F462318
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 549 | 356 | 518 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_101012322|Ga0070670_1010123221 |
| Length | 177 |
| Sequence | VPCASDRGWLSLAGARGIRLSTTFNDSGHLMRTYTPKPGEITRTWHVIDATDVVLGRLASQTAILLRGKHKATFAPHVDVGDFVIIINAEKVALTGAKAQQKKAYHHSGFPGGLKATSYTELLAKNPEKAVEKAVRGMLPRNTLGKAQLSKLKVYRGAEHPHAAQQPTPYELTQVAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 2 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 3 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 4 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 5 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 6 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 7 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 8 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 9 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 10 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 11 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 12 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 13 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 14 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 15 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 16 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 17 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 18 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 19 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 20 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 21 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 22 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 23 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 24 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 25 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 26 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 27 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 28 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 29 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003289 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_19 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 44 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 45 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 46 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 47 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 48 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 49 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 51 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300023436 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 | Metatranscriptome | Rhizosphere |
| 140 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 144 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 190 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 191 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 236 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 238 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 239 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 242 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 245 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 356 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.04 |
| Metatranscriptomes | 23.32 |
| Isolates | 5.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 3.46 |
| Rhizosphere | 88.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10130353 | 3300002067 | Bacteria | 725 |
| 2 | Ga0006779J45831_103482 | 3300003160 | Bacteria | 948 |
| 3 | Ga0006778J45830_1006918 | 3300003162 | Bacteria | 926 |
| 4 | Ga0006759J45824_1017117 | 3300003163 | Bacteria | 1025 |
| 5 | Ga0006776J48906_107582 | 3300003289 | Bacteria | 842 |
| 6 | Ga0006758J48902_1021532 | 3300003300 | Bacteria | 669 |
| 7 | Ga0006770J48903_1014969 | 3300003305 | Bacteria | 665 |
| 8 | Ga0006777J48905_1007106 | 3300003308 | Bacteria | 1534 |
| 9 | Ga0007417J51691_1013042 | 3300003544 | Bacteria | 1113 |
| 10 | Ga0007427J51700_105626 | 3300003559 | Bacteria | 1076 |
| 11 | Ga0006781J51513_1004893 | 3300003568 | Bacteria | 995 |
| 12 | Ga0007410J51695_1010777 | 3300003574 | Bacteria | 1101 |
| 13 | Ga0007409J51694_1026381 | 3300003575 | Bacteria | 1039 |
| 14 | Ga0007416J51690_1011832 | 3300003577 | Bacteria | 1083 |
| 15 | Ga0007429J51699_1006292 | 3300003579 | Bacteria | 1031 |
| 16 | Ga0007415J51800_110175 | 3300003613 | Bacteria | 603 |
| 17 | Ga0032354_1006556 | 3300003693 | Bacteria | 1010 |
| 18 | Ga0006780_1002139 | 3300003735 | Bacteria | 1079 |
| 19 | Ga0058858_1422307 | 3300004785 | Bacteria | 563 |
| 20 | Ga0058863_10102788 | 3300004799 | Bacteria | 519 |
| 21 | Ga0058863_10103508 | 3300004799 | Bacteria | 686 |
| 22 | Ga0058860_12083826 | 3300004801 | Bacteria | 563 |
| 23 | Ga0065714_10021064 | 3300005288 | Bacteria | 1355 |
| 24 | Ga0070658_10234640 | 3300005327 | Bacteria | 1554 |
| 25 | Ga0070658_10811873 | 3300005327 | Bacteria | 813 |
| 26 | Ga0070658_11836180 | 3300005327 | Bacteria | 524 |
| 27 | Ga0070683_100042888 | 3300005329 | Bacteria | 4168 |
| 28 | Ga0070683_100241552 | 3300005329 | Bacteria | 1718 |
| 29 | Ga0070683_100935755 | 3300005329 | Bacteria | 832 |
| 30 | Ga0070670_101012322 | 3300005331 | Bacteria | 756 |
| 31 | Ga0068869_100027886 | 3300005334 | Bacteria | 3941 |
| 32 | Ga0070680_100071213 | 3300005336 | Bacteria | 2856 |
| 33 | Ga0070691_10131642 | 3300005341 | Bacteria | 1268 |
| 34 | Ga0070661_100028384 | 3300005344 | Bacteria | 4036 |
| 35 | Ga0070661_101091293 | 3300005344 | Bacteria | 665 |
| 36 | Ga0070668_100028853 | 3300005347 | Bacteria | 4211 |
| 37 | Ga0070675_100006947 | 3300005354 | Bacteria | 8694 |
| 38 | Ga0070674_100031514 | 3300005356 | Bacteria | 3513 |
| 39 | Ga0070659_100071540 | 3300005366 | Bacteria | 2758 |
| 40 | Ga0070659_101040524 | 3300005366 | Bacteria | 720 |
| 41 | Ga0070659_101052696 | 3300005366 | Bacteria | 716 |
| 42 | Ga0070667_102015470 | 3300005367 | Bacteria | 544 |
| 43 | Ga0070709_10130788 | 3300005434 | Bacteria | 1713 |
| 44 | Ga0070709_10382677 | 3300005434 | Bacteria | 1046 |
| 45 | Ga0070714_100088026 | 3300005435 | Bacteria | 2716 |
| 46 | Ga0070714_101753115 | 3300005435 | Bacteria | 606 |
| 47 | Ga0070713_100436117 | 3300005436 | Bacteria | 1228 |
| 48 | Ga0070713_100457228 | 3300005436 | Bacteria | 1200 |
| 49 | Ga0070713_100535919 | 3300005436 | Bacteria | 1107 |
| 50 | Ga0070713_101990984 | 3300005436 | Bacteria | 563 |
| 51 | Ga0070710_10419884 | 3300005437 | Bacteria | 900 |
| 52 | Ga0070710_11282728 | 3300005437 | Bacteria | 544 |
| 53 | Ga0070711_100182444 | 3300005439 | Bacteria | 1607 |
| 54 | Ga0070711_101203046 | 3300005439 | Bacteria | 655 |
| 55 | Ga0070705_100013603 | 3300005440 | Bacteria | 4166 |
| 56 | Ga0070700_100014575 | 3300005441 | Bacteria | 4440 |
| 57 | Ga0070708_100002280 | 3300005445 | Bacteria | 14840 |
| 58 | Ga0070708_100126211 | 3300005445 | Bacteria | 2365 |
| 59 | Ga0070663_100002336 | 3300005455 | Bacteria | 10657 |
| 60 | Ga0070663_102037740 | 3300005455 | Bacteria | 517 |
| 61 | Ga0070678_100200714 | 3300005456 | Bacteria | 1646 |
| 62 | Ga0070678_100866760 | 3300005456 | Bacteria | 824 |
| 63 | Ga0070662_100006051 | 3300005457 | Bacteria | 7768 |
| 64 | Ga0070681_10413928 | 3300005458 | Bacteria | 1260 |
| 65 | Ga0068867_100117960 | 3300005459 | Bacteria | 2047 |
| 66 | Ga0070706_100027836 | 3300005467 | Bacteria | 5199 |
| 67 | Ga0070706_100084548 | 3300005467 | Bacteria | 2939 |
| 68 | Ga0070707_100012421 | 3300005468 | Bacteria | 7953 |
| 69 | Ga0070707_100231672 | 3300005468 | Bacteria | 1798 |
| 70 | Ga0070698_100005168 | 3300005471 | Bacteria | 14271 |
| 71 | Ga0070698_100005171 | 3300005471 | Bacteria | 14266 |
| 72 | Ga0070698_100039124 | 3300005471 | Bacteria | 4884 |
| 73 | Ga0070699_100834899 | 3300005518 | Bacteria | 843 |
| 74 | Ga0070684_100724682 | 3300005535 | Bacteria | 928 |
| 75 | Ga0070672_100133701 | 3300005543 | Bacteria | 2041 |
| 76 | Ga0070696_100077230 | 3300005546 | Bacteria | 2353 |
| 77 | Ga0070693_100027117 | 3300005547 | Bacteria | 3100 |
| 78 | Ga0070664_100001843 | 3300005564 | Bacteria | 16991 |
| 79 | Ga0068857_100182582 | 3300005577 | Bacteria | 1909 |
| 80 | Ga0068857_100223742 | 3300005577 | Bacteria | 1719 |
| 81 | Ga0068856_100035768 | 3300005614 | Bacteria | 4868 |
| 82 | Ga0070702_100000198 | 3300005615 | Bacteria | 19583 |
| 83 | Ga0068852_100201247 | 3300005616 | Bacteria | 1885 |
| 84 | Ga0068852_100653504 | 3300005616 | Bacteria | 1059 |
| 85 | Ga0068852_100737022 | 3300005616 | Bacteria | 997 |
| 86 | Ga0068864_101050701 | 3300005618 | Bacteria | 809 |
| 87 | Ga0068866_10196340 | 3300005718 | Bacteria | 1203 |
| 88 | Ga0068861_100148656 | 3300005719 | Bacteria | 1920 |
| 89 | Ga0068851_10273997 | 3300005834 | Bacteria | 963 |
| 90 | Ga0068863_100043625 | 3300005841 | Bacteria | 4257 |
| 91 | Ga0068860_100435859 | 3300005843 | Bacteria | 1301 |
| 92 | Ga0068860_100825889 | 3300005843 | Bacteria | 941 |
| 93 | Ga0070717_10006669 | 3300006028 | Bacteria | 8513 |
| 94 | Ga0070717_11000170 | 3300006028 | Bacteria | 761 |
| 95 | Ga0070715_10087090 | 3300006163 | Bacteria | 1429 |
| 96 | Ga0070715_10144323 | 3300006163 | Bacteria | 1159 |
| 97 | Ga0070716_100037364 | 3300006173 | Bacteria | 2683 |
| 98 | Ga0097621_100195669 | 3300006237 | Bacteria | 1753 |
| 99 | Ga0068871_101134296 | 3300006358 | Bacteria | 732 |
| 100 | Ga0075428_100751094 | 3300006844 | Bacteria | 1038 |
