852 3300025961 Bacteria 9475
373 Ga0207712_10192219 3300025961 Bacteria 1612
374 Ga0207712_10268560 3300025961 Bacteria 1386
375 Ga0207668_10047430 3300025972 Bacteria 2941
376 Ga0207640_10029027 3300025981 Bacteria 3390
377 Ga0207640_10049695 3300025981 Bacteria 2717
378 Ga0207640_10058267 3300025981 Bacteria 2544
379 Ga0207640_10254095 3300025981 Bacteria 1366
380 Ga0207658_10014460 3300025986 Bacteria 5405
381 Ga0207658_10019785 3300025986 Bacteria 4658
382 Ga0207658_10043573 3300025986 Bacteria 3263
383 Ga0207658_10049911 3300025986 Bacteria 3077
384 Ga0207658_10252784 3300025986 Bacteria 1498
385 Ga0207677_10210875 3300026023 Bacteria 1551
386 Ga0207703_10000924 3300026035 Bacteria 28603
387 Ga0207639_10004367 3300026041 Bacteria 9538
388 Ga0207639_10154197 3300026041 Bacteria 1927
389 Ga0207678_10062035 3300026067 Unclassified 3214
390 Ga0207678_10274611 3300026067 Unclassified 1446
391 Ga0207702_10008334 3300026078 Bacteria 8751
392 Ga0207702_10105517 3300026078 Bacteria 2496
393 Ga0207641_10000229 3300026088 Bacteria 72315
394 Ga0207641_10278011 3300026088 Bacteria 1573
395 Ga0207648_10014891 3300026089 Bacteria 7169
396 Ga0207648_10075182 3300026089 Bacteria 2945
397 Ga0207676_10004398 3300026095 Bacteria 9968
398 Ga0207676_10023601 3300026095 Bacteria 4541
399 Ga0207676_10028518 3300026095 Bacteria 4171
400 Ga0207676_10144128 3300026095 Unclassified 2043
401 Ga0207674_10008150 3300026116 Bacteria 12147
402 Ga0207674_10020026 3300026116 Bacteria 7237
403 Ga0207674_10025163 3300026116 Bacteria 6351
404 Ga0207674_10137555 3300026116 Bacteria 2403
405 Ga0207674_10158731 3300026116 Bacteria 2216
406 Ga0207675_100029699 3300026118 Bacteria 5091
407 Ga0207683_10002317 3300026121 Bacteria 16706
408 Ga0207683_10019343 3300026121 Bacteria 5815
409 Ga0207698_10005346 3300026142 Bacteria 7920
410 Ga0207698_10014331 3300026142 Bacteria 5267
411 Ga0207698_10033742 3300026142 Bacteria 3723
412 Ga0207698_10115022 3300026142 Unclassified 2264
413 Ga0207698_10124061 3300026142 Bacteria 2192
414 Ga0207698_10380241 3300026142 Bacteria 1343
415 Ga0268266_10000049 3300028379 Bacteria 307763
416 Ga0268264_10000313 3300028381 Bacteria 77820
417 Ga0268264_10003106 3300028381 Bacteria 14382
418 Ga0268264_10003271 3300028381 Bacteria 14012
419 Ga0268264_10006832 3300028381 Bacteria 9583
420 Ga0268264_10007090 3300028381 Bacteria 9391
421 Ga0268264_10120734 3300028381 Bacteria 2309
422 Ga0268264_10132719 3300028381 Bacteria 2210
423 Ga0307517_10003658 3300028786 Bacteria 23904
424 Ga0307515_10004330 3300028794 Bacteria 29440
425 Ga0307511_10000276 3300030521 Bacteria 53817
426 Ga0265327_10000208 3300031251 Bacteria 123034
427 Ga0265327_10008831 3300031251 Bacteria 7420
428 Ga0307513_10020895 3300031456 Bacteria 7746
429 Ga0307513_10236389 3300031456 Bacteria 1636
430 Ga0307508_10003266 3300031616 Bacteria 16542
431 Ga0307516_10001231 3300031730 Bacteria 35640
432 Ga0307516_10007511 3300031730 Bacteria 12531
433 Ga0307510_10008266 3300033180 Bacteria 12402
434 Ga0373933_0014955 3300035724 Bacteria 4322
435 Ga0395900_0086388 3300037418 Unclassified 3224
436 Ga0395900_0149033 3300037418 Bacteria 2391
437 Ga0395905_0005533 3300037471 Bacteria 12891
438 Ga0395901_0067789 3300038443 Bacteria 3717
439 Ga0436365_1029016 3300039437 Bacteria 11135
440 Ga0439449_0000790 3300042007 Bacteria 12217
441 Ga0439462_0014667 3300042015 Bacteria 2015
442 Ga0451577_0016751 3300042876 Bacteria 6778
443 Ga0451577_0023257 3300042876 Bacteria 5653
444 Ga0451577_0084867 3300042876 Unclassified 2826
445 Ga0466972_0000212 3300044658 Bacteria 41192
446 Ga0466972_0045611 3300044658 Bacteria 2124
447 Ga0453684_0000792 3300044712 Bacteria 108377
448 Ga0453684_0056943 3300044712 Bacteria 5066
449 Ga0466970_0057596 3300044765 Bacteria 2078
450 Ga0466970_0103601 3300044765 Bacteria 1551
451 Ga0451576_0226897 3300045051 Bacteria 1950
452 Ga0466958_0036163 3300045836 Bacteria 2955
453 Ga0495638_0042271 3300046460 Bacteria 2880
454 Ga0495638_0053614 3300046460 Bacteria 2510
455 Ga0495650_0041751 3300046471 Bacteria 1959
456 Ga0495580_0176093 3300046472 Bacteria 1478
457 Ga0495628_0182808 3300046516 Unclassified 1585
458 Ga0495632_0106646 3300046519 Bacteria 1318
459 Ga0495648_0017177 3300046524 Bacteria 5183
460 Ga0495640_0093167 3300046533 Unclassified 1986
461 Ga0495587_0113644 3300046536 Bacteria 1554
462 Ga0495668_0005369 3300046616 Bacteria 8731
463 Ga0495611_0010000 3300046648 Bacteria 4013
464 Ga0495625_0158810 3300046660 Bacteria 1516
465 Ga0495625_0193296 3300046660 Bacteria 1347
466 Ga0495649_0052933 3300046694 Bacteria 2199
467 Ga0495636_0000078 3300047318 Bacteria 40643
468 Ga0495672_0030543 3300047320 Bacteria 3378
469 Ga0495687_000001 3300047443 Bacteria 1215582
470 Ga0495686_0000004 3300047472 Bacteria 869019
471 Ga0496104_0357557 3300048907 Unclassified 1373
472 Ga0496112_0331348 3300048915 Bacteria 1466
473 Ga0496115_0014115 3300048918 Bacteria 6046
474 Ga0501335_003415 3300049551 Unclassified 1345
475 Ga0501032_0002810 3300049569 Bacteria 13533
476 Ga0501032_0047032 3300049569 Bacteria 2915
477 Ga0501033_0126112 3300049570 Bacteria 1856
478 Ga0501034_0026330 3300049571 Bacteria 5924
479 Ga0501034_0028766 3300049571 Bacteria 5654
480 Ga0501036_0006337 3300049572 Bacteria 9602
481 Ga0501037_0007731 3300049573 Bacteria 7868
482 Ga0501037_0032924 3300049573 Bacteria 3830
