F462324

General Info

Members Datasets Scaffolds Average Seq Length
549 297 1098 337

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100282106|Ga0070714_1002821061
Length 359
Sequence MPWRAWQRRGHILITTLVNTRQMPRAMFRLGEFNSVSKAGEDPLRSDRSFLSRSRGWLIGGIWVICQIVLIAWGTLAIYYSNLPWAALRLTLAAAFSRRRGMSAVFIGLFSHDRPWRSEVAVMPRAIIDGDRVRITGVRNFDYRSRNDFTVRYEEREIRLSHLTALDFFVSYWSEGLVGHTFLSFIFDDAPPLSISIETRPEVGEGFSPIASMFKQFELIYVVGDERDIVRVRTNYRKENVYLYRLNASDIDARRLLLVYLDRINELADRPEFYHLLSNSCTINIVRYANAAGRVGRFDVRHLLNGLIDSYLYHSGRVDTTLPFDELRRRSLINEAAQAADDAPDFSERIRASLPTVTH

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
198 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
293 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
294 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
295 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
296 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
297 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0.73
Rhizoplane 8.01
Rhizosphere 85.97
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100282106 3300005435 Bacteria 1544
2 2214772992 2209111006 Bacteria 11790
3 ARcpr5oldR_c001846 3300000041 Bacteria 2039
4 ARcpr5yngRDRAFT_c000432 3300000043 Bacteria 5511
5 ARCol0yngRDRAFT_1000318 3300000652 Bacteria 7219
6 JGI24752J21851_1005924 3300001976 Bacteria 1597
7 JGI24746J21847_1004747 3300001977 Bacteria 2136
8 JGI24737J22298_10001311 3300001990 Bacteria 8812
9 JGI24750J21931_1002156 3300002070 Bacteria 2386
10 JGI24033J26618_1001820 3300002155 Bacteria 2132
11 JGI24034J26672_10004968 3300002239 Bacteria 1897
12 JGI25404J52841_10000004 3300003659 Bacteria 17943
13 JGI25404J52841_10006845 3300003659 Bacteria 2395
14 JGI25405J52794_10014831 3300003911 Unclassified 1526
15 Ga0065716_1002373 3300005277 Bacteria 1868
16 Ga0065712_10001890 3300005290 Bacteria 8925
17 Ga0065715_10020173 3300005293 Bacteria 2330
18 Ga0065707_10025461 3300005295 Unclassified 1914
19 Ga0065707_10118399 3300005295 Unclassified 2158
20 Ga0070676_10000488 3300005328 Archaea 18902
21 Ga0070683_100012206 3300005329 Bacteria 7457
22 Ga0070683_100071343 3300005329 Bacteria 3241
23 Ga0070690_100014256 3300005330 Bacteria 4714
24 Ga0070690_100021421 3300005330 Bacteria 3947
25 Ga0070677_10010296 3300005333 Bacteria 3194
26 Ga0068869_100000691 3300005334 Archaea 19076
27 Ga0070666_10172933 3300005335 Bacteria 1513
28 Ga0070680_100008846 3300005336 Bacteria 7720
29 Ga0070680_100040742 3300005336 Bacteria 3763
30 Ga0070682_100002137 3300005337 Bacteria 10979
31 Ga0070682_100030150 3300005337 Bacteria 3271
32 Ga0068868_100045983 3300005338 Bacteria 3416
33 Ga0070660_100374415 3300005339 Bacteria 1175
34 Ga0070689_100016625 3300005340 Archaea 5384
35 Ga0070691_10061809 3300005341 Bacteria 1802
36 Ga0070687_100000984 3300005343 Bacteria 9708
37 Ga0070687_100056332 3300005343 Bacteria 2056
38 Ga0070692_10008434 3300005345 Bacteria 4599
39 Ga0070692_10059414 3300005345 Bacteria 2010
40 Ga0070668_100009105 3300005347 Archaea 7373
41 Ga0070668_100076394 3300005347 Unclassified 2616
42 Ga0070675_100029959 3300005354 Bacteria 4391
43 Ga0070671_100043713 3300005355 Bacteria 3723
44 Ga0070673_100000949 3300005364 Bacteria 16423
45 Ga0070673_100033326 3300005364 Bacteria 3888
46 Ga0070673_100141729 3300005364 Bacteria 2028
47 Ga0070688_100011633 3300005365 Bacteria 4896
48 Ga0070659_100054885 3300005366 Bacteria 3139
49 Ga0070703_10006406 3300005406 Unclassified 3300
50 Ga0070709_10094018 3300005434 Unclassified 1983
51 Ga0070714_100011199 3300005435 Bacteria 7110
52 Ga0070714_100016158 3300005435 Bacteria 6021
53 Ga0070713_100030925 3300005436 Bacteria 4258
54 Ga0070713_100068273 3300005436 Bacteria 2995
55 Ga0070713_100072742 3300005436 Bacteria 2908
56 Ga0070713_100394327 3300005436 Bacteria 1292
57 Ga0070710_10045406 3300005437 Bacteria 2442
58 Ga0070711_100055252 3300005439 Unclassified 2742
59 Ga0070711_100094843 3300005439 Bacteria 2158
60 Ga0070705_100027670 3300005440 Bacteria 3098
61 Ga0070694_100133612 3300005444 Bacteria 1795
62 Ga0070708_100016558 3300005445 Bacteria 6121
63 Ga0070678_100097907 3300005456 Bacteria 2266
64 Ga0070662_100043394 3300005457 Bacteria 3217
65 Ga0070662_100056831 3300005457 Bacteria 2841
66 Ga0070681_10358472 3300005458 Bacteria 1368
67 Ga0070685_10003365 3300005466 Bacteria 8136
68 Ga0070698_100014502 3300005471 Bacteria 8322
69 Ga0074259_10653956 3300005507 Bacteria 1420
70 Ga0070679_100240758 3300005530 Bacteria 1767
71 Ga0070684_100001219 3300005535 Archaea 18479
72 Ga0070684_100048752 3300005535 Bacteria 3675
73 Ga0068853_100212561 3300005539 Bacteria 1763
74 Ga0070672_100011292 3300005543 Archaea 6229
75 Ga0070686_100016036 3300005544 Bacteria 4353
76 Ga0070686_100024379 3300005544 Bacteria 3625
77 Ga0070695_100005809 3300005545 Bacteria 7273
78 Ga0070695_100105989 3300005545 Bacteria 1900
79 Ga0070693_100030603 3300005547 Unclassified 2943
80 Ga0070665_100050283 3300005548 Bacteria 4182
81 Ga0070665_100114104 3300005548 Bacteria 2704
82 Ga0070704_100022109 3300005549 Bacteria 4135
83 Ga0070664_100038701 3300005564 Bacteria 4016
84 Ga0070664_100049259 3300005564 Unclassified 3562
85 Ga0070664_100091803 3300005564 Unclassified 2628
86 Ga0068857_100043513 3300005577 Bacteria 3982
87 Ga0068854_100108759 3300005578 Bacteria 2088