| 101 | Ga0068865_100092062 | 3300006881 | Bacteria | 2202 |
| 102 | Ga0068865_100564048 | 3300006881 | Bacteria | 958 |
| 103 | Ga0075435_100893637 | 3300007076 | Bacteria | 775 |
| 104 | Ga0105247_10148944 | 3300009101 | Bacteria | 1540 |
| 105 | Ga0114129_11263372 | 3300009147 | Bacteria | 917 |
| 106 | Ga0105243_10009041 | 3300009148 | Bacteria | 7609 |
| 107 | Ga0105243_11102760 | 3300009148 | Bacteria | 802 |
| 108 | Ga0105243_11307376 | 3300009148 | Bacteria | 742 |
| 109 | Ga0105241_10413392 | 3300009174 | Bacteria | 1186 |
| 110 | Ga0105242_10060234 | 3300009176 | Bacteria | 3118 |
| 111 | Ga0105237_10626144 | 3300009545 | Bacteria | 1083 |
| 112 | Ga0105238_10484427 | 3300009551 | Bacteria | 1236 |
| 113 | Ga0105238_10698990 | 3300009551 | Bacteria | 1026 |
| 114 | Ga0099796_10025254 | 3300010159 | Bacteria | 1874 |
| 115 | Ga0105246_10222948 | 3300011119 | Bacteria | 1479 |
| 116 | Ga0154019_134497 | 3300013044 | Bacteria | 811 |
| 117 | Ga0154014_152655 | 3300013052 | Bacteria | 702 |
| 118 | Ga0154012_129624 | 3300013059 | Bacteria | 689 |
| 119 | Ga0154012_174429 | 3300013059 | Bacteria | 586 |
| 120 | Ga0157373_10821137 | 3300013100 | Bacteria | 686 |
| 121 | Ga0157370_10355780 | 3300013104 | Bacteria | 1349 |
| 122 | Ga0157369_10016634 | 3300013105 | Bacteria | 8270 |
| 123 | Ga0157378_10014969 | 3300013297 | Bacteria | 6792 |
| 124 | Ga0163162_10092421 | 3300013306 | Bacteria | 3109 |
| 125 | Ga0163162_10751007 | 3300013306 | Bacteria | 1095 |
| 126 | Ga0163162_11350474 | 3300013306 | Bacteria | 810 |
| 127 | Ga0157372_10025059 | 3300013307 | Bacteria | 6482 |
| 128 | Ga0157375_10024756 | 3300013308 | Bacteria | 5562 |
| 129 | Ga0157375_11158497 | 3300013308 | Bacteria | 906 |
| 130 | Ga0163163_10365258 | 3300014325 | Bacteria | 1500 |
| 131 | Ga0163163_10868289 | 3300014325 | Bacteria | 966 |
| 132 | Ga0157380_10125706 | 3300014326 | Bacteria | 2179 |
| 133 | Ga0157380_10883529 | 3300014326 | Bacteria | 918 |
| 134 | Ga0157377_10416225 | 3300014745 | Bacteria | 919 |
| 135 | Ga0157376_11199243 | 3300014969 | Bacteria | 787 |
| 136 | Ga0163161_10065215 | 3300017792 | Bacteria | 2657 |
| 137 | Ga0197907_10601052 | 3300020069 | Bacteria | 1401 |
| 138 | Ga0197907_10857789 | 3300020069 | Bacteria | 525 |
| 139 | Ga0197907_11149652 | 3300020069 | Bacteria | 853 |
| 140 | Ga0197907_11162759 | 3300020069 | Bacteria | 968 |
| 141 | Ga0197907_11331483 | 3300020069 | Bacteria | 915 |
| 142 | Ga0206356_10828527 | 3300020070 | Bacteria | 669 |
| 143 | Ga0206349_1564623 | 3300020075 | Bacteria | 737 |
| 144 | Ga0206349_1821486 | 3300020075 | Bacteria | 997 |
| 145 | Ga0206349_1871115 | 3300020075 | Bacteria | 878 |
| 146 | Ga0206355_1044750 | 3300020076 | Bacteria | 1327 |
| 147 | Ga0206355_1163317 | 3300020076 | Bacteria | 836 |
| 148 | Ga0206355_1231465 | 3300020076 | Bacteria | 673 |
| 149 | Ga0206355_1455207 | 3300020076 | Bacteria | 732 |
| 150 | Ga0206351_10040481 | 3300020077 | Bacteria | 658 |
| 151 | Ga0206351_10300344 | 3300020077 | Bacteria | 884 |
| 152 | Ga0206351_10874627 | 3300020077 | Bacteria | 860 |
| 153 | Ga0206352_10035753 | 3300020078 | Bacteria | 668 |
| 154 | Ga0206352_10275810 | 3300020078 | Bacteria | 752 |
| 155 | Ga0206352_11105915 | 3300020078 | Bacteria | 817 |
| 156 | Ga0206352_11289692 | 3300020078 | Bacteria | 1034 |
| 157 | Ga0206350_10071743 | 3300020080 | Bacteria | 570 |
| 158 | Ga0206350_10290155 | 3300020080 | Bacteria | 773 |
| 159 | Ga0206350_10434865 | 3300020080 | Bacteria | 802 |
| 160 | Ga0206350_11411288 | 3300020080 | Bacteria | 1005 |
| 161 | Ga0206354_10666701 | 3300020081 | Bacteria | 1000 |
| 162 | Ga0206354_11502833 | 3300020081 | Bacteria | 634 |
| 163 | Ga0206354_11643590 | 3300020081 | Bacteria | 795 |
| 164 | Ga0206353_10015581 | 3300020082 | Bacteria | 707 |
| 165 | Ga0206353_10319916 | 3300020082 | Bacteria | 1118 |
| 166 | Ga0206353_10427005 | 3300020082 | Bacteria | 1270 |
| 167 | Ga0206353_10907110 | 3300020082 | Bacteria | 764 |
| 168 | Ga0206353_11676470 | 3300020082 | Bacteria | 820 |
| 169 | Ga0213875_10047878 | 3300021388 | Bacteria | 2006 |
| 170 | Ga0224712_10136689 | 3300022467 | Bacteria | 1075 |
| 171 | Ga0224712_10166025 | 3300022467 | Bacteria | 988 |
| 172 | Ga0224712_10172211 | 3300022467 | Bacteria | 971 |
| 173 | Ga0224712_10241241 | 3300022467 | Bacteria | 832 |
| 174 | Ga0224712_10422486 | 3300022467 | Bacteria | 637 |
| 175 | Ga0256743_123451 | 3300023436 | Bacteria | 973 |
| 176 | Ga0247552_100504 | 3300023536 | Bacteria | 966 |
| 177 | Ga0247551_100537 | 3300023552 | Bacteria | 1074 |
| 178 | Ga0247553_103103 | 3300023672 | Bacteria | 798 |
| 179 | Ga0224572_1003783 | 3300024225 | Bacteria | 2582 |
| 180 | Ga0228598_1021821 | 3300024227 | Bacteria | 1260 |
| 181 | Ga0228598_1058895 | 3300024227 | Bacteria | 764 |
| 182 | Ga0207656_10194956 | 3300025321 | Bacteria | 977 |
| 183 | Ga0207692_10168898 | 3300025898 | Bacteria | 1266 |
| 184 | Ga0207692_10212414 | 3300025898 | Bacteria | 1143 |
| 185 | Ga0207688_10133551 | 3300025901 | Bacteria | 1456 |
| 186 | Ga0207685_10015597 | 3300025905 | Bacteria | 2411 |
| 187 | Ga0207685_10095578 | 3300025905 | Bacteria | 1261 |
| 188 | Ga0207699_10102062 | 3300025906 | Bacteria | 1822 |
| 189 | Ga0207643_10392583 | 3300025908 | Bacteria | 876 |
| 190 | Ga0207643_10658402 | 3300025908 | Bacteria | 676 |
| 191 | Ga0207705_10375352 | 3300025909 | Bacteria | 1098 |
| 192 | Ga0207684_10065003 | 3300025910 | Bacteria | 3097 |
| 193 | Ga0207684_10074216 | 3300025910 | Bacteria | 2889 |
| 194 | Ga0207684_10145920 | 3300025910 | Bacteria | 2035 |
| 195 | Ga0207684_10263568 | 3300025910 | Bacteria | 1487 |
| 196 | Ga0207695_11652738 | 3300025913 | Bacteria | 521 |
| 197 | Ga0207693_10083322 | 3300025915 | Bacteria | 2505 |
| 198 | Ga0207693_10137136 | 3300025915 | Bacteria | 1924 |
| 199 | Ga0207693_10875090 | 3300025915 | Bacteria | 690 |
| 200 | Ga0207663_10023704 | 3300025916 | Bacteria | 3526 |
| 201 | Ga0207663_10409044 | 3300025916 | Bacteria | 1039 |
| 202 | Ga0207657_10034194 | 3300025919 | Bacteria | 4573 |
| 203 | Ga0207649_10520788 | 3300025920 | Bacteria | 906 |
| 204 | Ga0207649_11074212 | 3300025920 | Bacteria | 634 |
| 205 | Ga0207652_10904114 | 3300025921 | Bacteria | 780 |
| 206 | Ga0207646_10288504 | 3300025922 | Bacteria | 1483 |
| 207 | Ga0207646_10347531 | 3300025922 | Bacteria | 1340 |
| 208 | Ga0207694_10485394 | 3300025924 | Bacteria | 1034 |
| 209 | Ga0207659_10014142 | 3300025926 | Bacteria | 5140 |
| 210 | Ga0207687_10020636 | 3300025927 | Bacteria | 4372 |
| 211 | Ga0207700_10615967 | 3300025928 | Bacteria | 967 |
| 212 | Ga0207700_10998090 | 3300025928 | Bacteria | 749 |
| 213 | Ga0207664_10100179 | 3300025929 | Bacteria | 2392 |
| 214 | Ga0207664_10111385 | 3300025929 | Bacteria | 2277 |
| 215 | Ga0207664_10209153 | 3300025929 | Bacteria | 1687 |
| 216 | Ga0207664_10307892 | 3300025929 | Bacteria | 1395 |
| 217 | Ga0207644_10481626 | 3300025931 | Bacteria | 1022 |
| 218 | Ga0207690_10332460 | 3300025932 | Bacteria | 1197 |
| 219 | Ga0207706_10065674 | 3300025933 | Bacteria | 3194 |
| 220 | Ga0207686_10059204 | 3300025934 | Bacteria | 2419 |
| 221 | Ga0207709_10095939 | 3300025935 | Bacteria | 1949 |
| 222 | Ga0207669_10053009 | 3300025937 | Bacteria | 2441 |
| 223 | Ga0207669_10477145 | 3300025937 | Bacteria | 993 |
| 224 | Ga0207704_10017593 | 3300025938 | Bacteria | 3711 |
| 225 | Ga0207704_10395241 | 3300025938 | Bacteria | 1089 |
| 226 | Ga0207665_10012742 | 3300025939 | Bacteria | 5529 |
| 227 | Ga0207691_10071731 | 3300025940 | Bacteria | 3125 |
| 228 | Ga0207689_10009163 | 3300025942 | Bacteria | 8562 |
| 229 | Ga0207661_10287466 | 3300025944 | Bacteria | 1471 |
| 230 | Ga0207661_10441525 | 3300025944 | Bacteria | 1184 |
| 231 | Ga0207661_11065674 | 3300025944 | Bacteria | 744 |
| 232 | Ga0207679_10003555 | 3300025945 | Bacteria | 9656 |
| 233 | Ga0207678_10012901 | 3300026067 | Bacteria | 7334 |
| 234 | Ga0207708_10003635 | 3300026075 | Bacteria | 11371 |
| 235 | Ga0207702_10278630 | 3300026078 | Bacteria | 1580 |
| 236 | Ga0207702_10316034 | 3300026078 | Bacteria | 1486 |
| 237 | Ga0207648_10185813 | 3300026089 | Bacteria | 1841 |
| 238 | Ga0207674_10003200 | 3300026116 | Bacteria | 20160 |
| 239 | Ga0207674_10049600 | 3300026116 | Bacteria | 4293 |
| 240 | Ga0207674_10087111 | 3300026116 | Bacteria | 3117 |
| 241 | Ga0207675_100220457 | 3300026118 | Bacteria | 1827 |
| 242 | Ga0207683_10150972 | 3300026121 | Bacteria | 2097 |
| 243 | Ga0207683_10242834 | 3300026121 | Bacteria | 1643 |
| 244 | Ga0207698_10265011 | 3300026142 | Bacteria | 1580 |
| 245 | Ga0207698_10473427 | 3300026142 | Bacteria | 1214 |
| 246 | Ga0207428_10049480 | 3300027907 | Bacteria | 3368 |
| 247 | Ga0268264_11364600 | 3300028381 | Bacteria | 719 |
| 248 | Ga0265334_10025340 | 3300028573 | Bacteria | 2401 |
| 249 | Ga0307515_10195134 | 3300028794 | Bacteria | 1920 |
| 250 | Ga0307515_10239157 | 3300028794 | Bacteria | 1591 |
| 251 | Ga0311003_165979 | 3300029282 | Bacteria | 696 |
| 252 | Ga0311003_169922 | 3300029282 | Bacteria | 600 |
| 253 | Ga0310981_1086556 | 3300029285 | Bacteria | 819 |
| 254 | Ga0265763_1016447 | 3300030763 | Bacteria | 742 |
| 255 | Ga0265764_104361 | 3300030882 | Bacteria | 768 |
| 256 | Ga0265761_103986 | 3300030889 | Bacteria | 741 |
| 257 | Ga0265761_106896 | 3300030889 | Bacteria | 613 |
| 258 | Ga0265773_1011800 | 3300031018 | Bacteria | 756 |