483 Ga0501038_0010161 3300049574 Bacteria 8616
484 Ga0501038_0064235 3300049574 Bacteria 3131
485 Ga0501039_0076202 3300049575 Bacteria 2607
486 Ga0501043_0002617 3300049579 Bacteria 15178
487 Ga0501043_0010495 3300049579 Bacteria 7255
488 Ga0501043_0027182 3300049579 Bacteria 4492
489 Ga0501043_0033385 3300049579 Bacteria 4049
490 Ga0501046_0025486 3300049580 Bacteria 4839
491 Ga0501047_0026103 3300049581 Bacteria 5618
492 Ga0501047_0062647 3300049581 Bacteria 3587
493 Ga0501047_0272635 3300049581 Bacteria 1538
494 Ga0501048_0013370 3300049582 Bacteria 6091
495 Ga0501067_0014205 3300049583 Bacteria 4411
496 Ga0501072_0187004 3300049588 Bacteria 1652
497 Ga0501073_0020528 3300049589 Bacteria 4763
498 Ga0501198_013444 3300049649 Unclassified 1239
499 Ga0501202_002400 3300049652 Bacteria 3140
500 Ga0501206_003203 3300049653 Unclassified 2078
501 Ga0501235_000813 3300049669 Bacteria 6372
502 Ga0501236_003711 3300049670 Unclassified 1789
503 Ga0501242_004382 3300049674 Unclassified 1564
504 Ga0501243_011052 3300049675 Bacteria 1413
505 Ga0501252_002061 3300049682 Unclassified 1956
506 Ga0501261_000553 3300049690 Bacteria 4753
507 Ga0501219_000052 3300049703 Bacteria 18661
508 Ga0501221_000112 3300049704 Bacteria 9948
509 Ga0501225_0005830 3300049705 Bacteria 3604
510 Ga0501225_0015465 3300049705 Unclassified 2123
511 Ga0501245_001198 3300049708 Bacteria 3346
512 Ga0501245_001227 3300049708 Bacteria 3311
513 Ga0501079_0160298 3300049741 Unclassified 1754
514 Ga0501080_0083717 3300049742 Bacteria 2963
515 Ga0501083_0019383 3300049744 Bacteria 4739
516 Ga0501264_001808 3300049761 Unclassified 2136
517 Ga0501035_0010571 3300049822 Bacteria 8551
518 Ga0501044_0003415 3300049823 Bacteria 17899
519 Ga0501044_0012622 3300049823 Bacteria 9148
520 Ga0501044_0039615 3300049823 Bacteria 4915
521 Ga0501044_0092738 3300049823 Bacteria 3046
522 Ga0501212_001562 3300049851 Unclassified 2609
523 Ga0501284_00029 3300050005 Bacteria 74818
524 nmdc:mga0k408_10506_c1 3300050493 Bacteria 5007
525 nmdc:mga0k408_42187_c1 3300050493 Bacteria 2627
526 nmdc:mga05p37_2059_c2 3300050507 Bacteria 13293
527 nmdc:mga09592_177604_c1 3300050508 Unclassified 1842
528 nmdc:mga09592_6092_c1 3300050508 Bacteria 9824
529 nmdc:mga0qj67_17832_c1 3300050509 Bacteria 5401
530 Ga0500578_0042024 3300053086 Bacteria 2936
531 Ga0500578_0102051 3300053086 Unclassified 1815
532 Ga0500646_0005896 3300053090 Unclassified 3108
533 Ga0500646_0038352 3300053090 Unclassified 1341
534 Ga0500583_0000124 3300053092 Bacteria 35474
535 Ga0500583_0044909 3300053092 Bacteria 2026
536 Ga0500641_0018632 3300053096 Bacteria 2614
537 Ga0500562_000161 3300053108 Bacteria 19289
538 Ga0500588_0004262 3300053146 Unclassified 3085
539 Ga0500604_0011690 3300053151 Bacteria 2362
540 Ga0500616_0015853 3300053153 Bacteria 4301
541 Ga0500622_0002412 3300053156 Bacteria 13509
542 Ga0500611_000075 3300053727 Bacteria 39695
543 Ga0500645_005960 3300053730 Bacteria 4411
544 Ga0500645_015169 3300053730 Bacteria 2445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10480046 Ga0105246_104800461 267
2 3300025913 Ga0207695_10065612 Ga0207695_100656122 286
3 3300003203 JGI25406J46586_10004539 JGI25406J46586_100045394 293
4 3300005985 Ga0081539_10000910 Ga0081539_1000091041 293
5 3300013306 Ga0163162_10001972 Ga0163162_1000197216 296
6 3300053153 Ga0500616_0015853 Ga0500616_0015853_1036_1965 297
7 3300014969 Ga0157376_10102982 Ga0157376_101029822 301
8 3300005618 Ga0068864_100057779 Ga0068864_1000577792 304
9 3300042007 Ga0439449_0000790 Ga0439449_0000790_10044_11111 307
10 3300005330 Ga0070690_100025529 Ga0070690_1000255292 308
11 3300005335 Ga0070666_10000135 Ga0070666_100001357 308
12 3300005338 Ga0068868_100023876 Ga0068868_1000238763 308
13 3300005365 Ga0070688_100069143 Ga0070688_1000691432 308
14 3300005367 Ga0070667_100087878 Ga0070667_1000878783 308
15 3300005457 Ga0070662_100033889 Ga0070662_1000338891 308
16 3300005564 Ga0070664_100114800 Ga0070664_1001148003 308
17 3300005616 Ga0068852_100004864 Ga0068852_10000486410 308
18 3300005617 Ga0068859_100000127 Ga0068859_10000012746 308
19 3300005617 Ga0068859_100061172 Ga0068859_1000611723 308
20 3300005618 Ga0068864_100104838 Ga0068864_1001048381 308
21 3300005834 Ga0068851_10103630 Ga0068851_101036301 308
22 3300005841 Ga0068863_100001425 Ga0068863_1000014253 308
23 3300005841 Ga0068863_100189534 Ga0068863_1001895341 308
24 3300005843 Ga0068860_100013041 Ga0068860_1000130412 308
25 3300006931 Ga0097620_100000127 Ga0097620_10000012725 308
26 3300006931 Ga0097620_100061176 Ga0097620_1000611763 308
27 3300009098 Ga0105245_10168278 Ga0105245_101682782 308
28 3300009148 Ga0105243_10132994 Ga0105243_101329942 308
29 3300009176 Ga0105242_10145295 Ga0105242_101452951 308
30 3300009545 Ga0105237_10021302 Ga0105237_100213025 308
31 3300009553 Ga0105249_10019556 Ga0105249_100195561 308
32 3300013297 Ga0157378_10067150 Ga0157378_100671503 308
33 3300013308 Ga0157375_10046139 Ga0157375_100461391 308
34 3300014325 Ga0163163_10230350 Ga0163163_102303502 308
35 3300014968 Ga0157379_10045049 Ga0157379_100450492 308
36 3300014968 Ga0157379_10063775 Ga0157379_100637752 308
37 3300025903 Ga0207680_10000057 Ga0207680_100000575 308
38 3300025914 Ga0207671_10033043 Ga0207671_100330432 308
39 3300025931 Ga0207644_10172419 Ga0207644_101724192 308