88 Ga0068856_100314990 3300005614 Bacteria 1582
89 Ga0070702_100019744 3300005615 Bacteria 3521
90 Ga0068852_100274213 3300005616 Bacteria 1624
91 Ga0068859_100003616 3300005617 Bacteria 15772
92 Ga0068864_100041372 3300005618 Bacteria 3942
93 Ga0068864_100320541 3300005618 Bacteria 1455
94 Ga0068861_100004720 3300005719 Bacteria 9159
95 Ga0068861_100024265 3300005719 Bacteria 4385
96 Ga0068861_100040270 3300005719 Bacteria 3493
97 Ga0068870_10015103 3300005840 Bacteria 3657
98 Ga0068860_100005973 3300005843 Bacteria 12253
99 Ga0068860_100025287 3300005843 Bacteria 5730
100 Ga0068860_100170390 3300005843 Bacteria 2103
101 Ga0068860_100202075 3300005843 Bacteria 1926
102 Ga0081455_10005373 3300005937 Bacteria 14065
103 Ga0081455_10008440 3300005937 Bacteria 10713
104 Ga0081455_10091706 3300005937 Bacteria 2460
105 Ga0081455_10115244 3300005937 Bacteria 2128
106 Ga0081540_1000633 3300005983 Bacteria 33475
107 Ga0081540_1002277 3300005983 Bacteria 15780
108 Ga0081540_1003588 3300005983 Bacteria 12193
109 Ga0081540_1015651 3300005983 Bacteria 4790
110 Ga0081540_1020491 3300005983 Bacteria 3974
111 Ga0070717_10017049 3300006028 Bacteria 5641
112 Ga0070717_10017654 3300006028 Bacteria 5556
113 Ga0075363_100058636 3300006048 Bacteria 2068
114 Ga0075363_100116166 3300006048 Bacteria 1490
115 Ga0075363_100144969 3300006048 Bacteria 1339
116 Ga0075432_10002200 3300006058 Bacteria 6493
117 Ga0070716_100029673 3300006173 Bacteria 2959
118 Ga0070712_100195765 3300006175 Bacteria 1584
119 Ga0075362_10056221 3300006177 Bacteria 1771
120 Ga0075367_10238520 3300006178 Bacteria 1139
121 Ga0075369_10069071 3300006186 Bacteria 1553
122 Ga0075427_10000062 3300006194 Bacteria 8148
123 Ga0097621_100129515 3300006237 Bacteria 2146
124 Ga0097621_100300122 3300006237 Bacteria 1418
125 Ga0068871_100036466 3300006358 Bacteria 3915
126 Ga0075428_100001449 3300006844 Bacteria 25361
127 Ga0075428_100048645 3300006844 Bacteria 4654
128 Ga0075428_100064745 3300006844 Bacteria 4004
129 Ga0075428_100156175 3300006844 Bacteria 2478
130 Ga0075428_100243472 3300006844 Unclassified 1940
131 Ga0075430_100001537 3300006846 Bacteria 18843
132 Ga0075431_100001649 3300006847 Bacteria 20906
133 Ga0075431_100018072 3300006847 Bacteria 7172
134 Ga0075431_100026020 3300006847 Bacteria 5999
135 Ga0075433_10002231 3300006852 Bacteria 14702
136 Ga0075433_10046448 3300006852 Bacteria 3777
137 Ga0075433_10199795 3300006852 Bacteria 1777
138 Ga0075434_100000265 3300006871 Bacteria 37177
139 Ga0075434_100005415 3300006871 Bacteria 11615
140 Ga0075434_100011147 3300006871 Bacteria 8458
141 Ga0075434_100044905 3300006871 Bacteria 4383
142 Ga0075434_100080161 3300006871 Bacteria 3261
143 Ga0075434_100139682 3300006871 Bacteria 2442
144 Ga0075429_100002944 3300006880 Bacteria 14441
145 Ga0075429_100013425 3300006880 Bacteria 7103
146 Ga0075429_100016301 3300006880 Bacteria 6441
147 Ga0068865_100075268 3300006881 Bacteria 2407
148 Ga0097620_100003616 3300006931 Bacteria 15772
149 Ga0097620_100029103 3300006931 Bacteria 5543
150 Ga0075435_100002948 3300007076 Bacteria 11440
151 Ga0075435_100045281 3300007076 Bacteria 3526
152 Ga0075435_100053510 3300007076 Bacteria 3256
153 Ga0075435_100105186 3300007076 Bacteria 2343
154 Ga0111539_10003434 3300009094 Bacteria 20870
155 Ga0111539_10019974 3300009094 Bacteria 8253
156 Ga0111539_10057568 3300009094 Bacteria 4615
157 Ga0111539_10246992 3300009094 Bacteria 2078
158 Ga0111539_10353859 3300009094 Bacteria 1709
159 Ga0111539_10358248 3300009094 Bacteria 1698
160 Ga0105245_10086679 3300009098 Bacteria 2872
161 Ga0105245_10496713 3300009098 Bacteria 1236
162 Ga0105247_10016761 3300009101 Bacteria 4393
163 Ga0105247_10030199 3300009101 Bacteria 3285
164 Ga0105247_10172090 3300009101 Bacteria 1440
165 Ga0114129_10004462 3300009147 Bacteria 19737
166 Ga0114129_10027197 3300009147 Bacteria 8098
167 Ga0114129_10076594 3300009147 Bacteria 4656
168 Ga0114129_10080987 3300009147 Bacteria 4513
169 Ga0105243_10069286 3300009148 Bacteria 2845
170 Ga0105241_10009413 3300009174 Bacteria 7175
171 Ga0105242_10063506 3300009176 Bacteria 3041
172 Ga0105242_10212244 3300009176 Bacteria 1726
173 Ga0105248_10043002 3300009177 Bacteria 5066
174 Ga0105248_10047479 3300009177 Archaea 4815
175 Ga0105248_10200852 3300009177 Bacteria 2246
176 Ga0105237_10038488 3300009545 Bacteria 4829
177 Ga0105237_10168663 3300009545 Bacteria 2189
178 Ga0105237_10338209 3300009545 Bacteria 1510
179 Ga0105238_10272892 3300009551 Bacteria 1672
180 Ga0105249_10072047 3300009553 Bacteria 3194
181 Ga0105249_10395859 3300009553 Unclassified 1410
182 Ga0105239_10061743 3300010375 Bacteria 4113
183 Ga0105239_10486709 3300010375 Bacteria 1402
184 Ga0105246_10008476 3300011119 Bacteria 6319
185 Ga0105246_10084461 3300011119 Bacteria 2271
186 Ga0157373_10127486 3300013100 Bacteria 1790
187 Ga0157371_10108657 3300013102 Bacteria 1968
188 Ga0157369_10008724 3300013105 Bacteria 11616
189 Ga0157374_10031575 3300013296 Plasmid 4815
190 Ga0157374_10036613 3300013296 Bacteria 4496
191 Ga0157374_10044704 3300013296 Bacteria 4094
192 Ga0157374_10044909 3300013296 Bacteria 4087
193 Ga0157374_10175313 3300013296 Unclassified 2093
194 Ga0163162_10024290 3300013306 Bacteria 5982
195 Ga0163162_10106234 3300013306 Bacteria 2903