| 259 | Ga0265760_10014888 | 3300031090 | Bacteria | 2230 |
| 260 | Ga0265760_10266353 | 3300031090 | Bacteria | 598 |
| 261 | Ga0265340_10002795 | 3300031247 | Bacteria | 9932 |
| 262 | Ga0307408_100658331 | 3300031548 | Bacteria | 937 |
| 263 | Ga0307508_10424947 | 3300031616 | Bacteria | 920 |
| 264 | Ga0307413_10520358 | 3300031824 | Bacteria | 959 |
| 265 | Ga0307410_10056981 | 3300031852 | Bacteria | 2659 |
| 266 | Ga0307406_10223622 | 3300031901 | Bacteria | 1401 |
| 267 | Ga0307406_10263291 | 3300031901 | Bacteria | 1306 |
| 268 | Ga0307409_100032855 | 3300031995 | Bacteria | 3768 |
| 269 | Ga0307409_100151026 | 3300031995 | Bacteria | 2017 |
| 270 | Ga0307409_100291582 | 3300031995 | Bacteria | 1513 |
| 271 | Ga0307409_101304606 | 3300031995 | Bacteria | 751 |
| 272 | Ga0307416_100306774 | 3300032002 | Bacteria | 1581 |
| 273 | Ga0307416_100486315 | 3300032002 | Bacteria | 1295 |
| 274 | Ga0307416_100561922 | 3300032002 | Bacteria | 1216 |
| 275 | Ga0307414_10280333 | 3300032004 | Bacteria | 1400 |
| 276 | Ga0307411_10189560 | 3300032005 | Bacteria | 1569 |
| 277 | Ga0307415_100119530 | 3300032126 | Bacteria | 1973 |
| 278 | Ga0307415_100138633 | 3300032126 | Bacteria | 1854 |
| 279 | Ga0307415_100731221 | 3300032126 | Bacteria | 896 |
| 280 | Ga0373926_0001724 | 3300035083 | Bacteria | 6769 |
| 281 | Ga0373934_0000617 | 3300035086 | Bacteria | 12514 |
| 282 | Ga0373934_0154541 | 3300035086 | Bacteria | 940 |
| 283 | Ga0373944_0000692 | 3300035089 | Bacteria | 8111 |
| 284 | Ga0373923_0231306 | 3300035111 | Bacteria | 861 |
| 285 | Ga0373936_0001828 | 3300035113 | Bacteria | 7832 |
| 286 | Ga0373936_0003698 | 3300035113 | Bacteria | 5742 |
| 287 | Ga0373945_0002371 | 3300035116 | Bacteria | 5907 |
| 288 | Ga0373953_0000138 | 3300035117 | Bacteria | 18268 |
| 289 | Ga0373954_0076350 | 3300035118 | Bacteria | 1597 |
| 290 | Ga0373956_0000951 | 3300035119 | Bacteria | 12044 |
| 291 | Ga0373956_0270617 | 3300035119 | Bacteria | 808 |
| 292 | Ga0373957_0000328 | 3300035120 | Bacteria | 11971 |
| 293 | Ga0373957_0060907 | 3300035120 | Bacteria | 1462 |
| 294 | Ga0373943_0002227 | 3300035170 | Bacteria | 8820 |
| 295 | Ga0373946_0000163 | 3300035171 | Bacteria | 20283 |
| 296 | Ga0373955_0000013 | 3300035172 | Bacteria | 73449 |
| 297 | Ga0373924_0000385 | 3300035410 | Bacteria | 13577 |
| 298 | Ga0373931_0631481 | 3300035691 | Bacteria | 702 |
| 299 | Ga0373935_0122992 | 3300035692 | Bacteria | 1735 |
| 300 | Ga0373935_0467119 | 3300035692 | Bacteria | 913 |
| 301 | Ga0373927_0009072 | 3300035695 | Bacteria | 6675 |
| 302 | Ga0373933_0000139 | 3300035724 | Bacteria | 46756 |
| 303 | Ga0373933_0048277 | 3300035724 | Bacteria | 2534 |
| 304 | Ga0373947_0007483 | 3300035725 | Bacteria | 6319 |
| 305 | Ga0373947_0105611 | 3300035725 | Bacteria | 1774 |
| 306 | Ga0373947_0252909 | 3300035725 | Bacteria | 1166 |
| 307 | Ga0373937_0000112 | 3300036401 | Bacteria | 77473 |
| 308 | Ga0373937_0481770 | 3300036401 | Bacteria | 1178 |
| 309 | Ga0373937_0677171 | 3300036401 | Bacteria | 977 |
| 310 | Ga0265778_022729 | 3300036457 | Bacteria | 782 |
| 311 | Ga0373925_0016436 | 3300037068 | Bacteria | 5360 |
| 312 | Ga0373925_0289213 | 3300037068 | Bacteria | 1321 |
| 313 | Ga0373925_0673732 | 3300037068 | Bacteria | 852 |
| 314 | Ga0373925_1197691 | 3300037068 | Bacteria | 624 |
| 315 | Ga0395898_0271155 | 3300037466 | Bacteria | 1618 |
| 316 | Ga0436364_0221389 | 3300037853 | Bacteria | 718 |
| 317 | Ga0436364_0664769 | 3300037853 | Bacteria | 2158 |
| 318 | Ga0436364_0982400 | 3300037853 | Bacteria | 1158 |
| 319 | Ga0436364_1160647 | 3300037853 | Bacteria | 1175 |
| 320 | Ga0436364_1449392 | 3300037853 | Bacteria | 5746 |
| 321 | Ga0395901_0138759 | 3300038443 | Bacteria | 2555 |
| 322 | Ga0436365_0009793 | 3300039437 | Bacteria | 767 |
| 323 | Ga0436365_1465599 | 3300039437 | Bacteria | 1234 |
| 324 | Ga0436360_0704114 | 3300039438 | Bacteria | 567 |
| 325 | Ga0436363_0879956 | 3300039450 | Bacteria | 1272 |
| 326 | Ga0439436_0235981 | 3300041404 | Bacteria | 528 |
| 327 | Ga0451793_0010092 | 3300041452 | Bacteria | 803 |
| 328 | Ga0451833_1400870 | 3300041491 | Bacteria | 1364 |
| 329 | Ga0451849_0283202 | 3300041505 | Bacteria | 533 |
| 330 | Ga0451843_0117617 | 3300041509 | Bacteria | 795 |
| 331 | Ga0451853_0113190 | 3300041512 | Bacteria | 1689 |
| 332 | Ga0451853_1295242 | 3300041512 | Bacteria | 1690 |
| 333 | Ga0439432_056443 | 3300042006 | Bacteria | 1217 |
| 334 | Ga0439456_114978 | 3300042013 | Bacteria | 614 |
| 335 | Ga0439457_007769 | 3300042014 | Bacteria | 2562 |
| 336 | Ga0450907_050248 | 3300042146 | Bacteria | 717 |
| 337 | Ga0450901_012846 | 3300042533 | Bacteria | 875 |
| 338 | Ga0466965_0101078 | 3300044683 | Bacteria | 1475 |
| 339 | Ga0466963_0004113 | 3300044694 | Bacteria | 8416 |
| 340 | Ga0466963_0143290 | 3300044694 | Bacteria | 1656 |
| 341 | Ga0466970_0687559 | 3300044765 | Bacteria | 596 |
| 342 | Ga0466960_0080702 | 3300044901 | Bacteria | 1639 |
| 343 | Ga0466958_0534788 | 3300045836 | Bacteria | 761 |
| 344 | Ga0466967_0025673 | 3300045976 | Bacteria | 4861 |
| 345 | Ga0466967_2194471 | 3300045976 | Bacteria | 548 |
| 346 | Ga0495592_0000094 | 3300046454 | Bacteria | 78801 |
| 347 | Ga0495592_0015950 | 3300046454 | Bacteria | 5699 |
| 348 | Ga0495641_0034299 | 3300046461 | Bacteria | 2400 |
| 349 | Ga0495641_0236900 | 3300046461 | Bacteria | 820 |
| 350 | Ga0495641_0377675 | 3300046461 | Bacteria | 642 |
| 351 | Ga0495651_0000041 | 3300046462 | Bacteria | 94160 |
| 352 | Ga0495651_0002063 | 3300046462 | Bacteria | 15529 |
| 353 | Ga0495651_0097057 | 3300046462 | Bacteria | 2201 |
| 354 | Ga0495653_0013086 | 3300046463 | Bacteria | 6764 |
| 355 | Ga0495653_0013477 | 3300046463 | Bacteria | 6661 |
| 356 | Ga0495653_0040650 | 3300046463 | Bacteria | 3633 |
| 357 | Ga0495580_0005827 | 3300046472 | Bacteria | 10107 |
| 358 | Ga0495582_0046247 | 3300046473 | Bacteria | 2397 |
| 359 | Ga0495639_0074184 | 3300046475 | Bacteria | 1576 |
| 360 | Ga0495662_0000390 | 3300046476 | Bacteria | 19590 |
| 361 | Ga0495662_0022507 | 3300046476 | Bacteria | 3043 |
| 362 | Ga0495664_0003456 | 3300046477 | Bacteria | 8593 |
| 363 | Ga0495664_0022835 | 3300046477 | Bacteria | 3629 |
| 364 | Ga0495608_0000081 | 3300046511 | Bacteria | 69898 |
| 365 | Ga0495608_0006616 | 3300046511 | Bacteria | 8228 |
| 366 | Ga0495608_0038981 | 3300046511 | Bacteria | 3187 |
| 367 | Ga0495618_0081028 | 3300046514 | Bacteria | 2072 |
| 368 | Ga0495628_0001589 | 3300046516 | Bacteria | 20837 |
| 369 | Ga0495628_0036245 | 3300046516 | Bacteria | 3960 |
| 370 | Ga0495628_0346170 | 3300046516 | Bacteria | 1093 |
| 371 | Ga0495630_0038944 | 3300046517 | Bacteria | 3555 |
| 372 | Ga0495630_0049467 | 3300046517 | Bacteria | 3146 |
| 373 | Ga0495666_0018682 | 3300046526 | Bacteria | 3444 |
| 374 | Ga0495652_0001330 | 3300046529 | Bacteria | 27552 |
| 375 | Ga0495652_0010650 | 3300046529 | Bacteria | 8330 |
| 376 | Ga0495652_0030673 | 3300046529 | Bacteria | 4712 |
| 377 | Ga0495665_0011264 | 3300046531 | Bacteria | 4842 |
| 378 | Ga0495665_0024076 | 3300046531 | Bacteria | 3270 |
| 379 | Ga0495640_0010828 | 3300046533 | Bacteria | 7035 |
| 380 | Ga0495640_0159766 | 3300046533 | Bacteria | 1445 |
| 381 | Ga0495586_0016566 | 3300046535 | Bacteria | 3921 |
| 382 | Ga0495587_0000038 | 3300046536 | Bacteria | 116118 |
| 383 | Ga0495587_0005716 | 3300046536 | Bacteria | 8104 |
| 384 | Ga0495587_0243088 | 3300046536 | Bacteria | 1013 |
| 385 | Ga0495645_0003715 | 3300046543 | Bacteria | 10377 |
| 386 | Ga0495645_0244959 | 3300046543 | Bacteria | 1194 |
| 387 | Ga0495667_0000070 | 3300046559 | Bacteria | 78776 |
| 388 | Ga0495667_0008085 | 3300046559 | Bacteria | 7138 |
| 389 | Ga0495667_0008797 | 3300046559 | Bacteria | 6864 |
| 390 | Ga0495667_0094527 | 3300046559 | Bacteria | 1935 |
| 391 | Ga0495634_0033793 | 3300046642 | Bacteria | 3512 |
| 392 | Ga0495634_0061971 | 3300046642 | Bacteria | 2484 |
| 393 | Ga0495635_0002519 | 3300046663 | Bacteria | 12529 |
| 394 | Ga0495635_0012485 | 3300046663 | Bacteria | 5950 |
| 395 | Ga0495635_0089299 | 3300046663 | Bacteria | 2108 |
| 396 | Ga0495657_0001540 | 3300046675 | Bacteria | 19817 |
| 397 | Ga0495657_0033029 | 3300046675 | Bacteria | 3606 |
| 398 | Ga0495657_0210984 | 3300046675 | Bacteria | 1180 |
| 399 | Ga0495657_0225287 | 3300046675 | Bacteria | 1135 |
| 400 | Ga0495599_0000100 | 3300046678 | Bacteria | 60814 |
| 401 | Ga0495599_0005565 | 3300046678 | Bacteria | 7556 |
| 402 | Ga0495599_0093710 | 3300046678 | Bacteria | 1873 |
| 403 | Ga0495623_0000609 | 3300046679 | Bacteria | 23835 |
| 404 | Ga0495623_0007953 | 3300046679 | Bacteria | 6891 |
| 405 | Ga0495646_0008190 | 3300046680 | Bacteria | 6642 |
| 406 | Ga0495646_0010557 | 3300046680 | Bacteria | 5867 |
| 407 | Ga0495613_0018672 | 3300046689 | Bacteria | 5170 |
| 408 | Ga0495624_0012594 | 3300046690 | Bacteria | 5774 |
| 409 | Ga0495600_0002560 | 3300046809 | Bacteria | 10482 |
| 410 | Ga0495600_0047712 | 3300046809 | Bacteria | 2794 |
| 411 | Ga0495600_0047729 | 3300046809 | Bacteria | 2794 |
| 412 | Ga0495600_0414045 | 3300046809 | Bacteria | 837 |
| 413 | Ga0495604_0000061 | 3300047317 | Bacteria | 94158 |
| 414 | Ga0495604_0000113 | 3300047317 | Bacteria | 68389 |
| 415 | Ga0495604_0203283 | 3300047317 | Bacteria | 1373 |
| 416 | Ga0495604_0232143 | 3300047317 | Bacteria | 1265 |