40 3300025933 Ga0207706_10131472 Ga0207706_101314722 308
41 3300025934 Ga0207686_10125901 Ga0207686_101259012 308
42 3300025942 Ga0207689_10000482 Ga0207689_1000048212 308
43 3300025961 Ga0207712_10192219 Ga0207712_101922191 308
44 3300025986 Ga0207658_10019785 Ga0207658_100197853 308
45 3300025986 Ga0207658_10043573 Ga0207658_100435734 308
46 3300026035 Ga0207703_10000924 Ga0207703_100009247 308
47 3300026088 Ga0207641_10000229 Ga0207641_1000022946 308
48 3300026095 Ga0207676_10144128 Ga0207676_101441282 308
49 3300026142 Ga0207698_10005346 Ga0207698_100053462 308
50 3300028381 Ga0268264_10006832 Ga0268264_100068321 308
51 3300005548 Ga0070665_100116956 Ga0070665_1001169562 309
52 3300005618 Ga0068864_100056928 Ga0068864_1000569282 309
53 3300013306 Ga0163162_10006817 Ga0163162_100068178 309
54 3300026095 Ga0207676_10028518 Ga0207676_100285184 309
55 3300048915 Ga0496112_0331348 Ga0496112_0331348_341_1405 309
56 3300048918 Ga0496115_0014115 Ga0496115_0014115_1374_2441 309
57 3300005367 Ga0070667_100026170 Ga0070667_1000261704 310
58 3300025986 Ga0207658_10252784 Ga0207658_102527841 310
59 3300005329 Ga0070683_100000286 Ga0070683_10000028621 311
60 3300005344 Ga0070661_100000587 Ga0070661_1000005875 311
61 3300005535 Ga0070684_100000500 Ga0070684_10000050019 311
62 3300005539 Ga0068853_100008829 Ga0068853_1000088294 311
63 3300005564 Ga0070664_100034828 Ga0070664_1000348282 311
64 3300005578 Ga0068854_100075950 Ga0068854_1000759502 311
65 3300005614 Ga0068856_100352985 Ga0068856_1003529852 311
66 3300013100 Ga0157373_10035500 Ga0157373_100355002 311
67 3300013102 Ga0157371_10001020 Ga0157371_1000102012 311
68 3300013105 Ga0157369_10027153 Ga0157369_100271538 311
69 3300013307 Ga0157372_10006994 Ga0157372_1000699410 311
70 3300025919 Ga0207657_10175233 Ga0207657_101752332 311
71 3300025944 Ga0207661_10002246 Ga0207661_100022469 311
72 3300025945 Ga0207679_10000363 Ga0207679_1000036311 311
73 3300026041 Ga0207639_10004367 Ga0207639_100043675 311
74 3300026116 Ga0207674_10020026 Ga0207674_100200262 311
75 3300028381 Ga0268264_10003271 Ga0268264_100032719 312
76 3300047318 Ga0495636_0000078 Ga0495636_0000078_13643_14665 313
77 3300053730 Ga0500645_015169 Ga0500645_015169_554_1618 313
78 3300005334 Ga0068869_100018905 Ga0068869_1000189052 314
79 3300005347 Ga0070668_100022068 Ga0070668_1000220684 314
80 3300005459 Ga0068867_100058992 Ga0068867_1000589922 314
81 3300005719 Ga0068861_100016204 Ga0068861_1000162046 314
82 3300005985 Ga0081539_10045078 Ga0081539_100450782 314
83 3300013102 Ga0157371_10138006 Ga0157371_101380062 314
84 3300025942 Ga0207689_10029184 Ga0207689_100291842 314
85 3300025961 Ga0207712_10268560 Ga0207712_102685602 314
86 3300025972 Ga0207668_10047430 Ga0207668_100474302 314
87 3300026089 Ga0207648_10075182 Ga0207648_100751822 314
88 3300026118 Ga0207675_100029699 Ga0207675_1000296996 314
89 3300005844 Ga0068862_100132990 Ga0068862_1001329901 315
90 3300013100 Ga0157373_10055805 Ga0157373_100558052 315
91 3300046471 Ga0495650_0041751 Ga0495650_0041751_824_1885 315
92 3300046616 Ga0495668_0005369 Ga0495668_0005369_4906_5976 315
93 3300053151 Ga0500604_0011690 Ga0500604_0011690_786_1856 315
94 3300005338 Ga0068868_100001462 Ga0068868_1000014625 316
95 3300005355 Ga0070671_100015192 Ga0070671_1000151923 316
96 3300005364 Ga0070673_100053086 Ga0070673_1000530862 316
97 3300005364 Ga0070673_100065753 Ga0070673_1000657532 316
98 3300005366 Ga0070659_100079423 Ga0070659_1000794232 316
99 3300005456 Ga0070678_100019430 Ga0070678_1000194304 316
100 3300005457 Ga0070662_100047095 Ga0070662_1000470952 316
101 3300005564 Ga0070664_100104687 Ga0070664_1001046871 316
102 3300005616 Ga0068852_100114339 Ga0068852_1001143394 316
103 3300005617 Ga0068859_100278856 Ga0068859_1002788562 316
104 3300005618 Ga0068864_100269616 Ga0068864_1002696162 316
105 3300005718 Ga0068866_10101401 Ga0068866_101014011 316
106 3300005841 Ga0068863_100312084 Ga0068863_1003120842 316
107 3300005842 Ga0068858_100130092 Ga0068858_1001300924 316
108 3300006358 Ga0068871_100059370 Ga0068871_1000593704 316
109 3300006931 Ga0097620_100278854 Ga0097620_1002788542 316
110 3300010375 Ga0105239_10234421 Ga0105239_102344212 316
111 3300013102 Ga0157371_10037354 Ga0157371_100373541 316
112 3300013296 Ga0157374_10003011 Ga0157374_1000301110 316
113 3300013297 Ga0157378_10039467 Ga0157378_100394675 316
114 3300013297 Ga0157378_10100844 Ga0157378_101008443 316
115 3300013297 Ga0157378_10409050 Ga0157378_104090501 316
116 3300013306 Ga0163162_10009348 Ga0163162_100093485 316
117 3300013307 Ga0157372_10365602 Ga0157372_103656023 316
118 3300013308 Ga0157375_10014733 Ga0157375_100147338 316
119 3300013308 Ga0157375_10029657 Ga0157375_100296572 316
120 3300013308 Ga0157375_10065040 Ga0157375_100650404 316
121 3300014326 Ga0157380_10032056 Ga0157380_100320563 316
122 3300014326 Ga0157380_10248440 Ga0157380_102484401 316
123 3300014969 Ga0157376_10003428 Ga0157376_1000342811 316
124 3300014969 Ga0157376_10111960 Ga0157376_101119604 316
125 3300014969 Ga0157376_10168720 Ga0157376_101687201 316
126 3300017792 Ga0163161_10004936 Ga0163161_100049369 316
127 3300025315 Ga0207697_10026104 Ga0207697_100261043 316
128 3300025904 Ga0207647_10014996 Ga0207647_100149964 316
129 3300025919 Ga0207657_10069151 Ga0207657_100691514 316
130 3300025926 Ga0207659_10064248 Ga0207659_100642482 316