196 Ga0163162_10246631 3300013306 Bacteria 1917
197 Ga0157375_10028543 3300013308 Bacteria 5233
198 Ga0157375_10063577 3300013308 Bacteria 3672
199 Ga0157375_10093610 3300013308 Unclassified 3071
200 Ga0157375_10097263 3300013308 Bacteria 3018
201 Ga0163163_10010078 3300014325 Bacteria 8478
202 Ga0163163_10041258 3300014325 Archaea 4512
203 Ga0163163_10055883 3300014325 Bacteria 3902
204 Ga0157377_10000577 3300014745 Bacteria 15330
205 Ga0157379_10011754 3300014968 Bacteria 7645
206 Ga0157379_10029928 3300014968 Bacteria 4842
207 Ga0157379_10218907 3300014968 Bacteria 1725
208 Ga0157376_10008172 3300014969 Bacteria 7528
209 Ga0157376_10133636 3300014969 Bacteria 2217
210 Ga0163161_10032755 3300017792 Bacteria 3712
211 Ga0163161_10164860 3300017792 Unclassified 1691
212 Ga0163161_10185043 3300017792 Bacteria 1599
213 Ga0213875_10000047 3300021388 Bacteria 148835
214 Ga0207666_1001290 3300025271 Bacteria 2948
215 Ga0207673_1002821 3300025290 Unclassified 2003
216 Ga0209758_1000074 3300025297 Bacteria 275577
217 Ga0207697_10009834 3300025315 Bacteria 4111
218 Ga0207697_10010140 3300025315 Bacteria 4042
219 Ga0207653_10005110 3300025885 Bacteria 4100
220 Ga0207710_10025396 3300025900 Unclassified 2556
221 Ga0207710_10031442 3300025900 Bacteria 2321
222 Ga0207688_10022566 3300025901 Bacteria 3444
223 Ga0207688_10034166 3300025901 Bacteria 2815
224 Ga0207688_10102616 3300025901 Bacteria 1653
225 Ga0207647_10010549 3300025904 Bacteria 6521
226 Ga0207643_10001173 3300025908 Bacteria 15575
227 Ga0207707_10176227 3300025912 Bacteria 1868
228 Ga0207707_10294548 3300025912 Bacteria 1404
229 Ga0207671_10146364 3300025914 Bacteria 1823
230 Ga0207693_10012845 3300025915 Bacteria 6756
231 Ga0207693_10018472 3300025915 Bacteria 5554
232 Ga0207693_10022955 3300025915 Bacteria 4954
233 Ga0207693_10107187 3300025915 Bacteria 2192
234 Ga0207663_10140729 3300025916 Bacteria 1680
235 Ga0207660_10029996 3300025917 Bacteria 3736
236 Ga0207660_10069189 3300025917 Bacteria 2562
237 Ga0207660_10077697 3300025917 Bacteria 2431
238 Ga0207657_10017921 3300025919 Bacteria 6775
239 Ga0207657_10256293 3300025919 Bacteria 1393
240 Ga0207646_10065711 3300025922 Plasmid 3238
241 Ga0207650_10054400 3300025925 Bacteria 2968
242 Ga0207700_10043138 3300025928 Bacteria 3311
243 Ga0207700_10088983 3300025928 Bacteria 2432
244 Ga0207690_10004930 3300025932 Archaea 7876
245 Ga0207690_10172282 3300025932 Bacteria 1622
246 Ga0207706_10077683 3300025933 Bacteria 2919
247 Ga0207706_10098090 3300025933 Bacteria 2578
248 Ga0207706_10162993 3300025933 Bacteria 1960
249 Ga0207709_10021042 3300025935 Bacteria 3689
250 Ga0207670_10004752 3300025936 Bacteria 7367
251 Ga0207670_10167563 3300025936 Bacteria 1644
252 Ga0207669_10003274 3300025937 Archaea 7001
253 Ga0207704_10019170 3300025938 Bacteria 3588
254 Ga0207704_10225894 3300025938 Bacteria 1389
255 Ga0207665_10021613 3300025939 Bacteria 4232
256 Ga0207691_10058385 3300025940 Bacteria 3509
257 Ga0207711_10110295 3300025941 Bacteria 2446
258 Ga0207711_10296250 3300025941 Unclassified 1491
259 Ga0207661_10004692 3300025944 Bacteria 9572
260 Ga0207661_10187626 3300025944 Bacteria 1811
261 Ga0207679_10022612 3300025945 Bacteria 4284
262 Ga0207679_10127187 3300025945 Bacteria 2038
263 Ga0207679_10176079 3300025945 Unclassified 1766
264 Ga0207679_10305812 3300025945 Bacteria 1372
265 Ga0207667_10241346 3300025949 Bacteria 1849
266 Ga0207651_10012151 3300025960 Bacteria 4858
267 Ga0207712_10012672 3300025961 Bacteria 5387
268 Ga0207712_10026203 3300025961 Bacteria 3882
269 Ga0207668_10063237 3300025972 Bacteria 2610
270 Ga0207677_10037036 3300026023 Bacteria 3185
271 Ga0207677_10323376 3300026023 Bacteria 1283
272 Ga0207678_10019030 3300026067 Bacteria 6031
273 Ga0207678_10034528 3300026067 Bacteria 4404
274 Ga0207678_10185232 3300026067 Bacteria 1778
275 Ga0207702_10100694 3300026078 Bacteria 2550
276 Ga0207648_10023030 3300026089 Bacteria 5586
277 Ga0207676_10564379 3300026095 Bacteria 1089
278 Ga0207674_10009330 3300026116 Archaea 11232
279 Ga0207675_100013369 3300026118 Bacteria 7659
280 Ga0207683_10076144 3300026121 Bacteria 2971
281 Ga0207683_10132796 3300026121 Bacteria 2239
282 Ga0207698_10007733 3300026142 Bacteria 6745
283 Ga0207428_10000188 3300027907 Bacteria 85820
284 Ga0207428_10003946 3300027907 Bacteria 14228
285 Ga0207428_10010168 3300027907 Bacteria 8414
286 Ga0207428_10044685 3300027907 Bacteria 3572
287 Ga0268266_10020286 3300028379 Bacteria 5668
288 Ga0268266_10104502 3300028379 Bacteria 2501
289 Ga0265313_10017611 3300031595 Bacteria 4048
290 Ga0307413_10146830 3300031824 Bacteria 1638
291 Ga0307510_10101619 3300033180 Bacteria 2662
292 Ga0373930_0022378 3300034816 Bacteria 1249
293 Ga0373948_0003432 3300034817 Bacteria 2436
294 Ga0373938_0003122 3300034957 Bacteria 2691
295 Ga0373929_0005991 3300035085 Bacteria 2195
296 Ga0373934_0040151 3300035086 Bacteria 1845
297 Ga0373940_0007556 3300035088 Bacteria 2457
298 Ga0373932_0005208 3300035112 Bacteria 3057
299 Ga0373932_0007029 3300035112 Bacteria 2674
300 Ga0373936_0021041 3300035113 Bacteria 2537
301 Ga0373939_0004771 3300035114 Bacteria 3214
302 Ga0373941_0000083 3300035115 Bacteria 15466
303 Ga0373945_0014759 3300035116 Bacteria 2622
304 Ga0373957_0042550 3300035120 Bacteria 1714