| 417 | Ga0495674_0000494 | 3300047319 | Bacteria | 35995 |
| 418 | Ga0495674_0014322 | 3300047319 | Bacteria | 7426 |
| 419 | Ga0495676_0165032 | 3300047321 | Bacteria | 1563 |
| 420 | Ga0495680_0000099 | 3300047322 | Bacteria | 78801 |
| 421 | Ga0495680_0028648 | 3300047322 | Bacteria | 4565 |
| 422 | Ga0495680_0049370 | 3300047322 | Bacteria | 3295 |
| 423 | Ga0495680_0349987 | 3300047322 | Bacteria | 1029 |
| 424 | Ga0495680_0768952 | 3300047322 | Bacteria | 631 |
| 425 | Ga0495675_0002112 | 3300047444 | Bacteria | 11852 |
| 426 | Ga0495675_0003973 | 3300047444 | Bacteria | 8963 |
| 427 | Ga0495675_0590308 | 3300047444 | Bacteria | 630 |
| 428 | Ga0495684_0011762 | 3300047471 | Bacteria | 6755 |
| 429 | Ga0495684_0014873 | 3300047471 | Bacteria | 5991 |
| 430 | Ga0495684_0020734 | 3300047471 | Bacteria | 5064 |
| 431 | Ga0495593_0003677 | 3300047673 | Bacteria | 9157 |
| 432 | Ga0495602_0000649 | 3300048088 | Bacteria | 32571 |
| 433 | Ga0495602_0015786 | 3300048088 | Bacteria | 7606 |
| 434 | Ga0495602_0242024 | 3300048088 | Bacteria | 1349 |
| 435 | Ga0496100_1279854 | 3300048903 | Bacteria | 579 |
| 436 | Ga0496101_0217538 | 3300048904 | Bacteria | 1482 |
| 437 | Ga0496101_0255739 | 3300048904 | Bacteria | 1365 |
| 438 | Ga0496101_0451439 | 3300048904 | Bacteria | 1014 |
| 439 | Ga0496104_0259859 | 3300048907 | Bacteria | 1649 |
| 440 | Ga0496104_0435768 | 3300048907 | Bacteria | 1222 |
| 441 | Ga0496105_0440495 | 3300048908 | Bacteria | 1029 |
| 442 | Ga0496106_0135921 | 3300048909 | Bacteria | 1931 |
| 443 | Ga0496106_0363736 | 3300048909 | Bacteria | 1162 |
| 444 | Ga0496107_0275723 | 3300048910 | Bacteria | 1252 |
| 445 | Ga0496108_0273398 | 3300048911 | Bacteria | 1471 |
| 446 | Ga0496109_0010829 | 3300048912 | Bacteria | 7808 |
| 447 | Ga0496109_0448909 | 3300048912 | Bacteria | 1218 |
| 448 | Ga0496110_0009432 | 3300048913 | Bacteria | 7905 |
| 449 | Ga0496111_0367834 | 3300048914 | Bacteria | 1064 |
| 450 | Ga0496112_0631376 | 3300048915 | Bacteria | 1002 |
| 451 | Ga0496115_0325156 | 3300048918 | Bacteria | 1257 |
| 452 | Ga0496115_0746251 | 3300048918 | Bacteria | 766 |
| 453 | Ga0496121_0564188 | 3300048924 | Bacteria | 710 |
| 454 | Ga0496126_0229548 | 3300048929 | Bacteria | 1556 |
| 455 | Ga0501306_010747 | 3300049127 | Bacteria | 1157 |
| 456 | Ga0501308_006718 | 3300049128 | Bacteria | 1187 |
| 457 | Ga0501309_014047 | 3300049129 | Bacteria | 1071 |
| 458 | Ga0501310_009556 | 3300049130 | Bacteria | 1071 |
| 459 | Ga0501310_009626 | 3300049130 | Bacteria | 1068 |
| 460 | Ga0501304_003533 | 3300049160 | Bacteria | 1150 |
| 461 | Ga0501305_013343 | 3300049161 | Bacteria | 1135 |
| 462 | Ga0501307_008964 | 3300049162 | Bacteria | 1135 |
| 463 | Ga0501311_012135 | 3300049527 | Bacteria | 1071 |
| 464 | Ga0501311_035147 | 3300049527 | Bacteria | 740 |
| 465 | Ga0501312_014450 | 3300049528 | Bacteria | 1110 |
| 466 | Ga0501312_032451 | 3300049528 | Bacteria | 825 |
| 467 | Ga0501313_006386 | 3300049529 | Bacteria | 1276 |
| 468 | Ga0501314_004769 | 3300049530 | Bacteria | 1135 |
| 469 | Ga0501315_009523 | 3300049531 | Bacteria | 1150 |
| 470 | Ga0501315_027721 | 3300049531 | Bacteria | 801 |
| 471 | Ga0501316_008319 | 3300049532 | Bacteria | 1144 |
| 472 | Ga0501316_012735 | 3300049532 | Bacteria | 987 |
| 473 | Ga0501317_009818 | 3300049533 | Bacteria | 1131 |
| 474 | Ga0501317_012535 | 3300049533 | Bacteria | 1047 |
| 475 | Ga0501317_061275 | 3300049533 | Bacteria | 618 |
| 476 | Ga0501318_007614 | 3300049534 | Bacteria | 1137 |
| 477 | Ga0501318_009684 | 3300049534 | Bacteria | 1056 |
| 478 | Ga0501319_002776 | 3300049535 | Bacteria | 1133 |
| 479 | Ga0501320_005938 | 3300049536 | Bacteria | 1130 |
| 480 | Ga0501321_008384 | 3300049537 | Bacteria | 1095 |
| 481 | Ga0501321_054497 | 3300049537 | Bacteria | 591 |
| 482 | Ga0501322_002375 | 3300049538 | Bacteria | 1150 |
| 483 | Ga0501323_018225 | 3300049539 | Bacteria | 907 |
| 484 | Ga0501324_005072 | 3300049540 | Bacteria | 1070 |
| 485 | Ga0501325_005925 | 3300049541 | Bacteria | 988 |
| 486 | Ga0501328_04491 | 3300049544 | Bacteria | 679 |
| 487 | Ga0501330_007298 | 3300049546 | Bacteria | 739 |
| 488 | Ga0501332_07952 | 3300049548 | Bacteria | 683 |
| 489 | Ga0501337_010335 | 3300049553 | Bacteria | 679 |
| 490 | Ga0501033_0206149 | 3300049570 | Bacteria | 1403 |
| 491 | Ga0501043_0372961 | 3300049579 | Bacteria | 1081 |
| 492 | Ga0501035_0423786 | 3300049822 | Bacteria | 1104 |
| 493 | Ga0501045_1040041 | 3300049824 | Bacteria | 600 |
| 494 | nmdc:mga05p37_662627_c1 | 3300050507 | Bacteria | 1166 |
| 495 | nmdc:mga08x19_726437_c1 | 3300050514 | Bacteria | 705 |
| 496 | Ga0495601_0005598 | 3300053077 | Bacteria | 7326 |
| 497 | Ga0495595_0000708 | 3300053084 | Bacteria | 12706 |
| 498 | Ga0495619_0166497 | 3300053085 | Bacteria | 1523 |
| 499 | Ga0495619_0217718 | 3300053085 | Bacteria | 1323 |
| 500 | Ga0500573_0090421 | 3300053140 | Bacteria | 1730 |
| 501 | Ga0500616_0000144 | 3300053153 | Bacteria | 121889 |
| 502 | Ga0500645_041594 | 3300053730 | Bacteria | 1357 |
| 503 | Ga0587093_029114 | 3300059478 | Bacteria | 785 |
| 504 | Ga0587070_100377 | 3300059491 | Bacteria | 665 |
| 505 | Ga0587082_061652 | 3300059504 | Bacteria | 741 |
| 506 | Ga0587089_065246 | 3300059509 | Bacteria | 609 |
| 507 | Ga0587090_095625 | 3300059510 | Bacteria | 615 |
| 508 | Ga0587090_111017 | 3300059510 | Bacteria | 585 |
| 509 | Ga0587125_053961 | 3300059607 | Bacteria | 573 |
| 510 | Ga0587099_022632 | 3300059622 | Bacteria | 719 |
| 511 | Ga0587099_039607 | 3300059622 | Bacteria | 600 |
| 512 | Ga0587115_044976 | 3300059626 | Bacteria | 701 |
| 513 | Ga0587075_033424 | 3300059644 | Bacteria | 830 |
| 514 | Ga0587105_016021 | 3300059651 | Bacteria | 620 |
| 515 | Ga0587119_042617 | 3300059658 | Bacteria | 656 |
| 516 | Ga0587096_01975 | 3300060247 | Bacteria | 743 |
| 517 | Ga0587071_066868 | 3300060344 | Bacteria | 775 |
| 518 | Ga0587071_101738 | 3300060344 | Bacteria | 665 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_11307376 | Ga0105243_113073761 | 143 |
| 2 | 3300060344 | Ga0587071_101738 | Ga0587071_101738_128_559 | 143 |
| 3 | iso_pu_bacteria | 2554235005 | 2554256753 | 143 |
| 4 | iso_pu_bacteria | 2643221601 | 2644014423 | 143 |
| 5 | iso_pu_bacteria | 2643221631 | 2644175860 | 143 |
| 6 | iso_pu_bacteria | 2643221678 | 2644439371 | 143 |
| 7 | iso_pu_bacteria | 2643221714 | 2644633255 | 143 |
| 8 | iso_pu_bacteria | 2675903060 | 2676494490 | 143 |
| 9 | iso_pu_bacteria | 2728369276 | 2729906649 | 143 |
| 10 | iso_pu_bacteria | 2808606359 | 2808843372 | 143 |
| 11 | iso_pu_bacteria | 2818991472 | 2819742288 | 143 |
| 12 | iso_pu_bacteria | 2848551377 | 2848553213 | 143 |
| 13 | iso_pu_bacteria | 2862178590 | 2862185290 | 143 |
| 14 | iso_pu_bacteria | 2867346516 | 2867349866 | 143 |
| 15 | iso_pu_bacteria | 2887443736 | 2887444586 | 143 |
| 16 | iso_pu_bacteria | 2919468124 | 2919470271 | 143 |
| 17 | iso_pu_bacteria | 2946072368 | 2946077146 | 143 |
| 18 | iso_pu_bacteria | 2990044586 | 2990044866 | 143 |
| 19 | iso_pu_bacteria | 3001889506 | 3001890624 | 143 |
| 20 | iso_pu_bacteria | 2585428094 | 2587863689 | 144 |
| 21 | iso_pu_bacteria | 2643221566 | 2643847814 | 144 |
| 22 | iso_pu_bacteria | 2643221635 | 2644197875 | 144 |
| 23 | iso_pu_bacteria | 2643221649 | 2644277761 | 144 |
| 24 | iso_pu_bacteria | 2757320536 | 2758224713 | 144 |
| 25 | iso_pu_bacteria | 2821268502 | 2821269074 | 144 |
| 26 | iso_pu_bacteria | 8002811521 | 8002811591 | 144 |
| 27 | iso_pu_bacteria | 2643221690 | 2644502871 | 145 |
| 28 | iso_pu_bacteria | 2643221694 | 2644525231 | 145 |
| 29 | iso_pu_bacteria | 2643221722 | 2644669319 | 145 |
| 30 | iso_pu_bacteria | 2758568522 | 2760304696 | 145 |
| 31 | iso_pu_bacteria | 2758568621 | 2760621488 | 145 |
| 32 | iso_pu_bacteria | 3002998708 | 3003001642 | 146 |
| 33 | iso_pu_bacteria | 8053945823 | 8053948683 | 146 |
| 34 | 3300003160 | Ga0006779J45831_103482 | Ga0006779J45831_1034821 | 147 |
| 35 | 3300003162 | Ga0006778J45830_1006918 | Ga0006778J45830_10069181 | 147 |
| 36 | 3300003163 | Ga0006759J45824_1017117 | Ga0006759J45824_10171171 | 147 |
| 37 | 3300003289 | Ga0006776J48906_107582 | Ga0006776J48906_1075821 | 147 |
| 38 | 3300003300 | Ga0006758J48902_1021532 | Ga0006758J48902_10215321 | 147 |
| 39 | 3300003305 | Ga0006770J48903_1014969 | Ga0006770J48903_10149691 | 147 |
| 40 | 3300003308 | Ga0006777J48905_1007106 | Ga0006777J48905_10071061 | 147 |
| 41 | 3300003544 | Ga0007417J51691_1013042 | Ga0007417J51691_10130421 | 147 |
| 42 | 3300003559 | Ga0007427J51700_105626 | Ga0007427J51700_1056261 | 147 |
| 43 | 3300003568 | Ga0006781J51513_1004893 | Ga0006781J51513_10048931 | 147 |
| 44 | 3300003574 | Ga0007410J51695_1010777 | Ga0007410J51695_10107771 | 147 |
| 45 | 3300003575 | Ga0007409J51694_1026381 | Ga0007409J51694_10263811 | 147 |
| 46 | 3300003577 | Ga0007416J51690_1011832 | Ga0007416J51690_10118321 | 147 |
| 47 | 3300003579 | Ga0007429J51699_1006292 | Ga0007429J51699_10062921 | 147 |
| 48 | 3300003613 | Ga0007415J51800_110175 | Ga0007415J51800_1101751 | 147 |
| 49 | 3300003693 | Ga0032354_1006556 | Ga0032354_10065561 | 147 |
| 50 | 3300003735 | Ga0006780_1002139 | Ga0006780_10021391 | 147 |
| 51 | 3300004785 | Ga0058858_1422307 | Ga0058858_14223071 | 147 |
| 52 | 3300004801 | Ga0058860_12083826 | Ga0058860_120838261 | 147 |
| 53 | 3300005288 | Ga0065714_10021064 | Ga0065714_100210641 | 147 |