131 3300025933 Ga0207706_10002905 Ga0207706_100029052 316
132 3300025942 Ga0207689_10003101 Ga0207689_100031019 316
133 3300025960 Ga0207651_10028310 Ga0207651_100283102 316
134 3300025981 Ga0207640_10029027 Ga0207640_100290272 316
135 3300026067 Ga0207678_10062035 Ga0207678_100620353 316
136 3300026089 Ga0207648_10014891 Ga0207648_100148912 316
137 3300026116 Ga0207674_10137555 Ga0207674_101375552 316
138 3300026121 Ga0207683_10019343 Ga0207683_100193435 316
139 3300026142 Ga0207698_10115022 Ga0207698_101150224 316
140 3300035724 Ga0373933_0014955 Ga0373933_0014955_452_1516 316
141 3300046460 Ga0495638_0053614 Ga0495638_0053614_87_1154 316
142 3300046516 Ga0495628_0182808 Ga0495628_0182808_168_1232 316
143 3300046533 Ga0495640_0093167 Ga0495640_0093167_58_1122 316
144 3300046536 Ga0495587_0113644 Ga0495587_0113644_113_1177 316
145 3300046660 Ga0495625_0193296 Ga0495625_0193296_266_1333 316
146 3300049569 Ga0501032_0047032 Ga0501032_0047032_1525_2592 316
147 3300049575 Ga0501039_0076202 Ga0501039_0076202_1240_2307 316
148 3300049579 Ga0501043_0033385 Ga0501043_0033385_28_1095 316
149 3300013307 Ga0157372_10683193 Ga0157372_106831931 317
150 3300031456 Ga0307513_10020895 Ga0307513_100208951 317
151 3300049588 Ga0501072_0187004 Ga0501072_0187004_360_1430 317
152 3300049703 Ga0501219_000052 Ga0501219_000052_2694_3764 318
153 3300050005 Ga0501284_00029 Ga0501284_00029_35232_36302 318
154 3300013307 Ga0157372_10087013 Ga0157372_100870132 319
155 3300028794 Ga0307515_10004330 Ga0307515_1000433019 319
156 3300005329 Ga0070683_100046056 Ga0070683_1000460564 320
157 3300005338 Ga0068868_100015057 Ga0068868_1000150573 320
158 3300005364 Ga0070673_100034526 Ga0070673_1000345262 320
159 3300005367 Ga0070667_100071321 Ga0070667_1000713214 320
160 3300005535 Ga0070684_100012410 Ga0070684_1000124105 320
161 3300005617 Ga0068859_100354358 Ga0068859_1003543581 320
162 3300006931 Ga0097620_100354394 Ga0097620_1003543942 320
163 3300010375 Ga0105239_10171663 Ga0105239_101716632 320
164 3300011119 Ga0105246_10326199 Ga0105246_103261992 320
165 3300013102 Ga0157371_10120156 Ga0157371_101201562 320
166 3300013105 Ga0157369_10030133 Ga0157369_100301334 320
167 3300013296 Ga0157374_10003032 Ga0157374_1000303214 320
168 3300013308 Ga0157375_10084355 Ga0157375_100843554 320
169 3300014325 Ga0163163_10000814 Ga0163163_1000081414 320
170 3300025920 Ga0207649_10039453 Ga0207649_100394535 320
171 3300025942 Ga0207689_10002620 Ga0207689_100026209 320
172 3300025944 Ga0207661_10009997 Ga0207661_100099974 320
173 3300025945 Ga0207679_10007257 Ga0207679_100072577 320
174 3300025960 Ga0207651_10098369 Ga0207651_100983692 320
175 3300025986 Ga0207658_10014460 Ga0207658_100144605 320
176 3300026023 Ga0207677_10210875 Ga0207677_102108751 320
177 3300026095 Ga0207676_10004398 Ga0207676_100043988 320
178 3300026116 Ga0207674_10008150 Ga0207674_100081503 320
179 3300026142 Ga0207698_10033742 Ga0207698_100337422 320
180 3300031251 Ga0265327_10008831 Ga0265327_100088314 320
181 3300009101 Ga0105247_10004365 Ga0105247_100043655 321
182 3300009553 Ga0105249_10020018 Ga0105249_100200182 321
183 3300025900 Ga0207710_10006884 Ga0207710_100068844 321
184 3300046519 Ga0495632_0106646 Ga0495632_0106646_195_1298 321
185 3300053092 Ga0500583_0000124 Ga0500583_0000124_8705_9808 321
186 3300037471 Ga0395905_0005533 Ga0395905_0005533_5649_6716 322
187 3300006237 Ga0097621_100002660 Ga0097621_10000266010 323
188 3300006358 Ga0068871_100068598 Ga0068871_1000685982 323
189 3300010375 Ga0105239_10044414 Ga0105239_100444143 323
190 3300014969 Ga0157376_10001271 Ga0157376_100012716 323
191 3300031616 Ga0307508_10003266 Ga0307508_100032666 323
192 3300005328 Ga0070676_10144875 Ga0070676_101448752 324
193 3300005331 Ga0070670_100109431 Ga0070670_1001094312 324
194 3300005334 Ga0068869_100163862 Ga0068869_1001638621 324
195 3300005353 Ga0070669_100130702 Ga0070669_1001307022 324
196 3300005356 Ga0070674_100195774 Ga0070674_1001957742 324
197 3300005364 Ga0070673_100200000 Ga0070673_1002000002 324
198 3300005367 Ga0070667_100038061 Ga0070667_1000380612 324
199 3300005457 Ga0070662_100087843 Ga0070662_1000878432 324
200 3300005539 Ga0068853_100175180 Ga0068853_1001751802 324
201 3300005617 Ga0068859_100020688 Ga0068859_1000206884 324
202 3300005617 Ga0068859_100065804 Ga0068859_1000658042 324
203 3300005718 Ga0068866_10031840 Ga0068866_100318403 324
204 3300005843 Ga0068860_100018651 Ga0068860_1000186513 324
205 3300006358 Ga0068871_100109732 Ga0068871_1001097322 324
206 3300006931 Ga0097620_100020689 Ga0097620_1000206894 324
207 3300006931 Ga0097620_100065800 Ga0097620_1000658003 324
208 3300009174 Ga0105241_10404235 Ga0105241_104042351 324
209 3300011119 Ga0105246_10010437 Ga0105246_100104375 324
210 3300013296 Ga0157374_10131353 Ga0157374_101313532 324
211 3300013306 Ga0163162_10378333 Ga0163162_103783332 324
212 3300025901 Ga0207688_10009233 Ga0207688_100092331 324
213 3300025933 Ga0207706_10165066 Ga0207706_101650662 324
214 3300025934 Ga0207686_10069603 Ga0207686_100696033 324
215 3300025938 Ga0207704_10100571 Ga0207704_101005711 324
216 3300025942 Ga0207689_10002539 Ga0207689_100025392 324
217 3300026041 Ga0207639_10154197 Ga0207639_101541972 324
218 3300026121 Ga0207683_10002317 Ga0207683_1000231710 324
219 3300028381 Ga0268264_10007090 Ga0268264_100070904 324