305 Ga0373960_0008863 3300035121 Bacteria 2423
306 Ga0373960_0024358 3300035121 Bacteria 1636
307 Ga0373943_0005639 3300035170 Bacteria 5616
308 Ga0373943_0114386 3300035170 Bacteria 1427
309 Ga0373946_0035723 3300035171 Bacteria 2012
310 Ga0373955_0010263 3300035172 Bacteria 4417
311 Ga0373942_0013176 3300035207 Bacteria 1984
312 Ga0373961_0017146 3300035241 Bacteria 1874
313 Ga0373962_0014257 3300035242 Unclassified 2024
314 Ga0373924_0009935 3300035410 Bacteria 3501
315 Ga0373924_0114201 3300035410 Unclassified 1169
316 Ga0373931_0116031 3300035691 Bacteria 1525
317 Ga0373935_0077063 3300035692 Bacteria 2160
318 Ga0373927_0027781 3300035695 Bacteria 3694
319 Ga0373927_0057591 3300035695 Bacteria 2512
320 Ga0373927_0095746 3300035695 Bacteria 1930
321 Ga0373933_0005395 3300035724 Bacteria 6956
322 Ga0373947_0051866 3300035725 Bacteria 2469
323 Ga0373937_0020205 3300036401 Bacteria 5969
324 Ga0373937_0023698 3300036401 Bacteria 5532
325 Ga0373937_0047646 3300036401 Bacteria 3922
326 Ga0373937_0078095 3300036401 Bacteria 3059
327 Ga0373937_0120150 3300036401 Bacteria 2448
328 Ga0373925_0007620 3300037068 Bacteria 7883
329 Ga0373925_0097125 3300037068 Bacteria 2259
330 Ga0373925_0184978 3300037068 Bacteria 1651
331 Ga0436364_0792980 3300037853 Bacteria 26671
332 Ga0242420_015746 3300038996 Bacteria 1310
333 Ga0436365_1034596 3300039437 Bacteria 4625
334 Ga0436363_0899502 3300039450 Plasmid 2506
335 Ga0436363_1473486 3300039450 Bacteria 1892
336 Ga0439453_0001387 3300041408 Bacteria 3096
337 Ga0439443_000674 3300042003 Bacteria 3265
338 Ga0439460_0035591 3300042461 Bacteria 1440
339 Ga0466966_0069665 3300044684 Bacteria 2206
340 Ga0466963_0191096 3300044694 Bacteria 1430
341 Ga0466957_0144421 3300044842 Bacteria 1535
342 Ga0451576_0213310 3300045051 Bacteria 2016
343 Ga0466958_0194883 3300045836 Bacteria 1288
344 Ga0495592_0043800 3300046454 Bacteria 3346
345 Ga0495603_0047113 3300046455 Bacteria 2568
346 Ga0495603_0097915 3300046455 Bacteria 1713
347 Ga0495629_0036152 3300046459 Bacteria 3489
348 Ga0495629_0038606 3300046459 Bacteria 3363
349 Ga0495629_0076165 3300046459 Unclassified 2342
350 Ga0495651_0019516 3300046462 Bacteria 5256
351 Ga0495651_0032440 3300046462 Bacteria 4074
352 Ga0495651_0227007 3300046462 Bacteria 1288
353 Ga0495651_0309684 3300046462 Bacteria 1056
354 Ga0495653_0054586 3300046463 Unclassified 3052
355 Ga0495653_0152260 3300046463 Bacteria 1615
356 Ga0495580_0007185 3300046472 Bacteria 8963
357 Ga0495582_0018886 3300046473 Bacteria 3771
358 Ga0495582_0092400 3300046473 Bacteria 1688
359 Ga0495582_0200158 3300046473 Bacteria 1140
360 Ga0495639_0002900 3300046475 Bacteria 7467
361 Ga0495664_0004464 3300046477 Bacteria 7660
362 Ga0495664_0031102 3300046477 Bacteria 3128
363 Ga0495664_0104640 3300046477 Bacteria 1706
364 Ga0495594_0099075 3300046499 Bacteria 1639
365 Ga0495608_0014078 3300046511 Bacteria 5552
366 Ga0495608_0018749 3300046511 Bacteria 4768
367 Ga0495608_0025330 3300046511 Bacteria 4050
368 Ga0495618_0208687 3300046514 Bacteria 1235
369 Ga0495628_0005487 3300046516 Bacteria 11104
370 Ga0495628_0026903 3300046516 Bacteria 4682
371 Ga0495628_0158414 3300046516 Bacteria 1721
372 Ga0495630_0017853 3300046517 Bacteria 5203
373 Ga0495630_0142022 3300046517 Bacteria 1826
374 Ga0495637_0088043 3300046520 Bacteria 1229
375 Ga0495652_0028354 3300046529 Unclassified 4926
376 Ga0495652_0157295 3300046529 Bacteria 1768
377 Ga0495665_0010459 3300046531 Bacteria 5021
378 Ga0495640_0051437 3300046533 Bacteria 2832
379 Ga0495640_0090871 3300046533 Bacteria 2015
380 Ga0495587_0008201 3300046536 Bacteria 6729
381 Ga0495587_0077418 3300046536 Bacteria 1931
382 Ga0495645_0006380 3300046543 Bacteria 8184
383 Ga0495645_0026163 3300046543 Unclassified 4234
384 Ga0495645_0050342 3300046543 Bacteria 3033
385 Ga0495645_0216081 3300046543 Bacteria 1292
386 Ga0495645_0232952 3300046543 Bacteria 1233
387 Ga0495667_0006901 3300046559 Bacteria 7704
388 Ga0495667_0023457 3300046559 Unclassified 4157
389 Ga0495634_0043364 3300046642 Bacteria 3049
390 Ga0495634_0086963 3300046642 Bacteria 2035
391 Ga0495634_0142222 3300046642 Bacteria 1522
392 Ga0495635_0005613 3300046663 Bacteria 8742
393 Ga0495659_0051496 3300046664 Bacteria 1500
394 Ga0495657_0024716 3300046675 Bacteria 4273
395 Ga0495599_0131401 3300046678 Bacteria 1555
396 Ga0495623_0003304 3300046679 Bacteria 10654
397 Ga0495623_0010825 3300046679 Bacteria 5906
398 Ga0495623_0029312 3300046679 Bacteria 3541
399 Ga0495646_0005223 3300046680 Bacteria 8184
400 Ga0495646_0008956 3300046680 Bacteria 6354
401 Ga0495647_0085257 3300046681 Bacteria 1287
402 Ga0495658_0056816 3300046683 Bacteria 2233
403 Ga0495669_0033628 3300046684 Bacteria 2257
404 Ga0495613_0101126 3300046689 Bacteria 2082
405 Ga0495613_0153115 3300046689 Bacteria 1643
406 Ga0495624_0105910 3300046690 Bacteria 1730
407 Ga0495600_0001948 3300046809 Bacteria 11591
408 Ga0495600_0009563 3300046809 Bacteria 5993
409 Ga0495600_0013321 3300046809 Bacteria 5164
410 Ga0495581_0045952 3300047315 Bacteria 2524
411 Ga0495581_0055869 3300047315 Bacteria 2278
412 Ga0495604_0019638 3300047317 Bacteria 5407
413 Ga0495604_0031673 3300047317 Bacteria 4194
414 Ga0495604_0072465 3300047317 Bacteria 2603
415 Ga0495604_0115264 3300047317 Bacteria 1953