| 54 | 3300005327 | Ga0070658_10234640 | Ga0070658_102346402 | 147 |
| 55 | 3300005327 | Ga0070658_11836180 | Ga0070658_118361801 | 147 |
| 56 | 3300005329 | Ga0070683_100042888 | Ga0070683_1000428883 | 147 |
| 57 | 3300005329 | Ga0070683_100935755 | Ga0070683_1009357551 | 147 |
| 58 | 3300005331 | Ga0070670_101012322 | Ga0070670_1010123221 | 147 |
| 59 | 3300005334 | Ga0068869_100027886 | Ga0068869_1000278864 | 147 |
| 60 | 3300005341 | Ga0070691_10131642 | Ga0070691_101316422 | 147 |
| 61 | 3300005344 | Ga0070661_100028384 | Ga0070661_1000283844 | 147 |
| 62 | 3300005344 | Ga0070661_101091293 | Ga0070661_1010912931 | 147 |
| 63 | 3300005347 | Ga0070668_100028853 | Ga0070668_1000288533 | 147 |
| 64 | 3300005354 | Ga0070675_100006947 | Ga0070675_1000069476 | 147 |
| 65 | 3300005356 | Ga0070674_100031514 | Ga0070674_1000315143 | 147 |
| 66 | 3300005366 | Ga0070659_100071540 | Ga0070659_1000715402 | 147 |
| 67 | 3300005366 | Ga0070659_101040524 | Ga0070659_1010405242 | 147 |
| 68 | 3300005367 | Ga0070667_102015470 | Ga0070667_1020154701 | 147 |
| 69 | 3300005434 | Ga0070709_10130788 | Ga0070709_101307883 | 147 |
| 70 | 3300005434 | Ga0070709_10382677 | Ga0070709_103826772 | 147 |
| 71 | 3300005435 | Ga0070714_100088026 | Ga0070714_1000880262 | 147 |
| 72 | 3300005435 | Ga0070714_101753115 | Ga0070714_1017531151 | 147 |
| 73 | 3300005436 | Ga0070713_100436117 | Ga0070713_1004361172 | 147 |
| 74 | 3300005436 | Ga0070713_100457228 | Ga0070713_1004572281 | 147 |
| 75 | 3300005436 | Ga0070713_100535919 | Ga0070713_1005359192 | 147 |
| 76 | 3300005436 | Ga0070713_101990984 | Ga0070713_1019909841 | 147 |
| 77 | 3300005437 | Ga0070710_10419884 | Ga0070710_104198842 | 147 |
| 78 | 3300005437 | Ga0070710_11282728 | Ga0070710_112827281 | 147 |
| 79 | 3300005439 | Ga0070711_100182444 | Ga0070711_1001824442 | 147 |
| 80 | 3300005439 | Ga0070711_101203046 | Ga0070711_1012030461 | 147 |
| 81 | 3300005440 | Ga0070705_100013603 | Ga0070705_1000136035 | 147 |
| 82 | 3300005441 | Ga0070700_100014575 | Ga0070700_1000145754 | 147 |
| 83 | 3300005445 | Ga0070708_100002280 | Ga0070708_10000228011 | 147 |
| 84 | 3300005445 | Ga0070708_100126211 | Ga0070708_1001262112 | 147 |
| 85 | 3300005455 | Ga0070663_100002336 | Ga0070663_10000233611 | 147 |
| 86 | 3300005455 | Ga0070663_102037740 | Ga0070663_1020377401 | 147 |
| 87 | 3300005456 | Ga0070678_100200714 | Ga0070678_1002007142 | 147 |
| 88 | 3300005456 | Ga0070678_100866760 | Ga0070678_1008667602 | 147 |
| 89 | 3300005457 | Ga0070662_100006051 | Ga0070662_1000060516 | 147 |
| 90 | 3300005458 | Ga0070681_10413928 | Ga0070681_104139281 | 147 |
| 91 | 3300005459 | Ga0068867_100117960 | Ga0068867_1001179602 | 147 |
| 92 | 3300005467 | Ga0070706_100027836 | Ga0070706_1000278365 | 147 |
| 93 | 3300005468 | Ga0070707_100012421 | Ga0070707_1000124212 | 147 |
| 94 | 3300005471 | Ga0070698_100005171 | Ga0070698_1000051719 | 147 |
| 95 | 3300005471 | Ga0070698_100039124 | Ga0070698_1000391243 | 147 |
| 96 | 3300005518 | Ga0070699_100834899 | Ga0070699_1008348991 | 147 |
| 97 | 3300005535 | Ga0070684_100724682 | Ga0070684_1007246822 | 147 |
| 98 | 3300005543 | Ga0070672_100133701 | Ga0070672_1001337014 | 147 |
| 99 | 3300005546 | Ga0070696_100077230 | Ga0070696_1000772303 | 147 |
| 100 | 3300005547 | Ga0070693_100027117 | Ga0070693_1000271173 | 147 |
| 101 | 3300005564 | Ga0070664_100001843 | Ga0070664_10000184312 | 147 |
| 102 | 3300005577 | Ga0068857_100182582 | Ga0068857_1001825822 | 147 |
| 103 | 3300005577 | Ga0068857_100223742 | Ga0068857_1002237423 | 147 |
| 104 | 3300005614 | Ga0068856_100035768 | Ga0068856_1000357682 | 147 |
| 105 | 3300005615 | Ga0070702_100000198 | Ga0070702_10000019810 | 147 |
| 106 | 3300005616 | Ga0068852_100201247 | Ga0068852_1002012472 | 147 |
| 107 | 3300005616 | Ga0068852_100653504 | Ga0068852_1006535042 | 147 |
| 108 | 3300005616 | Ga0068852_100737022 | Ga0068852_1007370221 | 147 |
| 109 | 3300005618 | Ga0068864_101050701 | Ga0068864_1010507012 | 147 |
| 110 | 3300005718 | Ga0068866_10196340 | Ga0068866_101963402 | 147 |
| 111 | 3300005719 | Ga0068861_100148656 | Ga0068861_1001486562 | 147 |
| 112 | 3300005834 | Ga0068851_10273997 | Ga0068851_102739971 | 147 |
| 113 | 3300005841 | Ga0068863_100043625 | Ga0068863_1000436252 | 147 |
| 114 | 3300005843 | Ga0068860_100435859 | Ga0068860_1004358593 | 147 |
| 115 | 3300005843 | Ga0068860_100825889 | Ga0068860_1008258891 | 147 |
| 116 | 3300006028 | Ga0070717_10006669 | Ga0070717_100066695 | 147 |
| 117 | 3300006028 | Ga0070717_11000170 | Ga0070717_110001701 | 147 |
| 118 | 3300006163 | Ga0070715_10087090 | Ga0070715_100870903 | 147 |
| 119 | 3300006163 | Ga0070715_10144323 | Ga0070715_101443231 | 147 |
| 120 | 3300006173 | Ga0070716_100037364 | Ga0070716_1000373643 | 147 |
| 121 | 3300006237 | Ga0097621_100195669 | Ga0097621_1001956693 | 147 |
| 122 | 3300006358 | Ga0068871_101134296 | Ga0068871_1011342962 | 147 |
| 123 | 3300006844 | Ga0075428_100751094 | Ga0075428_1007510941 | 147 |
| 124 | 3300006881 | Ga0068865_100092062 | Ga0068865_1000920622 | 147 |
| 125 | 3300006881 | Ga0068865_100564048 | Ga0068865_1005640482 | 147 |
| 126 | 3300007076 | Ga0075435_100893637 | Ga0075435_1008936371 | 147 |
| 127 | 3300009101 | Ga0105247_10148944 | Ga0105247_101489442 | 147 |
| 128 | 3300009147 | Ga0114129_11263372 | Ga0114129_112633721 | 147 |
| 129 | 3300009148 | Ga0105243_10009041 | Ga0105243_100090418 | 147 |
| 130 | 3300009148 | Ga0105243_11102760 | Ga0105243_111027601 | 147 |
| 131 | 3300009174 | Ga0105241_10413392 | Ga0105241_104133922 | 147 |
| 132 | 3300009176 | Ga0105242_10060234 | Ga0105242_100602342 | 147 |
| 133 | 3300009545 | Ga0105237_10626144 | Ga0105237_106261442 | 147 |
| 134 | 3300009551 | Ga0105238_10484427 | Ga0105238_104844272 | 147 |
| 135 | 3300009551 | Ga0105238_10698990 | Ga0105238_106989902 | 147 |
| 136 | 3300010159 | Ga0099796_10025254 | Ga0099796_100252542 | 147 |
| 137 | 3300011119 | Ga0105246_10222948 | Ga0105246_102229482 | 147 |
| 138 | 3300013052 | Ga0154014_152655 | Ga0154014_1526551 | 147 |
| 139 | 3300013059 | Ga0154012_129624 | Ga0154012_1296242 | 147 |
| 140 | 3300013059 | Ga0154012_174429 | Ga0154012_1744291 | 147 |
| 141 | 3300013100 | Ga0157373_10821137 | Ga0157373_108211371 | 147 |
| 142 | 3300013104 | Ga0157370_10355780 | Ga0157370_103557802 | 147 |
| 143 | 3300013105 | Ga0157369_10016634 | Ga0157369_100166345 | 147 |
| 144 | 3300013297 | Ga0157378_10014969 | Ga0157378_100149693 | 147 |
| 145 | 3300013306 | Ga0163162_10092421 | Ga0163162_100924213 | 147 |
| 146 | 3300013306 | Ga0163162_10751007 | Ga0163162_107510071 | 147 |
| 147 | 3300013306 | Ga0163162_11350474 | Ga0163162_113504741 | 147 |
| 148 | 3300013307 | Ga0157372_10025059 | Ga0157372_100250595 | 147 |
| 149 | 3300013308 | Ga0157375_10024756 | Ga0157375_100247567 | 147 |
| 150 | 3300013308 | Ga0157375_11158497 | Ga0157375_111584972 | 147 |
| 151 | 3300014325 | Ga0163163_10365258 | Ga0163163_103652583 | 147 |
| 152 | 3300014325 | Ga0163163_10868289 | Ga0163163_108682892 | 147 |
| 153 | 3300014326 | Ga0157380_10125706 | Ga0157380_101257063 | 147 |
| 154 | 3300014326 | Ga0157380_10883529 | Ga0157380_108835292 | 147 |
| 155 | 3300014745 | Ga0157377_10416225 | Ga0157377_104162252 | 147 |
| 156 | 3300014969 | Ga0157376_11199243 | Ga0157376_111992431 | 147 |
| 157 | 3300017792 | Ga0163161_10065215 | Ga0163161_100652151 | 147 |
| 158 | 3300020069 | Ga0197907_10601052 | Ga0197907_106010522 | 147 |
| 159 | 3300020069 | Ga0197907_10857789 | Ga0197907_108577891 | 147 |
| 160 | 3300020069 | Ga0197907_11149652 | Ga0197907_111496521 | 147 |
| 161 | 3300020069 | Ga0197907_11162759 | Ga0197907_111627591 | 147 |
| 162 | 3300020069 | Ga0197907_11331483 | Ga0197907_113314832 | 147 |
| 163 | 3300020075 | Ga0206349_1564623 | Ga0206349_15646231 | 147 |
| 164 | 3300020075 | Ga0206349_1821486 | Ga0206349_18214861 | 147 |
| 165 | 3300020075 | Ga0206349_1871115 | Ga0206349_18711152 | 147 |
| 166 | 3300020076 | Ga0206355_1044750 | Ga0206355_10447503 | 147 |
| 167 | 3300020076 | Ga0206355_1163317 | Ga0206355_11633172 | 147 |
| 168 | 3300020076 | Ga0206355_1455207 | Ga0206355_14552071 | 147 |
| 169 | 3300020077 | Ga0206351_10040481 | Ga0206351_100404811 | 147 |
| 170 | 3300020077 | Ga0206351_10300344 | Ga0206351_103003442 | 147 |
| 171 | 3300020077 | Ga0206351_10874627 | Ga0206351_108746272 | 147 |
| 172 | 3300020078 | Ga0206352_10035753 | Ga0206352_100357532 | 147 |
| 173 | 3300020078 | Ga0206352_10275810 | Ga0206352_102758101 | 147 |
| 174 | 3300020078 | Ga0206352_11105915 | Ga0206352_111059151 | 147 |
| 175 | 3300020078 | Ga0206352_11289692 | Ga0206352_112896922 | 147 |
| 176 | 3300020080 | Ga0206350_10071743 | Ga0206350_100717431 | 147 |
| 177 | 3300020080 | Ga0206350_11411288 | Ga0206350_114112882 | 147 |
| 178 | 3300020081 | Ga0206354_10666701 | Ga0206354_106667012 | 147 |
| 179 | 3300020081 | Ga0206354_11502833 | Ga0206354_115028331 | 147 |
| 180 | 3300020081 | Ga0206354_11643590 | Ga0206354_116435902 | 147 |
| 181 | 3300020082 | Ga0206353_10015581 | Ga0206353_100155812 | 147 |
| 182 | 3300020082 | Ga0206353_10319916 | Ga0206353_103199162 | 147 |
| 183 | 3300020082 | Ga0206353_10907110 | Ga0206353_109071102 | 147 |
| 184 | 3300020082 | Ga0206353_11676470 | Ga0206353_116764702 | 147 |
| 185 | 3300021388 | Ga0213875_10047878 | Ga0213875_100478781 | 147 |
| 186 | 3300022467 | Ga0224712_10172211 | Ga0224712_101722111 | 147 |