220 3300028381 Ga0268264_10120734 Ga0268264_101207342 324
221 3300048907 Ga0496104_0357557 Ga0496104_0357557_129_1196 324
222 3300009545 Ga0105237_10000528 Ga0105237_1000052839 325
223 3300014325 Ga0163163_10172362 Ga0163163_101723622 325
224 3300014968 Ga0157379_10321746 Ga0157379_103217462 325
225 3300025914 Ga0207671_10002788 Ga0207671_1000278813 325
226 3300044658 Ga0466972_0000212 Ga0466972_0000212_25270_26289 325
227 3300046648 Ga0495611_0010000 Ga0495611_0010000_78_1202 325
228 3300050507 nmdc:mga05p37_2059_c2 nmdc:mga05p37_2059_c2_4298_5323 325
229 3300033180 Ga0307510_10008266 Ga0307510_100082667 326
230 3300047320 Ga0495672_0030543 Ga0495672_0030543_2245_3312 326
231 3300053092 Ga0500583_0044909 Ga0500583_0044909_670_1737 326
232 3300005327 Ga0070658_10069420 Ga0070658_100694202 327
233 3300011119 Ga0105246_10102753 Ga0105246_101027532 327
234 3300046694 Ga0495649_0052933 Ga0495649_0052933_813_1880 328
235 3300047472 Ga0495686_0000004 Ga0495686_0000004_334961_336061 328
236 3300049652 Ga0501202_002400 Ga0501202_002400_1837_2886 328
237 3300003320 rootH2_10018154 rootH2_1001815416 329
238 3300006844 Ga0075428_100061991 Ga0075428_1000619914 330
239 3300006846 Ga0075430_100015730 Ga0075430_1000157306 330
240 3300006847 Ga0075431_100359144 Ga0075431_1003591442 330
241 3300031730 Ga0307516_10001231 Ga0307516_1000123129 330
242 3300031730 Ga0307516_10007511 Ga0307516_100075114 330
243 3300044765 Ga0466970_0103601 Ga0466970_0103601_245_1315 330
244 3300045836 Ga0466958_0036163 Ga0466958_0036163_770_1840 330
245 3300046460 Ga0495638_0042271 Ga0495638_0042271_1569_2642 330
246 3300050508 nmdc:mga09592_177604_c1 nmdc:mga09592_177604_c1_367_1458 330
247 3300050509 nmdc:mga0qj67_17832_c1 nmdc:mga0qj67_17832_c1_3737_4828 330
248 3300003320 rootH2_10054060 rootH2_100540603 331
249 3300005338 Ga0068868_100063507 Ga0068868_1000635073 331
250 3300005843 Ga0068860_100002119 Ga0068860_10000211916 331
251 3300009093 Ga0105240_10013866 Ga0105240_100138667 331
252 3300009545 Ga0105237_10000959 Ga0105237_1000095928 331
253 3300010375 Ga0105239_10000853 Ga0105239_1000085323 331
254 3300025914 Ga0207671_10001538 Ga0207671_100015382 331
255 3300028381 Ga0268264_10132719 Ga0268264_101327192 331
256 3300042876 Ga0451577_0016751 Ga0451577_0016751_5023_6087 331
257 3300044712 Ga0453684_0000792 Ga0453684_0000792_104872_105936 331
258 3300045051 Ga0451576_0226897 Ga0451576_0226897_313_1377 331
259 3300009174 Ga0105241_10195770 Ga0105241_101957702 332
260 3300009553 Ga0105249_10071328 Ga0105249_100713283 332
261 3300013297 Ga0157378_10023654 Ga0157378_100236544 332
262 3300013306 Ga0163162_10048158 Ga0163162_100481582 332
263 3300013306 Ga0163162_10052382 Ga0163162_100523822 332
264 3300014969 Ga0157376_10151058 Ga0157376_101510582 332
265 3300021384 Ga0213876_10038630 Ga0213876_100386303 332
266 3300025911 Ga0207654_10134176 Ga0207654_101341761 332
267 3300028786 Ga0307517_10003658 Ga0307517_100036589 332
268 3300030521 Ga0307511_10000276 Ga0307511_1000027630 332
269 3300039437 Ga0436365_1029016 Ga0436365_1029016_1445_2515 332
270 3300002459 JGI24751J29686_10001206 JGI24751J29686_100012063 333
271 3300005347 Ga0070668_100302736 Ga0070668_1003027361 333
272 3300009553 Ga0105249_10013937 Ga0105249_100139375 333
273 3300025961 Ga0207712_10001348 Ga0207712_1000134811 333
274 3300038443 Ga0395901_0067789 Ga0395901_0067789_2012_3130 333
275 3300005367 Ga0070667_100007115 Ga0070667_1000071153 334
276 3300005539 Ga0068853_100181447 Ga0068853_1001814472 334
277 3300005578 Ga0068854_100275389 Ga0068854_1002753891 334
278 3300005617 Ga0068859_100599706 Ga0068859_1005997061 334
279 3300005834 Ga0068851_10036193 Ga0068851_100361932 334
280 3300005841 Ga0068863_100347784 Ga0068863_1003477841 334
281 3300005843 Ga0068860_100014120 Ga0068860_1000141202 334
282 3300006931 Ga0097620_100599736 Ga0097620_1005997361 334
283 3300013297 Ga0157378_10007196 Ga0157378_100071969 334
284 3300013297 Ga0157378_10036254 Ga0157378_100362544 334
285 3300013308 Ga0157375_10029793 Ga0157375_100297931 334
286 3300014325 Ga0163163_10107139 Ga0163163_101071392 334
287 3300017792 Ga0163161_10055715 Ga0163161_100557153 334
288 3300025925 Ga0207650_10032543 Ga0207650_100325433 334
289 3300025981 Ga0207640_10254095 Ga0207640_102540951 334
290 3300026067 Ga0207678_10274611 Ga0207678_102746111 334
291 3300026088 Ga0207641_10278011 Ga0207641_102780112 334
292 3300028381 Ga0268264_10003106 Ga0268264_100031063 334
293 3300050493 nmdc:mga0k408_10506_c1 nmdc:mga0k408_10506_c1_840_1919 334
294 3300014969 Ga0157376_10227606 Ga0157376_102276062 335
295 3300042876 Ga0451577_0084867 Ga0451577_0084867_220_1287 335
296 3300044712 Ga0453684_0056943 Ga0453684_0056943_1879_2943 335
297 3300049569 Ga0501032_0002810 Ga0501032_0002810_6621_7688 335
298 3300049571 Ga0501034_0026330 Ga0501034_0026330_2929_3996 335
299 3300049572 Ga0501036_0006337 Ga0501036_0006337_2970_4037 335
300 3300049573 Ga0501037_0032924 Ga0501037_0032924_836_1903 335
301 3300049574 Ga0501038_0010161 Ga0501038_0010161_4104_5171 335
302 3300049579 Ga0501043_0002617 Ga0501043_0002617_7666_8733 335
303 3300049580 Ga0501046_0025486 Ga0501046_0025486_2298_3365 335
304 3300049581 Ga0501047_0026103 Ga0501047_0026103_4157_5224 335
305 3300049582 Ga0501048_0013370 Ga0501048_0013370_92_1159 335