416 Ga0495674_0010058 3300047319 Bacteria 8966
417 Ga0495674_0066333 3300047319 Bacteria 3132
418 Ga0495674_0075866 3300047319 Bacteria 2892
419 Ga0495674_0126026 3300047319 Bacteria 2161
420 Ga0495674_0172931 3300047319 Bacteria 1801
421 Ga0495674_0291216 3300047319 Bacteria 1335
422 Ga0495676_0136164 3300047321 Bacteria 1766
423 Ga0495680_0011769 3300047322 Bacteria 7727
424 Ga0495680_0014899 3300047322 Bacteria 6721
425 Ga0495680_0019468 3300047322 Bacteria 5726
426 Ga0495680_0036264 3300047322 Bacteria 3961
427 Ga0495680_0047797 3300047322 Bacteria 3363
428 Ga0495675_0002166 3300047444 Bacteria 11709
429 Ga0495675_0102379 3300047444 Bacteria 1791
430 Ga0495684_0002628 3300047471 Bacteria 14268
431 Ga0495593_0071849 3300047673 Bacteria 1797
432 Ga0495602_0000740 3300048088 Bacteria 30918
433 Ga0495602_0013142 3300048088 Bacteria 8470
434 Ga0495602_0033677 3300048088 Bacteria 4802
435 Ga0495602_0306970 3300048088 Bacteria 1159
436 Ga0496100_0046852 3300048903 Bacteria 2783
437 Ga0496100_0149326 3300048903 Bacteria 1665
438 Ga0496101_0001886 3300048904 Bacteria 12663
439 Ga0496101_0026637 3300048904 Bacteria 4020
440 Ga0496103_0005179 3300048906 Archaea 7845
441 Ga0496104_0018158 3300048907 Bacteria 6414
442 Ga0496104_0076509 3300048907 Bacteria 3188
443 Ga0496104_0114016 3300048907 Bacteria 2592
444 Ga0496104_0138069 3300048907 Bacteria 2342
445 Ga0496104_0274762 3300048907 Unclassified 1598
446 Ga0496104_0358535 3300048907 Bacteria 1370
447 Ga0496105_0004059 3300048908 Bacteria 10957
448 Ga0496105_0005836 3300048908 Bacteria 9392
449 Ga0496106_0007963 3300048909 Bacteria 7830
450 Ga0496106_0039904 3300048909 Bacteria 3515
451 Ga0496106_0259429 3300048909 Bacteria 1390
452 Ga0496107_0014792 3300048910 Bacteria 5461
453 Ga0496107_0019560 3300048910 Bacteria 4777
454 Ga0496108_0012653 3300048911 Archaea 6876
455 Ga0496108_0023183 3300048911 Bacteria 5105
456 Ga0496108_0061062 3300048911 Bacteria 3172
457 Ga0496108_0068287 3300048911 Bacteria 2999
458 Ga0496108_0379149 3300048911 Bacteria 1235
459 Ga0496109_0001436 3300048912 Archaea 19764
460 Ga0496109_0003903 3300048912 Bacteria 12458
461 Ga0496109_0040745 3300048912 Bacteria 4207
462 Ga0496110_0001138 3300048913 Bacteria 18809
463 Ga0496110_0045080 3300048913 Bacteria 3852
464 Ga0496110_0500434 3300048913 Bacteria 1106
465 Ga0496111_0006094 3300048914 Bacteria 7798
466 Ga0496111_0007169 3300048914 Bacteria 7286
467 Ga0496111_0069328 3300048914 Bacteria 2564
468 Ga0496111_0153875 3300048914 Unclassified 1706
469 Ga0496112_0010554 3300048915 Archaea 8388
470 Ga0496112_0369706 3300048915 Bacteria 1375
471 Ga0496112_0372935 3300048915 Bacteria 1368
472 Ga0496113_0035853 3300048916 Bacteria 3631
473 Ga0496114_0009274 3300048917 Bacteria 7806
474 Ga0496114_0057736 3300048917 Bacteria 3240
475 Ga0496114_0361644 3300048917 Bacteria 1284
476 Ga0496115_0154157 3300048918 Bacteria 1898
477 Ga0496115_0218851 3300048918 Bacteria 1572
478 Ga0496115_0313137 3300048918 Bacteria 1285
479 Ga0496115_0375427 3300048918 Bacteria 1157
480 Ga0496126_0032028 3300048929 Bacteria 4959
481 Ga0501039_0216422 3300049575 Bacteria 1506
482 Ga0501077_0045221 3300049593 Unclassified 2797
483 Ga0501081_0227025 3300049743 Bacteria 1359
484 nmdc:mga03683_76756_c1 3300050489 Bacteria 1437
485 nmdc:mga03n38_34911_c1 3300050490 Bacteria 2151
486 nmdc:mga00v17_86190_c1 3300050491 Bacteria 1968
487 nmdc:mga0yw44_10045_c1 3300050492 Bacteria 4816
488 nmdc:mga06z11_116671_c1 3300050494 Bacteria 1485
489 nmdc:mga06z11_78934_c1 3300050494 Bacteria 1761
490 nmdc:mga07m45_10940_c1 3300050496 Bacteria 4754
491 nmdc:mga05p37_1011_c1 3300050507 Bacteria 32036
492 nmdc:mga05p37_2388_c1 3300050507 Bacteria 21844
493 nmdc:mga05p37_567_c2 3300050507 Bacteria 34566
494 nmdc:mga09592_19830_c1 3300050508 Bacteria 5524
495 nmdc:mga09592_3384_c1 3300050508 Bacteria 12884
496 nmdc:mga09592_54196_c1 3300050508 Bacteria 3388
497 nmdc:mga0qj67_14199_c1 3300050509 Bacteria 6020
498 nmdc:mga0qj67_31667_c1 3300050509 Bacteria 4122
499 nmdc:mga06r32_126506_c1 3300050510 Bacteria 2525
500 nmdc:mga06r32_408_c1 3300050510 Bacteria 36183
501 nmdc:mga06r32_4570_c1 3300050510 Bacteria 12407
502 nmdc:mga06r32_578_c1 3300050510 Bacteria 31886
503 nmdc:mga08y16_128441_c1 3300050511 Bacteria 2637
504 nmdc:mga08y16_196380_c1 3300050511 Bacteria 2091
505 nmdc:mga08y16_1987_c1 3300050511 Bacteria 20871
506 nmdc:mga08y16_426796_c1 3300050511 Bacteria 1354
507 nmdc:mga08y16_46751_c1 3300050511 Bacteria 4531
508 nmdc:mga08y16_596026_c1 3300050511 Bacteria 1114
509 nmdc:mga08y16_73036_c1 3300050511 Bacteria 3575
510 nmdc:mga0n895_138736_c1 3300050512 Bacteria 2459
511 nmdc:mga0n895_1518_c1 3300050512 Bacteria 17419
512 nmdc:mga0n895_1985_c1 3300050512 Bacteria 15691
513 nmdc:mga0n895_2426_c1 3300050512 Bacteria 14544
514 nmdc:mga0n895_65966_c1 3300050512 Bacteria 3584
515 nmdc:mga0rr50_22252_c1 3300050513 Bacteria 4347
516 nmdc:mga0rr50_35674_c1 3300050513 Bacteria 3573
517 nmdc:mga0rr50_38729_c1 3300050513 Bacteria 3452
518 nmdc:mga0rr50_71435_c1 3300050513 Bacteria 2648
519 nmdc:mga0a205_100_c1 3300050515 Bacteria 49122
520 nmdc:mga0a205_233726_c1 3300050515 Bacteria 1721
521 nmdc:mga0a205_56605_c1 3300050515 Bacteria 3786
522 Ga0495601_0001319 3300053077 Bacteria 13617
523 Ga0495601_0001908 3300053077 Bacteria 11658