| 187 | 3300022467 | Ga0224712_10241241 | Ga0224712_102412412 | 147 |
| 188 | 3300022467 | Ga0224712_10422486 | Ga0224712_104224861 | 147 |
| 189 | 3300023436 | Ga0256743_123451 | Ga0256743_1234512 | 147 |
| 190 | 3300023536 | Ga0247552_100504 | Ga0247552_1005042 | 147 |
| 191 | 3300023552 | Ga0247551_100537 | Ga0247551_1005372 | 147 |
| 192 | 3300023672 | Ga0247553_103103 | Ga0247553_1031032 | 147 |
| 193 | 3300024225 | Ga0224572_1003783 | Ga0224572_10037833 | 147 |
| 194 | 3300024227 | Ga0228598_1021821 | Ga0228598_10218211 | 147 |
| 195 | 3300024227 | Ga0228598_1058895 | Ga0228598_10588952 | 147 |
| 196 | 3300025321 | Ga0207656_10194956 | Ga0207656_101949561 | 147 |
| 197 | 3300025898 | Ga0207692_10168898 | Ga0207692_101688982 | 147 |
| 198 | 3300025898 | Ga0207692_10212414 | Ga0207692_102124142 | 147 |
| 199 | 3300025901 | Ga0207688_10133551 | Ga0207688_101335513 | 147 |
| 200 | 3300025905 | Ga0207685_10015597 | Ga0207685_100155972 | 147 |
| 201 | 3300025905 | Ga0207685_10095578 | Ga0207685_100955782 | 147 |
| 202 | 3300025906 | Ga0207699_10102062 | Ga0207699_101020621 | 147 |
| 203 | 3300025908 | Ga0207643_10392583 | Ga0207643_103925831 | 147 |
| 204 | 3300025908 | Ga0207643_10658402 | Ga0207643_106584021 | 147 |
| 205 | 3300025909 | Ga0207705_10375352 | Ga0207705_103753522 | 147 |
| 206 | 3300025910 | Ga0207684_10145920 | Ga0207684_101459202 | 147 |
| 207 | 3300025910 | Ga0207684_10263568 | Ga0207684_102635681 | 147 |
| 208 | 3300025913 | Ga0207695_11652738 | Ga0207695_116527381 | 147 |
| 209 | 3300025915 | Ga0207693_10083322 | Ga0207693_100833222 | 147 |
| 210 | 3300025915 | Ga0207693_10137136 | Ga0207693_101371362 | 147 |
| 211 | 3300025915 | Ga0207693_10875090 | Ga0207693_108750902 | 147 |
| 212 | 3300025916 | Ga0207663_10023704 | Ga0207663_100237044 | 147 |
| 213 | 3300025916 | Ga0207663_10409044 | Ga0207663_104090442 | 147 |
| 214 | 3300025919 | Ga0207657_10034194 | Ga0207657_100341944 | 147 |
| 215 | 3300025920 | Ga0207649_11074212 | Ga0207649_110742121 | 147 |
| 216 | 3300025922 | Ga0207646_10347531 | Ga0207646_103475312 | 147 |
| 217 | 3300025924 | Ga0207694_10485394 | Ga0207694_104853942 | 147 |
| 218 | 3300025926 | Ga0207659_10014142 | Ga0207659_100141423 | 147 |
| 219 | 3300025927 | Ga0207687_10020636 | Ga0207687_100206365 | 147 |
| 220 | 3300025928 | Ga0207700_10615967 | Ga0207700_106159672 | 147 |
| 221 | 3300025928 | Ga0207700_10998090 | Ga0207700_109980902 | 147 |
| 222 | 3300025929 | Ga0207664_10100179 | Ga0207664_101001791 | 147 |
| 223 | 3300025929 | Ga0207664_10111385 | Ga0207664_101113852 | 147 |
| 224 | 3300025929 | Ga0207664_10209153 | Ga0207664_102091533 | 147 |
| 225 | 3300025929 | Ga0207664_10307892 | Ga0207664_103078923 | 147 |
| 226 | 3300025931 | Ga0207644_10481626 | Ga0207644_104816262 | 147 |
| 227 | 3300025932 | Ga0207690_10332460 | Ga0207690_103324602 | 147 |
| 228 | 3300025933 | Ga0207706_10065674 | Ga0207706_100656743 | 147 |
| 229 | 3300025934 | Ga0207686_10059204 | Ga0207686_100592042 | 147 |
| 230 | 3300025935 | Ga0207709_10095939 | Ga0207709_100959391 | 147 |
| 231 | 3300025937 | Ga0207669_10053009 | Ga0207669_100530091 | 147 |
| 232 | 3300025937 | Ga0207669_10477145 | Ga0207669_104771452 | 147 |
| 233 | 3300025938 | Ga0207704_10017593 | Ga0207704_100175932 | 147 |
| 234 | 3300025938 | Ga0207704_10395241 | Ga0207704_103952412 | 147 |
| 235 | 3300025939 | Ga0207665_10012742 | Ga0207665_100127423 | 147 |
| 236 | 3300025940 | Ga0207691_10071731 | Ga0207691_100717313 | 147 |
| 237 | 3300025942 | Ga0207689_10009163 | Ga0207689_100091636 | 147 |
| 238 | 3300025944 | Ga0207661_10287466 | Ga0207661_102874662 | 147 |
| 239 | 3300025944 | Ga0207661_11065674 | Ga0207661_110656741 | 147 |
| 240 | 3300025945 | Ga0207679_10003555 | Ga0207679_100035556 | 147 |
| 241 | 3300026067 | Ga0207678_10012901 | Ga0207678_100129017 | 147 |
| 242 | 3300026075 | Ga0207708_10003635 | Ga0207708_1000363512 | 147 |
| 243 | 3300026078 | Ga0207702_10278630 | Ga0207702_102786301 | 147 |
| 244 | 3300026078 | Ga0207702_10316034 | Ga0207702_103160342 | 147 |
| 245 | 3300026089 | Ga0207648_10185813 | Ga0207648_101858132 | 147 |
| 246 | 3300026116 | Ga0207674_10003200 | Ga0207674_1000320014 | 147 |
| 247 | 3300026116 | Ga0207674_10049600 | Ga0207674_100496006 | 147 |
| 248 | 3300026116 | Ga0207674_10087111 | Ga0207674_100871113 | 147 |
| 249 | 3300026118 | Ga0207675_100220457 | Ga0207675_1002204574 | 147 |
| 250 | 3300026121 | Ga0207683_10150972 | Ga0207683_101509722 | 147 |
| 251 | 3300026121 | Ga0207683_10242834 | Ga0207683_102428343 | 147 |
| 252 | 3300026142 | Ga0207698_10265011 | Ga0207698_102650112 | 147 |
| 253 | 3300026142 | Ga0207698_10473427 | Ga0207698_104734272 | 147 |
| 254 | 3300027907 | Ga0207428_10049480 | Ga0207428_100494804 | 147 |
| 255 | 3300028381 | Ga0268264_11364600 | Ga0268264_113646001 | 147 |
| 256 | 3300028573 | Ga0265334_10025340 | Ga0265334_100253403 | 147 |
| 257 | 3300028794 | Ga0307515_10195134 | Ga0307515_101951342 | 147 |
| 258 | 3300028794 | Ga0307515_10239157 | Ga0307515_102391572 | 147 |
| 259 | 3300029282 | Ga0311003_165979 | Ga0311003_1659791 | 147 |
| 260 | 3300029282 | Ga0311003_169922 | Ga0311003_1699221 | 147 |
| 261 | 3300029285 | Ga0310981_1086556 | Ga0310981_10865561 | 147 |
| 262 | 3300030763 | Ga0265763_1016447 | Ga0265763_10164472 | 147 |
| 263 | 3300030882 | Ga0265764_104361 | Ga0265764_1043611 | 147 |
| 264 | 3300030889 | Ga0265761_106896 | Ga0265761_1068961 | 147 |
| 265 | 3300031018 | Ga0265773_1011800 | Ga0265773_10118001 | 147 |
| 266 | 3300031090 | Ga0265760_10014888 | Ga0265760_100148882 | 147 |
| 267 | 3300031247 | Ga0265340_10002795 | Ga0265340_100027954 | 147 |
| 268 | 3300031548 | Ga0307408_100658331 | Ga0307408_1006583311 | 147 |
| 269 | 3300031616 | Ga0307508_10424947 | Ga0307508_104249471 | 147 |
| 270 | 3300031824 | Ga0307413_10520358 | Ga0307413_105203581 | 147 |
| 271 | 3300031852 | Ga0307410_10056981 | Ga0307410_100569814 | 147 |
| 272 | 3300031901 | Ga0307406_10223622 | Ga0307406_102236222 | 147 |
| 273 | 3300031901 | Ga0307406_10263291 | Ga0307406_102632912 | 147 |
| 274 | 3300031995 | Ga0307409_100032855 | Ga0307409_1000328555 | 147 |
| 275 | 3300031995 | Ga0307409_100151026 | Ga0307409_1001510263 | 147 |
| 276 | 3300031995 | Ga0307409_100291582 | Ga0307409_1002915822 | 147 |
| 277 | 3300031995 | Ga0307409_101304606 | Ga0307409_1013046062 | 147 |
| 278 | 3300032002 | Ga0307416_100306774 | Ga0307416_1003067742 | 147 |
| 279 | 3300032002 | Ga0307416_100486315 | Ga0307416_1004863151 | 147 |
| 280 | 3300032002 | Ga0307416_100561922 | Ga0307416_1005619222 | 147 |
| 281 | 3300032004 | Ga0307414_10280333 | Ga0307414_102803331 | 147 |
| 282 | 3300032005 | Ga0307411_10189560 | Ga0307411_101895603 | 147 |
| 283 | 3300032126 | Ga0307415_100119530 | Ga0307415_1001195302 | 147 |
| 284 | 3300032126 | Ga0307415_100138633 | Ga0307415_1001386332 | 147 |
| 285 | 3300032126 | Ga0307415_100731221 | Ga0307415_1007312212 | 147 |
| 286 | 3300035083 | Ga0373926_0001724 | Ga0373926_0001724_3460_3903 | 147 |
| 287 | 3300035086 | Ga0373934_0154541 | Ga0373934_0154541_238_681 | 147 |
| 288 | 3300035089 | Ga0373944_0000692 | Ga0373944_0000692_3392_3835 | 147 |
| 289 | 3300035111 | Ga0373923_0231306 | Ga0373923_0231306_166_609 | 147 |
| 290 | 3300035113 | Ga0373936_0001828 | Ga0373936_0001828_1794_2237 | 147 |
| 291 | 3300035113 | Ga0373936_0003698 | Ga0373936_0003698_650_1093 | 147 |
| 292 | 3300035116 | Ga0373945_0002371 | Ga0373945_0002371_3191_3634 | 147 |
| 293 | 3300035118 | Ga0373954_0076350 | Ga0373954_0076350_595_1038 | 147 |
| 294 | 3300035119 | Ga0373956_0270617 | Ga0373956_0270617_168_611 | 147 |
| 295 | 3300035120 | Ga0373957_0060907 | Ga0373957_0060907_435_878 | 147 |
| 296 | 3300035170 | Ga0373943_0002227 | Ga0373943_0002227_6470_6913 | 147 |
| 297 | 3300035171 | Ga0373946_0000163 | Ga0373946_0000163_5212_5655 | 147 |
| 298 | 3300035691 | Ga0373931_0631481 | Ga0373931_0631481_138_581 | 147 |
| 299 | 3300035692 | Ga0373935_0122992 | Ga0373935_0122992_1142_1585 | 147 |
| 300 | 3300035692 | Ga0373935_0467119 | Ga0373935_0467119_160_603 | 147 |
| 301 | 3300035695 | Ga0373927_0009072 | Ga0373927_0009072_5954_6397 | 147 |
| 302 | 3300035724 | Ga0373933_0048277 | Ga0373933_0048277_1038_1481 | 147 |
| 303 | 3300035725 | Ga0373947_0007483 | Ga0373947_0007483_2537_2980 | 147 |
| 304 | 3300035725 | Ga0373947_0105611 | Ga0373947_0105611_34_477 | 147 |
| 305 | 3300035725 | Ga0373947_0252909 | Ga0373947_0252909_555_998 | 147 |
| 306 | 3300036401 | Ga0373937_0481770 | Ga0373937_0481770_370_813 | 147 |
| 307 | 3300036401 | Ga0373937_0677171 | Ga0373937_0677171_488_931 | 147 |
| 308 | 3300036457 | Ga0265778_022729 | Ga0265778_022729_36_479 | 147 |
| 309 | 3300037068 | Ga0373925_0016436 | Ga0373925_0016436_4639_5082 | 147 |
| 310 | 3300037068 | Ga0373925_0289213 | Ga0373925_0289213_434_877 | 147 |
| 311 | 3300037068 | Ga0373925_0673732 | Ga0373925_0673732_338_781 | 147 |
| 312 | 3300037068 | Ga0373925_1197691 | Ga0373925_1197691_70_513 | 147 |
| 313 | 3300037466 | Ga0395898_0271155 | Ga0395898_0271155_88_531 | 147 |
| 314 | 3300037853 | Ga0436364_0221389 | Ga0436364_0221389_125_568 | 147 |
| 315 | 3300037853 | Ga0436364_0664769 | Ga0436364_0664769_1689_2132 | 147 |
| 316 | 3300037853 | Ga0436364_0982400 | Ga0436364_0982400_339_782 | 147 |
| 317 | 3300037853 | Ga0436364_1160647 | Ga0436364_1160647_562_1005 | 147 |