306 3300049583 Ga0501067_0014205 Ga0501067_0014205_1979_3046 335
307 3300049589 Ga0501073_0020528 Ga0501073_0020528_267_1334 335
308 3300049741 Ga0501079_0160298 Ga0501079_0160298_65_1132 335
309 3300049742 Ga0501080_0083717 Ga0501080_0083717_96_1163 335
310 3300049744 Ga0501083_0019383 Ga0501083_0019383_1197_2264 335
311 3300049822 Ga0501035_0010571 Ga0501035_0010571_5040_6107 335
312 3300049823 Ga0501044_0039615 Ga0501044_0039615_2413_3480 335
313 3300005577 Ga0068857_100178860 Ga0068857_1001788602 336
314 3300006195 Ga0075366_10173865 Ga0075366_101738651 336
315 3300013306 Ga0163162_10240382 Ga0163162_102403823 336
316 3300025942 Ga0207689_10000359 Ga0207689_1000035910 336
317 3300026116 Ga0207674_10158731 Ga0207674_101587313 336
318 3300049649 Ga0501198_013444 Ga0501198_013444_127_1200 336
319 3300049653 Ga0501206_003203 Ga0501206_003203_926_1999 336
320 3300049669 Ga0501235_000813 Ga0501235_000813_4862_5935 336
321 3300049670 Ga0501236_003711 Ga0501236_003711_704_1777 336
322 3300049674 Ga0501242_004382 Ga0501242_004382_319_1392 336
323 3300049675 Ga0501243_011052 Ga0501243_011052_88_1161 336
324 3300049682 Ga0501252_002061 Ga0501252_002061_120_1193 336
325 3300049690 Ga0501261_000553 Ga0501261_000553_599_1672 336
326 3300049704 Ga0501221_000112 Ga0501221_000112_630_1703 336
327 3300049705 Ga0501225_0005830 Ga0501225_0005830_1338_2411 336
328 3300049708 Ga0501245_001227 Ga0501245_001227_792_1865 336
329 3300049761 Ga0501264_001808 Ga0501264_001808_1042_2115 336
330 3300049851 Ga0501212_001562 Ga0501212_001562_812_1885 336
331 3300053096 Ga0500641_0018632 Ga0500641_0018632_1041_2129 336
332 iso_pu_bacteria 2739367866 2740031119 338
333 iso_pu_bacteria 2818991444 2819586865 338
334 iso_pu_bacteria 2929154850 2929156982 338
335 iso_pu_bacteria 2738541278 2738724609 339
336 iso_pu_bacteria 2839989709 2839991003 339
337 3300003322 rootL2_10254500 rootL2_102545001 341
338 3300003323 rootH1_10148454 rootH1_101484546 341
339 3300005329 Ga0070683_100169319 Ga0070683_1001693192 341
340 3300005335 Ga0070666_10025453 Ga0070666_100254536 341
341 3300005337 Ga0070682_100027228 Ga0070682_1000272282 341
342 3300005339 Ga0070660_100005869 Ga0070660_1000058694 341
343 3300005344 Ga0070661_100037944 Ga0070661_1000379441 341
344 3300005366 Ga0070659_100004142 Ga0070659_1000041428 341
345 3300005457 Ga0070662_100074155 Ga0070662_1000741551 341
346 3300005535 Ga0070684_100022651 Ga0070684_1000226515 341
347 3300005539 Ga0068853_100020744 Ga0068853_1000207447 341
348 3300005548 Ga0070665_100000001 Ga0070665_100000001645 341
349 3300005564 Ga0070664_100009022 Ga0070664_1000090221 341
350 3300005614 Ga0068856_100117066 Ga0068856_1001170664 341
351 3300005843 Ga0068860_100000111 Ga0068860_10000011152 341
352 3300006237 Ga0097621_100062398 Ga0097621_1000623984 341
353 3300006358 Ga0068871_100099509 Ga0068871_1000995091 341
354 3300013100 Ga0157373_10009280 Ga0157373_100092803 341
355 3300013102 Ga0157371_10057839 Ga0157371_100578393 341
356 3300013104 Ga0157370_10069622 Ga0157370_100696223 341
357 3300013105 Ga0157369_10006103 Ga0157369_1000610311 341
358 3300013296 Ga0157374_10062178 Ga0157374_100621781 341
359 3300013306 Ga0163162_10000101 Ga0163162_1000010113 341
360 3300013307 Ga0157372_10533126 Ga0157372_105331261 341
361 3300014745 Ga0157377_10059084 Ga0157377_100590841 341
362 3300014969 Ga0157376_10044788 Ga0157376_100447882 341
363 3300025904 Ga0207647_10031509 Ga0207647_100315094 341
364 3300025919 Ga0207657_10000998 Ga0207657_1000099812 341
365 3300025920 Ga0207649_10069932 Ga0207649_100699321 341
366 3300025932 Ga0207690_10167908 Ga0207690_101679081 341
367 3300025933 Ga0207706_10011699 Ga0207706_100116997 341
368 3300025944 Ga0207661_10096932 Ga0207661_100969322 341
369 3300026078 Ga0207702_10105517 Ga0207702_101055173 341
370 3300028379 Ga0268266_10000049 Ga0268266_100000496 341
371 3300028381 Ga0268264_10000313 Ga0268264_1000031348 341
372 3300046524 Ga0495648_0017177 Ga0495648_0017177_630_1691 341
373 3300046660 Ga0495625_0158810 Ga0495625_0158810_24_1085 341
374 3300047443 Ga0495687_000001 Ga0495687_000001_447699_448760 341
375 3300003322 rootL2_10312626 rootL2_103126262 342
376 3300005290 Ga0065712_10137454 Ga0065712_101374541 342
377 3300005457 Ga0070662_100054582 Ga0070662_1000545823 342
378 3300005459 Ga0068867_100041789 Ga0068867_1000417894 342
379 3300005543 Ga0070672_100288642 Ga0070672_1002886422 342
380 3300025981 Ga0207640_10058267 Ga0207640_100582671 342
381 3300031251 Ga0265327_10000208 Ga0265327_1000020882 342
382 3300037418 Ga0395900_0149033 Ga0395900_0149033_266_1333 342
383 3300053108 Ga0500562_000161 Ga0500562_000161_10893_11957 342
384 3300053156 Ga0500622_0002412 Ga0500622_0002412_10543_11607 342
385 3300053730 Ga0500645_005960 Ga0500645_005960_3130_4194 342
386 3300001979 JGI24740J21852_10017736 JGI24740J21852_100177362 343
387 3300003320 rootH2_10059512 rootH2_100595123 343
388 3300003320 rootH2_10173704 rootH2_101737045 343
389 3300003323 rootH1_10011481 rootH1_100114812 343
390 3300003354 JGI25160J50197_1010888 JGI25160J50197_10108883 343
391 3300005295 Ga0065707_10162810 Ga0065707_101628101 343
392 3300005329 Ga0070683_100050964 Ga0070683_1000509643 343
393 3300005331 Ga0070670_100229580 Ga0070670_1002295801 343
394 3300005334 Ga0068869_100269403 Ga0068869_1002694031 343
395 3300005339 Ga0070660_100327542 Ga0070660_1003275421 343