524 Ga0495601_0050826 3300053077 Bacteria 2615
525 Ga0495612_0010290 3300053078 Bacteria 3785
526 Ga0495655_0022889 3300053083 Bacteria 1434
527 Ga0495595_0000177 3300053084 Bacteria 25431
528 Ga0495595_0002073 3300053084 Bacteria 7796
529 Ga0495595_0002946 3300053084 Bacteria 6720
530 Ga0495595_0020433 3300053084 Unclassified 2882
531 Ga0495595_0043078 3300053084 Bacteria 2069
532 Ga0495595_0082268 3300053084 Bacteria 1535
533 Ga0495619_0000148 3300053085 Bacteria 51816
534 Ga0495619_0001175 3300053085 Bacteria 17233
535 Ga0495619_0072172 3300053085 Unclassified 2311
536 Ga0500651_0035641 3300053093 Bacteria 3135
537 Ga0500595_001713 3300053119 Bacteria 11451
538 Ga0500595_024993 3300053119 Bacteria 2078
539 Ga0500568_0026905 3300053139 Bacteria 2410
540 Ga0500603_003935 3300053150 Bacteria 3179
541 Ga0500637_0000119 3300053178 Bacteria 28866
542 Ga0530510_0063406 3300061734 Bacteria 2676
543 Ga0530510_0287247 3300061734 Bacteria 1229
544 2824682515 2824679649 Bacteria 8248951
545 2885367937 2885366525 Bacteria 8326213
546 2908745198 2908739725 Bacteria 8628932
547 8007000783 8006994254 Bacteria 8309700
548 8019559716 8019555841 Bacteria 9642137
549 8019569825 8019565922 Bacteria 9639779
550 Ga0070714_100282106
551 2214772992
552 ARcpr5oldR_c001846
553 ARcpr5yngRDRAFT_c000432
554 ARCol0yngRDRAFT_1000318
555 JGI24752J21851_1005924
556 JGI24746J21847_1004747
557 JGI24737J22298_10001311
558 JGI24750J21931_1002156
559 JGI24033J26618_1001820
560 JGI24034J26672_10004968
561 JGI25404J52841_10000004
562 JGI25404J52841_10006845
563 JGI25405J52794_10014831
564 Ga0065716_1002373
565 Ga0065712_10001890
566 Ga0065715_10020173
567 Ga0065707_10025461
568 Ga0065707_10118399
569 Ga0070676_10000488
570 Ga0070683_100012206
571 Ga0070683_100071343
572 Ga0070690_100014256
573 Ga0070690_100021421
574 Ga0070677_10010296
575 Ga0068869_100000691
576 Ga0070666_10172933
577 Ga0070680_100008846
578 Ga0070680_100040742
579 Ga0070682_100002137
580 Ga0070682_100030150
581 Ga0068868_100045983
582 Ga0070660_100374415
583 Ga0070689_100016625
584 Ga0070691_10061809
585 Ga0070687_100000984
586 Ga0070687_100056332
587 Ga0070692_10008434
588 Ga0070692_10059414
589 Ga0070668_100009105
590 Ga0070668_100076394
591 Ga0070675_100029959
592 Ga0070671_100043713
593 Ga0070673_100000949
594 Ga0070673_100033326
595 Ga0070673_100141729
596 Ga0070688_100011633
597 Ga0070659_100054885
598 Ga0070703_10006406
599 Ga0070709_10094018
600 Ga0070714_100011199
601 Ga0070714_100016158
602 Ga0070713_100030925
603 Ga0070713_100068273
604 Ga0070713_100072742
605 Ga0070713_100394327
606 Ga0070710_10045406
607 Ga0070711_100055252
608 Ga0070711_100094843
609 Ga0070705_100027670
610 Ga0070694_100133612
611 Ga0070708_100016558
612 Ga0070678_100097907
613 Ga0070662_100043394
614 Ga0070662_100056831
615 Ga0070681_10358472
616 Ga0070685_10003365
617 Ga0070698_100014502
618 Ga0074259_10653956
619 Ga0070679_100240758
620 Ga0070684_100001219
621 Ga0070684_100048752
622 Ga0068853_100212561
623 Ga0070672_100011292
624 Ga0070686_100016036
625 Ga0070686_100024379
626 Ga0070695_100005809
627 Ga0070695_100105989
628 Ga0070693_100030603
629 Ga0070665_100050283
630 Ga0070665_100114104
631 Ga0070704_100022109
632 Ga0070664_100038701
633 Ga0070664_100049259
634 Ga0070664_100091803
635 Ga0068857_100043513
636 Ga0068854_100108759
637 Ga0068856_100314990
638 Ga0070702_100019744
639 Ga0068852_100274213
640 Ga0068859_100003616
641 Ga0068864_100041372
642 Ga0068864_100320541
643 Ga0068861_100004720
644 Ga0068861_100024265
645 Ga0068861_100040270
646 Ga0068870_10015103
647 Ga0068860_100005973
648 Ga0068860_100025287
649 Ga0068860_100170390
650 Ga0068860_100202075
651 Ga0081455_10005373
652 Ga0081455_10008440
653 Ga0081455_10091706
654 Ga0081455_10115244
655 Ga0081540_1000633
656 Ga0081540_1002277
657 Ga0081540_1003588
658 Ga0081540_1015651
659 Ga0081540_1020491
660 Ga0070717_10017049
661 Ga0070717_10017654
662 Ga0075363_100058636
663 Ga0075363_100116166
664 Ga0075363_100144969
665 Ga0075432_10002200
666 Ga0070716_100029673
667 Ga0070712_100195765
668 Ga0075362_10056221
669 Ga0075367_10238520
670 Ga0075369_10069071
671 Ga0075427_10000062
672 Ga0097621_100129515
673 Ga0097621_100300122
674 Ga0068871_100036466
675 Ga0075428_100001449
676 Ga0075428_100048645
677 Ga0075428_100064745
678 Ga0075428_100156175
679 Ga0075428_100243472
680 Ga0075430_100001537
681 Ga0075431_100001649
682 Ga0075431_100018072
683 Ga0075431_100026020
684 Ga0075433_10002231
685 Ga0075433_10046448
686 Ga0075433_10199795
687 Ga0075434_100000265
688 Ga0075434_100005415
689 Ga0075434_100011147
690 Ga0075434_100044905
691 Ga0075434_100080161
692 Ga0075434_100139682
693 Ga0075429_100002944
694 Ga0075429_100013425
695 Ga0075429_100016301
696 Ga0068865_100075268
697 Ga0097620_100003616
698 Ga0097620_100029103
699 Ga0075435_100002948
700 Ga0075435_100045281
701 Ga0075435_100053510
702 Ga0075435_100105186
703 Ga0111539_10003434
704 Ga0111539_10019974
705 Ga0111539_10057568
706 Ga0111539_10246992
707 Ga0111539_10353859
708 Ga0111539_10358248
709 Ga0105245_10086679
710 Ga0105245_10496713
711 Ga0105247_10016761
712 Ga0105247_10030199
713 Ga0105247_10172090
714 Ga0114129_10004462
715 Ga0114129_10027197
716 Ga0114129_10076594
717 Ga0114129_10080987
718 Ga0105243_10069286