| 318 | 3300037853 | Ga0436364_1449392 | Ga0436364_1449392_821_1264 | 147 |
| 319 | 3300038443 | Ga0395901_0138759 | Ga0395901_0138759_2043_2486 | 147 |
| 320 | 3300039437 | Ga0436365_0009793 | Ga0436365_0009793_277_720 | 147 |
| 321 | 3300039437 | Ga0436365_1465599 | Ga0436365_1465599_113_556 | 147 |
| 322 | 3300039438 | Ga0436360_0704114 | Ga0436360_0704114_87_530 | 147 |
| 323 | 3300039450 | Ga0436363_0879956 | Ga0436363_0879956_155_598 | 147 |
| 324 | 3300041404 | Ga0439436_0235981 | Ga0439436_0235981_23_466 | 147 |
| 325 | 3300041452 | Ga0451793_0010092 | Ga0451793_0010092_124_567 | 147 |
| 326 | 3300041491 | Ga0451833_1400870 | Ga0451833_1400870_764_1207 | 147 |
| 327 | 3300041505 | Ga0451849_0283202 | Ga0451849_0283202_54_497 | 147 |
| 328 | 3300041509 | Ga0451843_0117617 | Ga0451843_0117617_246_689 | 147 |
| 329 | 3300041512 | Ga0451853_0113190 | Ga0451853_0113190_1231_1674 | 147 |
| 330 | 3300041512 | Ga0451853_1295242 | Ga0451853_1295242_1025_1468 | 147 |
| 331 | 3300042006 | Ga0439432_056443 | Ga0439432_056443_186_629 | 147 |
| 332 | 3300042013 | Ga0439456_114978 | Ga0439456_114978_131_574 | 147 |
| 333 | 3300042014 | Ga0439457_007769 | Ga0439457_007769_2000_2443 | 147 |
| 334 | 3300042146 | Ga0450907_050248 | Ga0450907_050248_91_534 | 147 |
| 335 | 3300042533 | Ga0450901_012846 | Ga0450901_012846_414_857 | 147 |
| 336 | 3300044683 | Ga0466965_0101078 | Ga0466965_0101078_135_578 | 147 |
| 337 | 3300044694 | Ga0466963_0004113 | Ga0466963_0004113_4355_4798 | 147 |
| 338 | 3300044694 | Ga0466963_0143290 | Ga0466963_0143290_62_505 | 147 |
| 339 | 3300044765 | Ga0466970_0687559 | Ga0466970_0687559_21_464 | 147 |
| 340 | 3300044901 | Ga0466960_0080702 | Ga0466960_0080702_765_1208 | 147 |
| 341 | 3300045836 | Ga0466958_0534788 | Ga0466958_0534788_235_678 | 147 |
| 342 | 3300045976 | Ga0466967_0025673 | Ga0466967_0025673_628_1071 | 147 |
| 343 | 3300045976 | Ga0466967_2194471 | Ga0466967_2194471_28_471 | 147 |
| 344 | 3300046454 | Ga0495592_0015950 | Ga0495592_0015950_1956_2399 | 147 |
| 345 | 3300046461 | Ga0495641_0034299 | Ga0495641_0034299_1161_1604 | 147 |
| 346 | 3300046461 | Ga0495641_0236900 | Ga0495641_0236900_272_715 | 147 |
| 347 | 3300046461 | Ga0495641_0377675 | Ga0495641_0377675_164_607 | 147 |
| 348 | 3300046462 | Ga0495651_0002063 | Ga0495651_0002063_4562_5005 | 147 |
| 349 | 3300046462 | Ga0495651_0097057 | Ga0495651_0097057_543_986 | 147 |
| 350 | 3300046463 | Ga0495653_0013086 | Ga0495653_0013086_3209_3652 | 147 |
| 351 | 3300046463 | Ga0495653_0013477 | Ga0495653_0013477_4985_5428 | 147 |
| 352 | 3300046472 | Ga0495580_0005827 | Ga0495580_0005827_9036_9479 | 147 |
| 353 | 3300046473 | Ga0495582_0046247 | Ga0495582_0046247_1256_1699 | 147 |
| 354 | 3300046475 | Ga0495639_0074184 | Ga0495639_0074184_554_997 | 147 |
| 355 | 3300046476 | Ga0495662_0000390 | Ga0495662_0000390_1828_2271 | 147 |
| 356 | 3300046476 | Ga0495662_0022507 | Ga0495662_0022507_2022_2465 | 147 |
| 357 | 3300046477 | Ga0495664_0003456 | Ga0495664_0003456_5750_6193 | 147 |
| 358 | 3300046477 | Ga0495664_0022835 | Ga0495664_0022835_1743_2186 | 147 |
| 359 | 3300046511 | Ga0495608_0006616 | Ga0495608_0006616_3225_3668 | 147 |
| 360 | 3300046511 | Ga0495608_0038981 | Ga0495608_0038981_2688_3131 | 147 |
| 361 | 3300046514 | Ga0495618_0081028 | Ga0495618_0081028_1055_1498 | 147 |
| 362 | 3300046516 | Ga0495628_0036245 | Ga0495628_0036245_1962_2405 | 147 |
| 363 | 3300046516 | Ga0495628_0346170 | Ga0495628_0346170_394_837 | 147 |
| 364 | 3300046517 | Ga0495630_0038944 | Ga0495630_0038944_1285_1728 | 147 |
| 365 | 3300046517 | Ga0495630_0049467 | Ga0495630_0049467_851_1294 | 147 |
| 366 | 3300046526 | Ga0495666_0018682 | Ga0495666_0018682_1046_1489 | 147 |
| 367 | 3300046529 | Ga0495652_0010650 | Ga0495652_0010650_662_1105 | 147 |
| 368 | 3300046529 | Ga0495652_0030673 | Ga0495652_0030673_3113_3556 | 147 |
| 369 | 3300046531 | Ga0495665_0011264 | Ga0495665_0011264_1812_2255 | 147 |
| 370 | 3300046531 | Ga0495665_0024076 | Ga0495665_0024076_2650_3093 | 147 |
| 371 | 3300046533 | Ga0495640_0010828 | Ga0495640_0010828_4071_4514 | 147 |
| 372 | 3300046533 | Ga0495640_0159766 | Ga0495640_0159766_731_1174 | 147 |
| 373 | 3300046535 | Ga0495586_0016566 | Ga0495586_0016566_2517_2960 | 147 |
| 374 | 3300046536 | Ga0495587_0005716 | Ga0495587_0005716_3927_4370 | 147 |
| 375 | 3300046536 | Ga0495587_0243088 | Ga0495587_0243088_178_621 | 147 |
| 376 | 3300046543 | Ga0495645_0003715 | Ga0495645_0003715_5983_6426 | 147 |
| 377 | 3300046543 | Ga0495645_0244959 | Ga0495645_0244959_331_774 | 147 |
| 378 | 3300046559 | Ga0495667_0008085 | Ga0495667_0008085_2892_3335 | 147 |
| 379 | 3300046559 | Ga0495667_0008797 | Ga0495667_0008797_2460_2903 | 147 |
| 380 | 3300046559 | Ga0495667_0094527 | Ga0495667_0094527_1071_1514 | 147 |
| 381 | 3300046642 | Ga0495634_0033793 | Ga0495634_0033793_1700_2143 | 147 |
| 382 | 3300046642 | Ga0495634_0061971 | Ga0495634_0061971_1828_2271 | 147 |
| 383 | 3300046663 | Ga0495635_0002519 | Ga0495635_0002519_5509_5952 | 147 |
| 384 | 3300046663 | Ga0495635_0012485 | Ga0495635_0012485_2985_3428 | 147 |
| 385 | 3300046663 | Ga0495635_0089299 | Ga0495635_0089299_1468_1911 | 147 |
| 386 | 3300046675 | Ga0495657_0033029 | Ga0495657_0033029_342_785 | 147 |
| 387 | 3300046675 | Ga0495657_0210984 | Ga0495657_0210984_455_898 | 147 |
| 388 | 3300046675 | Ga0495657_0225287 | Ga0495657_0225287_630_1073 | 147 |
| 389 | 3300046678 | Ga0495599_0005565 | Ga0495599_0005565_4133_4576 | 147 |
| 390 | 3300046678 | Ga0495599_0093710 | Ga0495599_0093710_963_1406 | 147 |
| 391 | 3300046679 | Ga0495623_0007953 | Ga0495623_0007953_3499_3942 | 147 |
| 392 | 3300046680 | Ga0495646_0008190 | Ga0495646_0008190_2273_2716 | 147 |
| 393 | 3300046689 | Ga0495613_0018672 | Ga0495613_0018672_2189_2632 | 147 |
| 394 | 3300046690 | Ga0495624_0012594 | Ga0495624_0012594_586_1029 | 147 |
| 395 | 3300046809 | Ga0495600_0002560 | Ga0495600_0002560_5862_6305 | 147 |
| 396 | 3300046809 | Ga0495600_0047712 | Ga0495600_0047712_56_499 | 147 |
| 397 | 3300046809 | Ga0495600_0414045 | Ga0495600_0414045_143_586 | 147 |
| 398 | 3300047317 | Ga0495604_0000113 | Ga0495604_0000113_12277_12720 | 147 |
| 399 | 3300047317 | Ga0495604_0203283 | Ga0495604_0203283_314_757 | 147 |
| 400 | 3300047317 | Ga0495604_0232143 | Ga0495604_0232143_198_641 | 147 |
| 401 | 3300047319 | Ga0495674_0000494 | Ga0495674_0000494_16415_16858 | 147 |
| 402 | 3300047319 | Ga0495674_0014322 | Ga0495674_0014322_4445_4888 | 147 |
| 403 | 3300047321 | Ga0495676_0165032 | Ga0495676_0165032_842_1285 | 147 |
| 404 | 3300047322 | Ga0495680_0028648 | Ga0495680_0028648_3880_4323 | 147 |
| 405 | 3300047322 | Ga0495680_0049370 | Ga0495680_0049370_365_808 | 147 |
| 406 | 3300047322 | Ga0495680_0349987 | Ga0495680_0349987_315_758 | 147 |
| 407 | 3300047322 | Ga0495680_0768952 | Ga0495680_0768952_159_602 | 147 |
| 408 | 3300047444 | Ga0495675_0002112 | Ga0495675_0002112_8588_9031 | 147 |
| 409 | 3300047444 | Ga0495675_0590308 | Ga0495675_0590308_36_479 | 147 |
| 410 | 3300047471 | Ga0495684_0011762 | Ga0495684_0011762_3594_4037 | 147 |
| 411 | 3300047471 | Ga0495684_0014873 | Ga0495684_0014873_1992_2435 | 147 |
| 412 | 3300047471 | Ga0495684_0020734 | Ga0495684_0020734_3445_3888 | 147 |
| 413 | 3300047673 | Ga0495593_0003677 | Ga0495593_0003677_2098_2541 | 147 |
| 414 | 3300048088 | Ga0495602_0015786 | Ga0495602_0015786_2539_2982 | 147 |
| 415 | 3300048088 | Ga0495602_0242024 | Ga0495602_0242024_71_514 | 147 |
| 416 | 3300048903 | Ga0496100_1279854 | Ga0496100_1279854_41_484 | 147 |
| 417 | 3300048904 | Ga0496101_0217538 | Ga0496101_0217538_536_979 | 147 |
| 418 | 3300048904 | Ga0496101_0255739 | Ga0496101_0255739_182_625 | 147 |
| 419 | 3300048904 | Ga0496101_0451439 | Ga0496101_0451439_107_550 | 147 |
| 420 | 3300048907 | Ga0496104_0259859 | Ga0496104_0259859_1058_1501 | 147 |
| 421 | 3300048907 | Ga0496104_0435768 | Ga0496104_0435768_706_1149 | 147 |
| 422 | 3300048908 | Ga0496105_0440495 | Ga0496105_0440495_539_982 | 147 |
| 423 | 3300048909 | Ga0496106_0135921 | Ga0496106_0135921_1377_1820 | 147 |
| 424 | 3300048909 | Ga0496106_0363736 | Ga0496106_0363736_186_629 | 147 |
| 425 | 3300048910 | Ga0496107_0275723 | Ga0496107_0275723_138_581 | 147 |
| 426 | 3300048911 | Ga0496108_0273398 | Ga0496108_0273398_269_712 | 147 |
| 427 | 3300048912 | Ga0496109_0010829 | Ga0496109_0010829_590_1033 | 147 |
| 428 | 3300048912 | Ga0496109_0448909 | Ga0496109_0448909_38_481 | 147 |
| 429 | 3300048913 | Ga0496110_0009432 | Ga0496110_0009432_594_1037 | 147 |
| 430 | 3300048914 | Ga0496111_0367834 | Ga0496111_0367834_252_695 | 147 |
| 431 | 3300048915 | Ga0496112_0631376 | Ga0496112_0631376_403_846 | 147 |
| 432 | 3300048918 | Ga0496115_0325156 | Ga0496115_0325156_226_669 | 147 |
| 433 | 3300048918 | Ga0496115_0746251 | Ga0496115_0746251_161_604 | 147 |
| 434 | 3300048924 | Ga0496121_0564188 | Ga0496121_0564188_112_555 | 147 |
| 435 | 3300048929 | Ga0496126_0229548 | Ga0496126_0229548_589_1032 | 147 |
| 436 | 3300049127 | Ga0501306_010747 | Ga0501306_010747_137_580 | 147 |
| 437 | 3300049128 | Ga0501308_006718 | Ga0501308_006718_140_583 | 147 |
| 438 | 3300049129 | Ga0501309_014047 | Ga0501309_014047_139_582 | 147 |
| 439 | 3300049130 | Ga0501310_009556 | Ga0501310_009556_139_582 | 147 |
| 440 | 3300049130 | Ga0501310_009626 | Ga0501310_009626_131_574 | 147 |
| 441 | 3300049160 | Ga0501304_003533 | Ga0501304_003533_137_580 | 147 |