396 3300005341 Ga0070691_10013653 Ga0070691_100136534 343
397 3300005341 Ga0070691_10060478 Ga0070691_100604782 343
398 3300005354 Ga0070675_100009802 Ga0070675_1000098022 343
399 3300005354 Ga0070675_100080758 Ga0070675_1000807582 343
400 3300005354 Ga0070675_100259974 Ga0070675_1002599741 343
401 3300005355 Ga0070671_100350031 Ga0070671_1003500311 343
402 3300005364 Ga0070673_100040582 Ga0070673_1000405824 343
403 3300005364 Ga0070673_100190184 Ga0070673_1001901842 343
404 3300005459 Ga0068867_100270748 Ga0068867_1002707481 343
405 3300005471 Ga0070698_100001497 Ga0070698_10000149723 343
406 3300005471 Ga0070698_100010867 Ga0070698_1000108678 343
407 3300005471 Ga0070698_100091935 Ga0070698_1000919351 343
408 3300005535 Ga0070684_100001699 Ga0070684_1000016993 343
409 3300005535 Ga0070684_100077250 Ga0070684_1000772504 343
410 3300005539 Ga0068853_100000675 Ga0068853_10000067516 343
411 3300005539 Ga0068853_100015298 Ga0068853_1000152984 343
412 3300005563 Ga0068855_100000089 Ga0068855_10000008954 343
413 3300005563 Ga0068855_100007823 Ga0068855_1000078237 343
414 3300005563 Ga0068855_100029591 Ga0068855_1000295917 343
415 3300005563 Ga0068855_100178309 Ga0068855_1001783092 343
416 3300005577 Ga0068857_100002744 Ga0068857_10000274410 343
417 3300005578 Ga0068854_100038918 Ga0068854_1000389182 343
418 3300005578 Ga0068854_100061642 Ga0068854_1000616422 343
419 3300005614 Ga0068856_100100991 Ga0068856_1001009913 343
420 3300005616 Ga0068852_100003713 Ga0068852_1000037136 343
421 3300005616 Ga0068852_100050545 Ga0068852_1000505454 343
422 3300005616 Ga0068852_100053779 Ga0068852_1000537792 343
423 3300005616 Ga0068852_100065071 Ga0068852_1000650712 343
424 3300005616 Ga0068852_100228746 Ga0068852_1002287462 343
425 3300005618 Ga0068864_100080607 Ga0068864_1000806073 343
426 3300005834 Ga0068851_10019688 Ga0068851_100196881 343
427 3300006195 Ga0075366_10044326 Ga0075366_100443262 343
428 3300006237 Ga0097621_100077860 Ga0097621_1000778603 343
429 3300006358 Ga0068871_100133752 Ga0068871_1001337521 343
430 3300006358 Ga0068871_100318726 Ga0068871_1003187261 343
431 3300006844 Ga0075428_100216409 Ga0075428_1002164091 343
432 3300006880 Ga0075429_100002013 Ga0075429_10000201311 343
433 3300009093 Ga0105240_10000074 Ga0105240_1000007464 343
434 3300009093 Ga0105240_10000513 Ga0105240_1000051320 343
435 3300009093 Ga0105240_10001630 Ga0105240_1000163012 343
436 3300009093 Ga0105240_10003016 Ga0105240_1000301621 343
437 3300009093 Ga0105240_10036376 Ga0105240_100363765 343
438 3300009093 Ga0105240_10042091 Ga0105240_100420913 343
439 3300009093 Ga0105240_10076125 Ga0105240_100761252 343
440 3300009093 Ga0105240_10087359 Ga0105240_100873594 343
441 3300009147 Ga0114129_10004521 Ga0114129_100045217 343
442 3300009147 Ga0114129_10154899 Ga0114129_101548994 343
443 3300009174 Ga0105241_10001544 Ga0105241_100015448 343
444 3300009174 Ga0105241_10196900 Ga0105241_101969001 343
445 3300009545 Ga0105237_10001503 Ga0105237_100015032 343
446 3300009545 Ga0105237_10014968 Ga0105237_100149685 343
447 3300009545 Ga0105237_10026382 Ga0105237_100263821 343
448 3300009545 Ga0105237_10116470 Ga0105237_101164703 343
449 3300009551 Ga0105238_10001119 Ga0105238_1000111911 343
450 3300009551 Ga0105238_10045942 Ga0105238_100459423 343
451 3300009553 Ga0105249_10004091 Ga0105249_1000409110 343
452 3300010375 Ga0105239_10000048 Ga0105239_1000004818 343
453 3300010375 Ga0105239_10000314 Ga0105239_1000031423 343
454 3300010375 Ga0105239_10003942 Ga0105239_1000394219 343
455 3300010375 Ga0105239_10005365 Ga0105239_100053658 343
456 3300010375 Ga0105239_10007377 Ga0105239_100073772 343
457 3300010375 Ga0105239_10102864 Ga0105239_101028643 343
458 3300013102 Ga0157371_10028492 Ga0157371_100284925 343
459 3300013104 Ga0157370_10001415 Ga0157370_100014154 343
460 3300013104 Ga0157370_10041237 Ga0157370_100412373 343
461 3300013104 Ga0157370_10184598 Ga0157370_101845981 343
462 3300013105 Ga0157369_10040391 Ga0157369_100403912 343
463 3300013105 Ga0157369_10071400 Ga0157369_100714003 343
464 3300013296 Ga0157374_10000001 Ga0157374_10000001283 343
465 3300013296 Ga0157374_10219037 Ga0157374_102190372 343
466 3300013306 Ga0163162_10260490 Ga0163162_102604902 343
467 3300013307 Ga0157372_10000804 Ga0157372_1000080421 343
468 3300013307 Ga0157372_10053241 Ga0157372_100532412 343
469 3300013307 Ga0157372_10062681 Ga0157372_100626813 343
470 3300013307 Ga0157372_10103722 Ga0157372_101037223 343
471 3300013307 Ga0157372_10476882 Ga0157372_104768821 343
472 3300013308 Ga0157375_10129201 Ga0157375_101292012 343
473 3300014325 Ga0163163_10066226 Ga0163163_100662263 343
474 3300014969 Ga0157376_10000873 Ga0157376_1000087311 343
475 3300014969 Ga0157376_10175414 Ga0157376_101754142 343
476 3300014969 Ga0157376_10360415 Ga0157376_103604151 343
477 3300020069 Ga0197907_11473226 Ga0197907_114732262 343
478 3300020078 Ga0206352_10291238 Ga0206352_102912381 343
479 3300025246 Ga0209646_1005703 Ga0209646_10057031 343
480 3300025302 Ga0207426_1000093 Ga0207426_100009353 343
481 3300025321 Ga0207656_10040412 Ga0207656_100404122 343
482 3300025904 Ga0207647_10006207 Ga0207647_100062077 343
483 3300025911 Ga0207654_10004238 Ga0207654_100042383 343
484 3300025911 Ga0207654_10094308 Ga0207654_100943082 343
485 3300025913 Ga0207695_10000071 Ga0207695_10000071184 343
486 3300025913 Ga0207695_10000084 Ga0207695_10000084150 343
487 3300025913 Ga0207695_10000323 Ga0207695_100003233 343
488 3300025913 Ga0207695_10001425 Ga0207695_1000142519 343
489 3300025913 Ga0207695_10054570 Ga0207695_100545704 343
490 3300025913 Ga0207695_10065774 Ga0207695_100657742 343
491 3300025913 Ga0207695_10091022 Ga0207695_100910223 343
492 3300025914 Ga0207671_10002808 Ga0207671_100028088 343
493 3300025914 Ga0207671_10089518 Ga0207671_100895182 343
494 3300025914 Ga0207671_10141997 Ga0207671_101419972 343
495 3300025919 Ga0207657_10305677 Ga0207657_103056771 343
496 3300025920 Ga0207649_10080125 Ga0207649_100801253 343
497 3300025924 Ga0207694_10007044 Ga0207694_100070444 343
498 3300025925 Ga0207650_10017976 Ga0207650_100179767 343
499 3300025926 Ga0207659_10170224 Ga0207659_101702241 343
500 3300025932 Ga0207690_10021469 Ga0207690_100214693 343
501 3300025940 Ga0207691_10158489 Ga0207691_101584891 343
502 3300025942 Ga0207689_10263463 Ga0207689_102634631 343
503 3300025944 Ga0207661_10021969 Ga0207661_100219692 343
504 3300025944 Ga0207661_10103111 Ga0207661_101031113 343
505 3300025945 Ga0207679_10201914 Ga0207679_102019142 343
506 3300025949 Ga0207667_10000135 Ga0207667_1000013561 343
507 3300025949 Ga0207667_10000177 Ga0207667_1000017769 343
508 3300025949 Ga0207667_10013458 Ga0207667_100134586 343
509 3300025949 Ga0207667_10036693 Ga0207667_100366935 343
510 3300025949 Ga0207667_10227610 Ga0207667_102276102 343
511 3300025960 Ga0207651_10017211 Ga0207651_100172112 343
512 3300025961 Ga0207712_10003852 Ga0207712_100038528 343
513 3300025981 Ga0207640_10049695 Ga0207640_100496952 343
514 3300025986 Ga0207658_10049911 Ga0207658_100499111 343
515 3300026078 Ga0207702_10008334 Ga0207702_100083344 343
516 3300026095 Ga0207676_10023601 Ga0207676_100236012 343
517 3300026116 Ga0207674_10025163 Ga0207674_100251634 343
518 3300026142 Ga0207698_10014331 Ga0207698_100143313 343
519 3300026142 Ga0207698_10124061 Ga0207698_101240611 343
520 3300026142 Ga0207698_10380241 Ga0207698_103802411 343
521 3300031456 Ga0307513_10236389 Ga0307513_102363891 343
522 3300037418 Ga0395900_0086388 Ga0395900_0086388_1514_2581 343
523 3300042015 Ga0439462_0014667 Ga0439462_0014667_620_1702 343
524 3300042876 Ga0451577_0023257 Ga0451577_0023257_1918_2988 343
525 3300044658 Ga0466972_0045611 Ga0466972_0045611_538_1605 343
526 3300044765 Ga0466970_0057596 Ga0466970_0057596_853_1920 343
527 3300046472 Ga0495580_0176093 Ga0495580_0176093_57_1124 343
528 3300049551 Ga0501335_003415 Ga0501335_003415_263_1330 343
529 3300049570 Ga0501033_0126112 Ga0501033_0126112_563_1630 343
530 3300049571 Ga0501034_0028766 Ga0501034_0028766_887_1954 343
531 3300049573 Ga0501037_0007731 Ga0501037_0007731_4686_5753 343
532 3300049574 Ga0501038_0064235 Ga0501038_0064235_1235_2302 343
533 3300049579 Ga0501043_0010495 Ga0501043_0010495_760_1827 343
534 3300049579 Ga0501043_0027182 Ga0501043_0027182_1887_2954 343
535 3300049581 Ga0501047_0062647 Ga0501047_0062647_602_1669 343
536 3300049581 Ga0501047_0272635 Ga0501047_0272635_169_1236 343
537 3300049705 Ga0501225_0015465 Ga0501225_0015465_406_1488 343
538 3300049708 Ga0501245_001198 Ga0501245_001198_668_1735 343
539 3300049823 Ga0501044_0003415 Ga0501044_0003415_12815_13900 343
540 3300049823 Ga0501044_0012622 Ga0501044_0012622_4436_5503 343
541 3300049823 Ga0501044_0092738 Ga0501044_0092738_810_1877 343
542 3300050493 nmdc:mga0k408_42187_c1 nmdc:mga0k408_42187_c1_534_1616 343
543 3300050508 nmdc:mga09592_6092_c1 nmdc:mga09592_6092_c1_2585_3679 343
544 3300053086 Ga0500578_0042024 Ga0500578_0042024_1216_2307 343
545 3300053086 Ga0500578_0102051 Ga0500578_0102051_333_1433 343
546 3300053090 Ga0500646_0005896 Ga0500646_0005896_814_1917 343
547 3300053090 Ga0500646_0038352 Ga0500646_0038352_23_1105 343
548 3300053146 Ga0500588_0004262 Ga0500588_0004262_1020_2102 343
549 3300053727 Ga0500611_000075 Ga0500611_000075_19545_20612 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

110

360

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.6384 38 299
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.54 3 317
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.48 3 317
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.4688 38 299
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.4262 36 339
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.652 68 322 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6177 68 322 3.30.40.10
af_Q21512_7_153_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2873 42 226 1.20.140.150
af_Q21512_7_153_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2729 42 226 1.20.140.150
af_C0H4C0_218_446_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2636 13 226 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6I6GNG0-F1-model_v4 Acyl-CoA desaturase 0.9851 1 342 GO:0006629
GO:0016020
GO:0016717
AF-A0A6P0RR09-F1-model_v4 Acyl-CoA desaturase 0.9846 236 341 GO:0006629
GO:0016020
GO:0016717
AF-A0A7X9KQ13-F1-model_v4 Acyl-CoA desaturase 0.9831 227 343 GO:0006629
GO:0016020
GO:0016717
AF-A0A3C1LHM0-F1-model_v4 Acyl-CoA desaturase 0.9821 41 343 GO:0006629
GO:0016020
GO:0016717
AF-A0A3M1CGR0-F1-model_v4 Acyl-CoA desaturase 0.9802 2 343 GO:0006629
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
90.27 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map