719 Ga0105241_10009413
720 Ga0105242_10063506
721 Ga0105242_10212244
722 Ga0105248_10043002
723 Ga0105248_10047479
724 Ga0105248_10200852
725 Ga0105237_10038488
726 Ga0105237_10168663
727 Ga0105237_10338209
728 Ga0105238_10272892
729 Ga0105249_10072047
730 Ga0105249_10395859
731 Ga0105239_10061743
732 Ga0105239_10486709
733 Ga0105246_10008476
734 Ga0105246_10084461
735 Ga0157373_10127486
736 Ga0157371_10108657
737 Ga0157369_10008724
738 Ga0157374_10031575
739 Ga0157374_10036613
740 Ga0157374_10044704
741 Ga0157374_10044909
742 Ga0157374_10175313
743 Ga0163162_10024290
744 Ga0163162_10106234
745 Ga0163162_10246631
746 Ga0157375_10028543
747 Ga0157375_10063577
748 Ga0157375_10093610
749 Ga0157375_10097263
750 Ga0163163_10010078
751 Ga0163163_10041258
752 Ga0163163_10055883
753 Ga0157377_10000577
754 Ga0157379_10011754
755 Ga0157379_10029928
756 Ga0157379_10218907
757 Ga0157376_10008172
758 Ga0157376_10133636
759 Ga0163161_10032755
760 Ga0163161_10164860
761 Ga0163161_10185043
762 Ga0213875_10000047
763 Ga0207666_1001290
764 Ga0207673_1002821
765 Ga0209758_1000074
766 Ga0207697_10009834
767 Ga0207697_10010140
768 Ga0207653_10005110
769 Ga0207710_10025396
770 Ga0207710_10031442
771 Ga0207688_10022566
772 Ga0207688_10034166
773 Ga0207688_10102616
774 Ga0207647_10010549
775 Ga0207643_10001173
776 Ga0207707_10176227
777 Ga0207707_10294548
778 Ga0207671_10146364
779 Ga0207693_10012845
780 Ga0207693_10018472
781 Ga0207693_10022955
782 Ga0207693_10107187
783 Ga0207663_10140729
784 Ga0207660_10029996
785 Ga0207660_10069189
786 Ga0207660_10077697
787 Ga0207657_10017921
788 Ga0207657_10256293
789 Ga0207646_10065711
790 Ga0207650_10054400
791 Ga0207700_10043138
792 Ga0207700_10088983
793 Ga0207690_10004930
794 Ga0207690_10172282
795 Ga0207706_10077683
796 Ga0207706_10098090
797 Ga0207706_10162993
798 Ga0207709_10021042
799 Ga0207670_10004752
800 Ga0207670_10167563
801 Ga0207669_10003274
802 Ga0207704_10019170
803 Ga0207704_10225894
804 Ga0207665_10021613
805 Ga0207691_10058385
806 Ga0207711_10110295
807 Ga0207711_10296250
808 Ga0207661_10004692
809 Ga0207661_10187626
810 Ga0207679_10022612
811 Ga0207679_10127187
812 Ga0207679_10176079
813 Ga0207679_10305812
814 Ga0207667_10241346
815 Ga0207651_10012151
816 Ga0207712_10012672
817 Ga0207712_10026203
818 Ga0207668_10063237
819 Ga0207677_10037036
820 Ga0207677_10323376
821 Ga0207678_10019030
822 Ga0207678_10034528
823 Ga0207678_10185232
824 Ga0207702_10100694
825 Ga0207648_10023030
826 Ga0207676_10564379
827 Ga0207674_10009330
828 Ga0207675_100013369
829 Ga0207683_10076144
830 Ga0207683_10132796
831 Ga0207698_10007733
832 Ga0207428_10000188
833 Ga0207428_10003946
834 Ga0207428_10010168
835 Ga0207428_10044685
836 Ga0268266_10020286
837 Ga0268266_10104502
838 Ga0265313_10017611
839 Ga0307413_10146830
840 Ga0307510_10101619
841 Ga0373930_0022378
842 Ga0373948_0003432
843 Ga0373938_0003122
844 Ga0373929_0005991
845 Ga0373934_0040151
846 Ga0373940_0007556
847 Ga0373932_0005208
848 Ga0373932_0007029
849 Ga0373936_0021041
850 Ga0373939_0004771
851 Ga0373941_0000083
852 Ga0373945_0014759
853 Ga0373957_0042550
854 Ga0373960_0008863
855 Ga0373960_0024358
856 Ga0373943_0005639
857 Ga0373943_0114386
858 Ga0373946_0035723
859 Ga0373955_0010263
860 Ga0373942_0013176
861 Ga0373961_0017146
862 Ga0373962_0014257
863 Ga0373924_0009935
864 Ga0373924_0114201
865 Ga0373931_0116031
866 Ga0373935_0077063
867 Ga0373927_0027781
868 Ga0373927_0057591
869 Ga0373927_0095746
870 Ga0373933_0005395
871 Ga0373947_0051866
872 Ga0373937_0020205
873 Ga0373937_0023698
874 Ga0373937_0047646
875 Ga0373937_0078095
876 Ga0373937_0120150
877 Ga0373925_0007620
878 Ga0373925_0097125
879 Ga0373925_0184978
880 Ga0436364_0792980
881 Ga0242420_015746
882 Ga0436365_1034596
883 Ga0436363_0899502
884 Ga0436363_1473486
885 Ga0439453_0001387
886 Ga0439443_000674
887 Ga0439460_0035591
888 Ga0466966_0069665
889 Ga0466963_0191096
890 Ga0466957_0144421
891 Ga0451576_0213310
892 Ga0466958_0194883
893 Ga0495592_0043800
894 Ga0495603_0047113
895 Ga0495603_0097915
896 Ga0495629_0036152
897 Ga0495629_0038606
898 Ga0495629_0076165
899 Ga0495651_0019516
900 Ga0495651_0032440
901 Ga0495651_0227007
902 Ga0495651_0309684
903 Ga0495653_0054586
904 Ga0495653_0152260
905 Ga0495580_0007185
906 Ga0495582_0018886
907 Ga0495582_0092400
908 Ga0495582_0200158
909 Ga0495639_0002900
910 Ga0495664_0004464
911 Ga0495664_0031102
912 Ga0495664_0104640
913 Ga0495594_0099075
914 Ga0495608_0014078
915 Ga0495608_0018749
916 Ga0495608_0025330
917 Ga0495618_0208687
918 Ga0495628_0005487
919 Ga0495628_0026903
920 Ga0495628_0158414
921 Ga0495630_0017853
922 Ga0495630_0142022
923 Ga0495637_0088043
924 Ga0495652_0028354
925 Ga0495652_0157295
926 Ga0495665_0010459
927 Ga0495640_0051437
928 Ga0495640_0090871
929 Ga0495587_0008201
930 Ga0495587_0077418
931 Ga0495645_0006380
932 Ga0495645_0026163
933 Ga0495645_0050342
934 Ga0495645_0216081
935 Ga0495645_0232952
936 Ga0495667_0006901
937 Ga0495667_0023457
938 Ga0495634_0043364
939 Ga0495634_0086963
940 Ga0495634_0142222
941 Ga0495635_0005613
942 Ga0495659_0051496
943 Ga0495657_0024716
944 Ga0495599_0131401
945 Ga0495623_0003304
946 Ga0495623_0010825
947 Ga0495623_0029312
948 Ga0495646_0005223
949 Ga0495646_0008956
950 Ga0495647_0085257
951 Ga0495658_0056816
952 Ga0495669_0033628
953 Ga0495613_0101126
954 Ga0495613_0153115
955 Ga0495624_0105910
956 Ga0495600_0001948
957 Ga0495600_0009563
958 Ga0495600_0013321
959 Ga0495581_0045952
960 Ga0495581_0055869
961 Ga0495604_0019638
962 Ga0495604_0031673
963 Ga0495604_0072465
964 Ga0495604_0115264
965 Ga0495674_0010058
966 Ga0495674_0066333
967 Ga0495674_0075866
968 Ga0495674_0126026
969 Ga0495674_0172931
970 Ga0495674_0291216
971 Ga0495676_0136164
972 Ga0495680_0011769
973 Ga0495680_0014899
974 Ga0495680_0019468
975 Ga0495680_0036264
976 Ga0495680_0047797
977 Ga0495675_0002166
978 Ga0495675_0102379
979 Ga0495684_0002628
980 Ga0495593_0071849
981 Ga0495602_0000740
982 Ga0495602_0013142
983 Ga0495602_0033677
984 Ga0495602_0306970
985 Ga0496100_0046852
986 Ga0496100_0149326
987 Ga0496101_0001886
988 Ga0496101_0026637
989 Ga0496103_0005179
990 Ga0496104_0018158
991 Ga0496104_0076509
992 Ga0496104_0114016
993 Ga0496104_0138069
994 Ga0496104_0274762
995 Ga0496104_0358535
996 Ga0496105_0004059
997 Ga0496105_0005836
998 Ga0496106_0007963
999 Ga0496106_0039904
1000 Ga0496106_0259429
1001 Ga0496107_0014792
1002 Ga0496107_0019560
1003 Ga0496108_0012653
1004 Ga0496108_0023183
1005 Ga0496108_0061062
1006 Ga0496108_0068287
1007 Ga0496108_0379149
1008 Ga0496109_0001436
1009 Ga0496109_0003903
1010 Ga0496109_0040745
1011 Ga0496110_0001138
1012 Ga0496110_0045080
1013 Ga0496110_0500434
1014 Ga0496111_0006094
1015 Ga0496111_0007169
1016 Ga0496111_0069328
1017 Ga0496111_0153875
1018 Ga0496112_0010554
1019 Ga0496112_0369706
1020 Ga0496112_0372935
1021 Ga0496113_0035853
1022 Ga0496114_0009274
1023 Ga0496114_0057736
1024 Ga0496114_0361644
1025 Ga0496115_0154157
1026 Ga0496115_0218851
1027 Ga0496115_0313137
1028 Ga0496115_0375427
1029 Ga0496126_0032028
1030 Ga0501039_0216422
1031 Ga0501077_0045221
1032 Ga0501081_0227025
1033 nmdc:mga03683_76756_c1
1034 nmdc:mga03n38_34911_c1
1035 nmdc:mga00v17_86190_c1
1036 nmdc:mga0yw44_10045_c1
1037 nmdc:mga06z11_116671_c1
1038 nmdc:mga06z11_78934_c1
1039 nmdc:mga07m45_10940_c1
1040 nmdc:mga05p37_1011_c1
1041 nmdc:mga05p37_2388_c1
1042 nmdc:mga05p37_567_c2
1043 nmdc:mga09592_19830_c1
1044 nmdc:mga09592_3384_c1
1045 nmdc:mga09592_54196_c1
1046 nmdc:mga0qj67_14199_c1
1047 nmdc:mga0qj67_31667_c1
1048 nmdc:mga06r32_126506_c1
1049 nmdc:mga06r32_408_c1
1050 nmdc:mga06r32_4570_c1
1051 nmdc:mga06r32_578_c1
1052 nmdc:mga08y16_128441_c1
1053 nmdc:mga08y16_196380_c1
1054 nmdc:mga08y16_1987_c1
1055 nmdc:mga08y16_426796_c1
1056 nmdc:mga08y16_46751_c1
1057 nmdc:mga08y16_596026_c1
1058 nmdc:mga08y16_73036_c1
1059 nmdc:mga0n895_138736_c1
1060 nmdc:mga0n895_1518_c1
1061 nmdc:mga0n895_1985_c1
1062 nmdc:mga0n895_2426_c1
1063 nmdc:mga0n895_65966_c1
1064 nmdc:mga0rr50_22252_c1
1065 nmdc:mga0rr50_35674_c1
1066 nmdc:mga0rr50_38729_c1
1067 nmdc:mga0rr50_71435_c1
1068 nmdc:mga0a205_100_c1
1069 nmdc:mga0a205_233726_c1
1070 nmdc:mga0a205_56605_c1
1071 Ga0495601_0001319
1072 Ga0495601_0001908
1073 Ga0495601_0050826
1074 Ga0495612_0010290
1075 Ga0495655_0022889
1076 Ga0495595_0000177
1077 Ga0495595_0002073
1078 Ga0495595_0002946
1079 Ga0495595_0020433
1080 Ga0495595_0043078
1081 Ga0495595_0082268
1082 Ga0495619_0000148
1083 Ga0495619_0001175
1084 Ga0495619_0072172
1085 Ga0500651_0035641
1086 Ga0500595_001713
1087 Ga0500595_024993
1088 Ga0500568_0026905
1089 Ga0500603_003935
1090 Ga0500637_0000119
1091 Ga0530510_0063406
1092 Ga0530510_0287247
1093 2824682515
1094 2885367937
1095 2908745198
1096 8007000783
1097 8019559716
1098 8019569825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13387

DUF4105

Domain of unknown function (DUF4105)

149

304

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dwd-assembly1.cif.gz_A crystal structure of mandelate racemase/muconate lactonizing protein from paracoccus denitrificans pd1222 complexed with magnesium 0.7242 143 176
7phb-assembly1.cif.gz_P 70s ribosome with a- and p-site trnas in chloramphenicol-treated mycoplasma pneumoniae cells 0.5739 103 139
7ml4-assembly1.cif.gz_U rna polymerase ii initially transcribing complex (itc) 0.5357 94 139
7bog-assembly1.cif.gz_Q bacterial 30s ribosomal subunit assembly complex state e (body domain) 0.4919 103 139
6gxm-assembly1.cif.gz_q cryo-em structure of an e. coli 70s ribosome in complex with rf3-gdpcp, rf1(gaq) and pint-trna (state ii) 0.4896 102 139
ID Description Score Start End Superfamily
af_B3DHR3_5_138_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.5564 149 275 3.90.1720.10
af_P91082_142_284_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.5552 138 280 3.90.1720.10
af_Q86WG5_909_1002_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5294 98 176 2.30.29.30
af_P91082_142_284_3.90.1720.10 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.5292 138 280 3.90.1720.10
af_Q5KQH1_111_228_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5164 106 169 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A512N4N8-F1-model_v4 Membrane protein 0.9698 3 335 GO:0016020
AF-A0A2W4R8W9-F1-model_v4 DUF4105 domain-containing protein 0.9694 9 335 GO:0016020
AF-A0A3B8PVX0-F1-model_v4 DUF4105 domain-containing protein 0.9681 3 336 GO:0016020
AF-A0A6A7MBI9-F1-model_v4 DUF4105 domain-containing protein 0.9643 1 338 GO:0016020
AF-A0A3A0DSS8-F1-model_v4 DUF4105 domain-containing protein 0.9622 89 333

Map