| 442 | 3300049161 | Ga0501305_013343 | Ga0501305_013343_138_581 | 147 |
| 443 | 3300049162 | Ga0501307_008964 | Ga0501307_008964_138_581 | 147 |
| 444 | 3300049527 | Ga0501311_012135 | Ga0501311_012135_493_936 | 147 |
| 445 | 3300049527 | Ga0501311_035147 | Ga0501311_035147_25_468 | 147 |
| 446 | 3300049528 | Ga0501312_014450 | Ga0501312_014450_139_582 | 147 |
| 447 | 3300049528 | Ga0501312_032451 | Ga0501312_032451_79_522 | 147 |
| 448 | 3300049529 | Ga0501313_006386 | Ga0501313_006386_137_580 | 147 |
| 449 | 3300049530 | Ga0501314_004769 | Ga0501314_004769_138_581 | 147 |
| 450 | 3300049531 | Ga0501315_009523 | Ga0501315_009523_137_580 | 147 |
| 451 | 3300049531 | Ga0501315_027721 | Ga0501315_027721_96_539 | 147 |
| 452 | 3300049532 | Ga0501316_008319 | Ga0501316_008319_490_933 | 147 |
| 453 | 3300049532 | Ga0501316_012735 | Ga0501316_012735_293_736 | 147 |
| 454 | 3300049533 | Ga0501317_009818 | Ga0501317_009818_159_602 | 147 |
| 455 | 3300049533 | Ga0501317_012535 | Ga0501317_012535_118_561 | 147 |
| 456 | 3300049533 | Ga0501317_061275 | Ga0501317_061275_129_572 | 147 |
| 457 | 3300049534 | Ga0501318_007614 | Ga0501318_007614_555_998 | 147 |
| 458 | 3300049534 | Ga0501318_009684 | Ga0501318_009684_59_502 | 147 |
| 459 | 3300049535 | Ga0501319_002776 | Ga0501319_002776_138_581 | 147 |
| 460 | 3300049536 | Ga0501320_005938 | Ga0501320_005938_139_582 | 147 |
| 461 | 3300049537 | Ga0501321_008384 | Ga0501321_008384_139_582 | 147 |
| 462 | 3300049537 | Ga0501321_054497 | Ga0501321_054497_78_521 | 147 |
| 463 | 3300049538 | Ga0501322_002375 | Ga0501322_002375_138_581 | 147 |
| 464 | 3300049539 | Ga0501323_018225 | Ga0501323_018225_139_582 | 147 |
| 465 | 3300049540 | Ga0501324_005072 | Ga0501324_005072_138_581 | 147 |
| 466 | 3300049541 | Ga0501325_005925 | Ga0501325_005925_136_579 | 147 |
| 467 | 3300049544 | Ga0501328_04491 | Ga0501328_04491_132_575 | 147 |
| 468 | 3300049546 | Ga0501330_007298 | Ga0501330_007298_165_608 | 147 |
| 469 | 3300049548 | Ga0501332_07952 | Ga0501332_07952_132_575 | 147 |
| 470 | 3300049553 | Ga0501337_010335 | Ga0501337_010335_132_575 | 147 |
| 471 | 3300049570 | Ga0501033_0206149 | Ga0501033_0206149_360_803 | 147 |
| 472 | 3300049579 | Ga0501043_0372961 | Ga0501043_0372961_509_952 | 147 |
| 473 | 3300049822 | Ga0501035_0423786 | Ga0501035_0423786_69_512 | 147 |
| 474 | 3300049824 | Ga0501045_1040041 | Ga0501045_1040041_10_453 | 147 |
| 475 | 3300050507 | nmdc:mga05p37_662627_c1 | nmdc:mga05p37_662627_c1_98_541 | 147 |
| 476 | 3300050514 | nmdc:mga08x19_726437_c1 | nmdc:mga08x19_726437_c1_173_616 | 147 |
| 477 | 3300053077 | Ga0495601_0005598 | Ga0495601_0005598_587_1030 | 147 |
| 478 | 3300053085 | Ga0495619_0166497 | Ga0495619_0166497_395_838 | 147 |
| 479 | 3300053085 | Ga0495619_0217718 | Ga0495619_0217718_300_743 | 147 |
| 480 | 3300053140 | Ga0500573_0090421 | Ga0500573_0090421_454_897 | 147 |
| 481 | 3300053153 | Ga0500616_0000144 | Ga0500616_0000144_21841_22284 | 147 |
| 482 | 3300053730 | Ga0500645_041594 | Ga0500645_041594_453_899 | 147 |
| 483 | 3300059478 | Ga0587093_029114 | Ga0587093_029114_186_629 | 147 |
| 484 | 3300059491 | Ga0587070_100377 | Ga0587070_100377_136_579 | 147 |
| 485 | 3300059504 | Ga0587082_061652 | Ga0587082_061652_93_536 | 147 |
| 486 | 3300059509 | Ga0587089_065246 | Ga0587089_065246_105_548 | 147 |
| 487 | 3300059510 | Ga0587090_095625 | Ga0587090_095625_97_540 | 147 |
| 488 | 3300059510 | Ga0587090_111017 | Ga0587090_111017_94_540 | 147 |
| 489 | 3300059607 | Ga0587125_053961 | Ga0587125_053961_77_520 | 147 |
| 490 | 3300059622 | Ga0587099_022632 | Ga0587099_022632_246_689 | 147 |
| 491 | 3300059622 | Ga0587099_039607 | Ga0587099_039607_19_462 | 147 |
| 492 | 3300059626 | Ga0587115_044976 | Ga0587115_044976_89_532 | 147 |
| 493 | 3300059644 | Ga0587075_033424 | Ga0587075_033424_203_646 | 147 |
| 494 | 3300059651 | Ga0587105_016021 | Ga0587105_016021_157_600 | 147 |
| 495 | 3300059658 | Ga0587119_042617 | Ga0587119_042617_97_540 | 147 |
| 496 | 3300060247 | Ga0587096_01975 | Ga0587096_01975_193_648 | 147 |
| 497 | 3300060344 | Ga0587071_066868 | Ga0587071_066868_191_634 | 147 |
| 498 | 3300030889 | Ga0265761_103986 | Ga0265761_1039861 | 149 |
| 499 | 3300031090 | Ga0265760_10266353 | Ga0265760_102663531 | 149 |
| 500 | 3300002067 | JGI24735J21928_10130353 | JGI24735J21928_101303532 | 150 |
| 501 | 3300004799 | Ga0058863_10102788 | Ga0058863_101027881 | 150 |
| 502 | 3300004799 | Ga0058863_10103508 | Ga0058863_101035082 | 150 |
| 503 | 3300005327 | Ga0070658_10811873 | Ga0070658_108118731 | 150 |
| 504 | 3300005329 | Ga0070683_100241552 | Ga0070683_1002415521 | 150 |
| 505 | 3300005336 | Ga0070680_100071213 | Ga0070680_1000712132 | 150 |
| 506 | 3300005366 | Ga0070659_101052696 | Ga0070659_1010526961 | 150 |
| 507 | 3300005467 | Ga0070706_100084548 | Ga0070706_1000845482 | 150 |
| 508 | 3300005468 | Ga0070707_100231672 | Ga0070707_1002316723 | 150 |
| 509 | 3300005471 | Ga0070698_100005168 | Ga0070698_10000516811 | 150 |
| 510 | 3300013044 | Ga0154019_134497 | Ga0154019_1344971 | 150 |
| 511 | 3300020070 | Ga0206356_10828527 | Ga0206356_108285272 | 150 |
| 512 | 3300020076 | Ga0206355_1231465 | Ga0206355_12314651 | 150 |
| 513 | 3300020080 | Ga0206350_10290155 | Ga0206350_102901552 | 150 |
| 514 | 3300020080 | Ga0206350_10434865 | Ga0206350_104348652 | 150 |
| 515 | 3300020082 | Ga0206353_10427005 | Ga0206353_104270052 | 150 |
| 516 | 3300022467 | Ga0224712_10136689 | Ga0224712_101366892 | 150 |
| 517 | 3300022467 | Ga0224712_10166025 | Ga0224712_101660251 | 150 |
| 518 | 3300025910 | Ga0207684_10065003 | Ga0207684_100650032 | 150 |
| 519 | 3300025910 | Ga0207684_10074216 | Ga0207684_100742161 | 150 |
| 520 | 3300025920 | Ga0207649_10520788 | Ga0207649_105207882 | 150 |
| 521 | 3300025921 | Ga0207652_10904114 | Ga0207652_109041141 | 150 |
| 522 | 3300025922 | Ga0207646_10288504 | Ga0207646_102885041 | 150 |
| 523 | 3300025944 | Ga0207661_10441525 | Ga0207661_104415251 | 150 |
| 524 | 3300035086 | Ga0373934_0000617 | Ga0373934_0000617_4876_5346 | 150 |
| 525 | 3300035117 | Ga0373953_0000138 | Ga0373953_0000138_16113_16583 | 150 |
| 526 | 3300035119 | Ga0373956_0000951 | Ga0373956_0000951_7339_7809 | 150 |
| 527 | 3300035120 | Ga0373957_0000328 | Ga0373957_0000328_6357_6827 | 150 |
| 528 | 3300035172 | Ga0373955_0000013 | Ga0373955_0000013_66577_67047 | 150 |
| 529 | 3300035410 | Ga0373924_0000385 | Ga0373924_0000385_10711_11181 | 150 |
| 530 | 3300035724 | Ga0373933_0000139 | Ga0373933_0000139_3360_3830 | 150 |
| 531 | 3300036401 | Ga0373937_0000112 | Ga0373937_0000112_49309_49779 | 150 |
| 532 | 3300046454 | Ga0495592_0000094 | Ga0495592_0000094_6403_6873 | 150 |
| 533 | 3300046462 | Ga0495651_0000041 | Ga0495651_0000041_21762_22232 | 150 |
| 534 | 3300046463 | Ga0495653_0040650 | Ga0495653_0040650_1280_1750 | 150 |
| 535 | 3300046511 | Ga0495608_0000081 | Ga0495608_0000081_6403_6873 | 150 |
| 536 | 3300046516 | Ga0495628_0001589 | Ga0495628_0001589_13969_14439 | 150 |
| 537 | 3300046529 | Ga0495652_0001330 | Ga0495652_0001330_14652_15122 | 150 |
| 538 | 3300046536 | Ga0495587_0000038 | Ga0495587_0000038_66340_66810 | 150 |
| 539 | 3300046559 | Ga0495667_0000070 | Ga0495667_0000070_71922_72392 | 150 |
| 540 | 3300046675 | Ga0495657_0001540 | Ga0495657_0001540_12911_13381 | 150 |
| 541 | 3300046678 | Ga0495599_0000100 | Ga0495599_0000100_21709_22179 | 150 |
| 542 | 3300046679 | Ga0495623_0000609 | Ga0495623_0000609_14996_15466 | 150 |
| 543 | 3300046680 | Ga0495646_0010557 | Ga0495646_0010557_699_1169 | 150 |
| 544 | 3300046809 | Ga0495600_0047729 | Ga0495600_0047729_1574_2044 | 150 |
| 545 | 3300047317 | Ga0495604_0000061 | Ga0495604_0000061_71929_72399 | 150 |
| 546 | 3300047322 | Ga0495680_0000099 | Ga0495680_0000099_71929_72399 | 150 |
| 547 | 3300047444 | Ga0495675_0003973 | Ga0495675_0003973_2141_2611 | 150 |
| 548 | 3300048088 | Ga0495602_0000649 | Ga0495602_0000649_6403_6873 | 150 |
| 549 | 3300053084 | Ga0495595_0000708 | Ga0495595_0000708_6575_7045 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9208 | 2 | 142 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9205 | 1 | 142 |
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9188 | 7 | 143 |
| 7nhn-assembly1.cif.gz_M | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9162 | 1 | 142 |
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9146 | 2 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9103 | 12 | 150 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9078 | 1 | 142 | 3.90.1180.10 |
| af_Q4CZX3_36_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.907 | 10 | 143 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9062 | 12 | 150 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9018 | 1 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1DJB2-F1-model_v4 | 50S ribosomal protein L13 | 0.9491 | 14 | 142 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |
| AF-A0A6J6JL86-F1-model_v4 | Unannotated protein | 0.9486 | 2 | 147 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A7Y5LT23-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9468 | 5 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A381R3J9-F1-model_v4 | 50S ribosomal protein L13 | 0.946 | 1 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A534TBT7-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9451 | 12 | 142 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar