F462318

General Info

Members Datasets Scaffolds Average Seq Length
549 356 518 148

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101012322|Ga0070670_1010123221
Length 177
Sequence VPCASDRGWLSLAGARGIRLSTTFNDSGHLMRTYTPKPGEITRTWHVIDATDVVLGRLASQTAILLRGKHKATFAPHVDVGDFVIIINAEKVALTGAKAQQKKAYHHSGFPGGLKATSYTELLAKNPEKAVEKAVRGMLPRNTLGKAQLSKLKVYRGAEHPHAAQQPTPYELTQVAQ

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221566 Microbacterium sp. Root166 Isolate Unclassified
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
10 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
13 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
14 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
15 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
16 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
17 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
20 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
21 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
22 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
23 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
24 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
25 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
26 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
27 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
28 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
29 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
30 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
31 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003289 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_19 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
44 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
45 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
48 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
49 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
140 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
144 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
190 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
191 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
238 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
239 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
245 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
356 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.04
Metatranscriptomes 23.32
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.46
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 7.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10130353 3300002067 Bacteria 725
2 Ga0006779J45831_103482 3300003160 Bacteria 948
3 Ga0006778J45830_1006918 3300003162 Bacteria 926
4 Ga0006759J45824_1017117 3300003163 Bacteria 1025
5 Ga0006776J48906_107582 3300003289 Bacteria 842
6 Ga0006758J48902_1021532 3300003300 Bacteria 669
7 Ga0006770J48903_1014969 3300003305 Bacteria 665
8 Ga0006777J48905_1007106 3300003308 Bacteria 1534
9 Ga0007417J51691_1013042 3300003544 Bacteria 1113
10 Ga0007427J51700_105626 3300003559 Bacteria 1076
11 Ga0006781J51513_1004893 3300003568 Bacteria 995
12 Ga0007410J51695_1010777 3300003574 Bacteria 1101
13 Ga0007409J51694_1026381 3300003575 Bacteria 1039
14 Ga0007416J51690_1011832 3300003577 Bacteria 1083
15 Ga0007429J51699_1006292 3300003579 Bacteria 1031
16 Ga0007415J51800_110175 3300003613 Bacteria 603
17 Ga0032354_1006556 3300003693 Bacteria 1010
18 Ga0006780_1002139 3300003735 Bacteria 1079
19 Ga0058858_1422307 3300004785 Bacteria 563
20 Ga0058863_10102788 3300004799 Bacteria 519
21 Ga0058863_10103508 3300004799 Bacteria 686
22 Ga0058860_12083826 3300004801 Bacteria 563
23 Ga0065714_10021064 3300005288 Bacteria 1355
24 Ga0070658_10234640 3300005327 Bacteria 1554
25 Ga0070658_10811873 3300005327 Bacteria 813
26 Ga0070658_11836180 3300005327 Bacteria 524
27 Ga0070683_100042888 3300005329 Bacteria 4168
28 Ga0070683_100241552 3300005329 Bacteria 1718
29 Ga0070683_100935755 3300005329 Bacteria 832
30 Ga0070670_101012322 3300005331 Bacteria 756
31 Ga0068869_100027886 3300005334 Bacteria 3941
32 Ga0070680_100071213 3300005336 Bacteria 2856
33 Ga0070691_10131642 3300005341 Bacteria 1268
34 Ga0070661_100028384 3300005344 Bacteria 4036
35 Ga0070661_101091293 3300005344 Bacteria 665
36 Ga0070668_100028853 3300005347 Bacteria 4211
37 Ga0070675_100006947 3300005354 Bacteria 8694
38 Ga0070674_100031514 3300005356 Bacteria 3513
39 Ga0070659_100071540 3300005366 Bacteria 2758
40 Ga0070659_101040524 3300005366 Bacteria 720
41 Ga0070659_101052696 3300005366 Bacteria 716
42 Ga0070667_102015470 3300005367 Bacteria 544
43 Ga0070709_10130788 3300005434 Bacteria 1713
44 Ga0070709_10382677 3300005434 Bacteria 1046
45 Ga0070714_100088026 3300005435 Bacteria 2716
46 Ga0070714_101753115 3300005435 Bacteria 606
47 Ga0070713_100436117 3300005436 Bacteria 1228
48 Ga0070713_100457228 3300005436 Bacteria 1200
49 Ga0070713_100535919 3300005436 Bacteria 1107
50 Ga0070713_101990984 3300005436 Bacteria 563
51 Ga0070710_10419884 3300005437 Bacteria 900
52 Ga0070710_11282728 3300005437 Bacteria 544
53 Ga0070711_100182444 3300005439 Bacteria 1607
54 Ga0070711_101203046 3300005439 Bacteria 655
55 Ga0070705_100013603 3300005440 Bacteria 4166
56 Ga0070700_100014575 3300005441 Bacteria 4440
57 Ga0070708_100002280 3300005445 Bacteria 14840
58 Ga0070708_100126211 3300005445 Bacteria 2365
59 Ga0070663_100002336 3300005455 Bacteria 10657
60 Ga0070663_102037740 3300005455 Bacteria 517
61 Ga0070678_100200714 3300005456 Bacteria 1646
62 Ga0070678_100866760 3300005456 Bacteria 824
63 Ga0070662_100006051 3300005457 Bacteria 7768
64 Ga0070681_10413928 3300005458 Bacteria 1260
65 Ga0068867_100117960 3300005459 Bacteria 2047
66 Ga0070706_100027836 3300005467 Bacteria 5199
67 Ga0070706_100084548 3300005467 Bacteria 2939
68 Ga0070707_100012421 3300005468 Bacteria 7953
69 Ga0070707_100231672 3300005468 Bacteria 1798
70 Ga0070698_100005168 3300005471 Bacteria 14271
71 Ga0070698_100005171 3300005471 Bacteria 14266
72 Ga0070698_100039124 3300005471 Bacteria 4884
73 Ga0070699_100834899 3300005518 Bacteria 843
74 Ga0070684_100724682 3300005535 Bacteria 928
75 Ga0070672_100133701 3300005543 Bacteria 2041
76 Ga0070696_100077230 3300005546 Bacteria 2353
77 Ga0070693_100027117 3300005547 Bacteria 3100
78 Ga0070664_100001843 3300005564 Bacteria 16991
79 Ga0068857_100182582 3300005577 Bacteria 1909
80 Ga0068857_100223742 3300005577 Bacteria 1719
81 Ga0068856_100035768 3300005614 Bacteria 4868
82 Ga0070702_100000198 3300005615 Bacteria 19583
83 Ga0068852_100201247 3300005616 Bacteria 1885
84 Ga0068852_100653504 3300005616 Bacteria 1059
85 Ga0068852_100737022 3300005616 Bacteria 997
86 Ga0068864_101050701 3300005618 Bacteria 809
87 Ga0068866_10196340 3300005718 Bacteria 1203
88 Ga0068861_100148656 3300005719 Bacteria 1920
89 Ga0068851_10273997 3300005834 Bacteria 963
90 Ga0068863_100043625 3300005841 Bacteria 4257
91 Ga0068860_100435859 3300005843 Bacteria 1301
92 Ga0068860_100825889 3300005843 Bacteria 941
93 Ga0070717_10006669 3300006028 Bacteria 8513
94 Ga0070717_11000170 3300006028 Bacteria 761
95 Ga0070715_10087090 3300006163 Bacteria 1429
96 Ga0070715_10144323 3300006163 Bacteria 1159
97 Ga0070716_100037364 3300006173 Bacteria 2683
98 Ga0097621_100195669 3300006237 Bacteria 1753
99 Ga0068871_101134296 3300006358 Bacteria 732
100 Ga0075428_100751094 3300006844 Bacteria 1038
101 Ga0068865_100092062 3300006881 Bacteria 2202
102 Ga0068865_100564048 3300006881 Bacteria 958
103 Ga0075435_100893637 3300007076 Bacteria 775
104 Ga0105247_10148944 3300009101 Bacteria 1540
105 Ga0114129_11263372 3300009147 Bacteria 917
106 Ga0105243_10009041 3300009148 Bacteria 7609
107 Ga0105243_11102760 3300009148 Bacteria 802
108 Ga0105243_11307376 3300009148 Bacteria 742
109 Ga0105241_10413392 3300009174 Bacteria 1186
110 Ga0105242_10060234 3300009176 Bacteria 3118
111 Ga0105237_10626144 3300009545 Bacteria 1083
112 Ga0105238_10484427 3300009551 Bacteria 1236
113 Ga0105238_10698990 3300009551 Bacteria 1026
114 Ga0099796_10025254 3300010159 Bacteria 1874
115 Ga0105246_10222948 3300011119 Bacteria 1479
116 Ga0154019_134497 3300013044 Bacteria 811
117 Ga0154014_152655 3300013052 Bacteria 702
118 Ga0154012_129624 3300013059 Bacteria 689
119 Ga0154012_174429 3300013059 Bacteria 586
120 Ga0157373_10821137 3300013100 Bacteria 686
121 Ga0157370_10355780 3300013104 Bacteria 1349
122 Ga0157369_10016634 3300013105 Bacteria 8270
123 Ga0157378_10014969 3300013297 Bacteria 6792
124 Ga0163162_10092421 3300013306 Bacteria 3109
125 Ga0163162_10751007 3300013306 Bacteria 1095
126 Ga0163162_11350474 3300013306 Bacteria 810
127 Ga0157372_10025059 3300013307 Bacteria 6482
128 Ga0157375_10024756 3300013308 Bacteria 5562
129 Ga0157375_11158497 3300013308 Bacteria 906
130 Ga0163163_10365258 3300014325 Bacteria 1500
131 Ga0163163_10868289 3300014325 Bacteria 966
132 Ga0157380_10125706 3300014326 Bacteria 2179
133 Ga0157380_10883529 3300014326 Bacteria 918
134 Ga0157377_10416225 3300014745 Bacteria 919
135 Ga0157376_11199243 3300014969 Bacteria 787
136 Ga0163161_10065215 3300017792 Bacteria 2657
137 Ga0197907_10601052 3300020069 Bacteria 1401
138 Ga0197907_10857789 3300020069 Bacteria 525
139 Ga0197907_11149652 3300020069 Bacteria 853
140 Ga0197907_11162759 3300020069 Bacteria 968
141 Ga0197907_11331483 3300020069 Bacteria 915
142 Ga0206356_10828527 3300020070 Bacteria 669
143 Ga0206349_1564623 3300020075 Bacteria 737
144 Ga0206349_1821486 3300020075 Bacteria 997
145 Ga0206349_1871115 3300020075 Bacteria 878
146 Ga0206355_1044750 3300020076 Bacteria 1327
147 Ga0206355_1163317 3300020076 Bacteria 836
148 Ga0206355_1231465 3300020076 Bacteria 673
149 Ga0206355_1455207 3300020076 Bacteria 732
150 Ga0206351_10040481 3300020077 Bacteria 658
151 Ga0206351_10300344 3300020077 Bacteria 884
152 Ga0206351_10874627 3300020077 Bacteria 860
153 Ga0206352_10035753 3300020078 Bacteria 668
154 Ga0206352_10275810 3300020078 Bacteria 752
155 Ga0206352_11105915 3300020078 Bacteria 817
156 Ga0206352_11289692 3300020078 Bacteria 1034
157 Ga0206350_10071743 3300020080 Bacteria 570
158 Ga0206350_10290155 3300020080 Bacteria 773
159 Ga0206350_10434865 3300020080 Bacteria 802
160 Ga0206350_11411288 3300020080 Bacteria 1005
161 Ga0206354_10666701 3300020081 Bacteria 1000
162 Ga0206354_11502833 3300020081 Bacteria 634
163 Ga0206354_11643590 3300020081 Bacteria 795
164 Ga0206353_10015581 3300020082 Bacteria 707
165 Ga0206353_10319916 3300020082 Bacteria 1118
166 Ga0206353_10427005 3300020082 Bacteria 1270
167 Ga0206353_10907110 3300020082 Bacteria 764
168 Ga0206353_11676470 3300020082 Bacteria 820
169 Ga0213875_10047878 3300021388 Bacteria 2006
170 Ga0224712_10136689 3300022467 Bacteria 1075
171 Ga0224712_10166025 3300022467 Bacteria 988
172 Ga0224712_10172211 3300022467 Bacteria 971
173 Ga0224712_10241241 3300022467 Bacteria 832
174 Ga0224712_10422486 3300022467 Bacteria 637
175 Ga0256743_123451 3300023436 Bacteria 973
176 Ga0247552_100504 3300023536 Bacteria 966
177 Ga0247551_100537 3300023552 Bacteria 1074
178 Ga0247553_103103 3300023672 Bacteria 798
179 Ga0224572_1003783 3300024225 Bacteria 2582
180 Ga0228598_1021821 3300024227 Bacteria 1260
181 Ga0228598_1058895 3300024227 Bacteria 764
182 Ga0207656_10194956 3300025321 Bacteria 977
183 Ga0207692_10168898 3300025898 Bacteria 1266
184 Ga0207692_10212414 3300025898 Bacteria 1143
185 Ga0207688_10133551 3300025901 Bacteria 1456
186 Ga0207685_10015597 3300025905 Bacteria 2411
187 Ga0207685_10095578 3300025905 Bacteria 1261
188 Ga0207699_10102062 3300025906 Bacteria 1822
189 Ga0207643_10392583 3300025908 Bacteria 876
190 Ga0207643_10658402 3300025908 Bacteria 676
191 Ga0207705_10375352 3300025909 Bacteria 1098
192 Ga0207684_10065003 3300025910 Bacteria 3097
193 Ga0207684_10074216 3300025910 Bacteria 2889
194 Ga0207684_10145920 3300025910 Bacteria 2035
195 Ga0207684_10263568 3300025910 Bacteria 1487
196 Ga0207695_11652738 3300025913 Bacteria 521
197 Ga0207693_10083322 3300025915 Bacteria 2505
198 Ga0207693_10137136 3300025915 Bacteria 1924
199 Ga0207693_10875090 3300025915 Bacteria 690
200 Ga0207663_10023704 3300025916 Bacteria 3526
201 Ga0207663_10409044 3300025916 Bacteria 1039
202 Ga0207657_10034194 3300025919 Bacteria 4573
203 Ga0207649_10520788 3300025920 Bacteria 906
204 Ga0207649_11074212 3300025920 Bacteria 634
205 Ga0207652_10904114 3300025921 Bacteria 780
206 Ga0207646_10288504 3300025922 Bacteria 1483
207 Ga0207646_10347531 3300025922 Bacteria 1340
208 Ga0207694_10485394 3300025924 Bacteria 1034
209 Ga0207659_10014142 3300025926 Bacteria 5140
210 Ga0207687_10020636 3300025927 Bacteria 4372
211 Ga0207700_10615967 3300025928 Bacteria 967
212 Ga0207700_10998090 3300025928 Bacteria 749
213 Ga0207664_10100179 3300025929 Bacteria 2392
214 Ga0207664_10111385 3300025929 Bacteria 2277
215 Ga0207664_10209153 3300025929 Bacteria 1687
216 Ga0207664_10307892 3300025929 Bacteria 1395
217 Ga0207644_10481626 3300025931 Bacteria 1022
218 Ga0207690_10332460 3300025932 Bacteria 1197
219 Ga0207706_10065674 3300025933 Bacteria 3194
220 Ga0207686_10059204 3300025934 Bacteria 2419
221 Ga0207709_10095939 3300025935 Bacteria 1949
222 Ga0207669_10053009 3300025937 Bacteria 2441
223 Ga0207669_10477145 3300025937 Bacteria 993
224 Ga0207704_10017593 3300025938 Bacteria 3711
225 Ga0207704_10395241 3300025938 Bacteria 1089
226 Ga0207665_10012742 3300025939 Bacteria 5529
227 Ga0207691_10071731 3300025940 Bacteria 3125
228 Ga0207689_10009163 3300025942 Bacteria 8562
229 Ga0207661_10287466 3300025944 Bacteria 1471
230 Ga0207661_10441525 3300025944 Bacteria 1184
231 Ga0207661_11065674 3300025944 Bacteria 744
232 Ga0207679_10003555 3300025945 Bacteria 9656
233 Ga0207678_10012901 3300026067 Bacteria 7334
234 Ga0207708_10003635 3300026075 Bacteria 11371
235 Ga0207702_10278630 3300026078 Bacteria 1580
236 Ga0207702_10316034 3300026078 Bacteria 1486
237 Ga0207648_10185813 3300026089 Bacteria 1841
238 Ga0207674_10003200 3300026116 Bacteria 20160
239 Ga0207674_10049600 3300026116 Bacteria 4293
240 Ga0207674_10087111 3300026116 Bacteria 3117
241 Ga0207675_100220457 3300026118 Bacteria 1827
242 Ga0207683_10150972 3300026121 Bacteria 2097
243 Ga0207683_10242834 3300026121 Bacteria 1643
244 Ga0207698_10265011 3300026142 Bacteria 1580
245 Ga0207698_10473427 3300026142 Bacteria 1214
246 Ga0207428_10049480 3300027907 Bacteria 3368
247 Ga0268264_11364600 3300028381 Bacteria 719
248 Ga0265334_10025340 3300028573 Bacteria 2401
249 Ga0307515_10195134 3300028794 Bacteria 1920
250 Ga0307515_10239157 3300028794 Bacteria 1591
251 Ga0311003_165979 3300029282 Bacteria 696
252 Ga0311003_169922 3300029282 Bacteria 600
253 Ga0310981_1086556 3300029285 Bacteria 819
254 Ga0265763_1016447 3300030763 Bacteria 742
255 Ga0265764_104361 3300030882 Bacteria 768
256 Ga0265761_103986 3300030889 Bacteria 741
257 Ga0265761_106896 3300030889 Bacteria 613
258 Ga0265773_1011800 3300031018 Bacteria 756
259 Ga0265760_10014888 3300031090 Bacteria 2230
260 Ga0265760_10266353 3300031090 Bacteria 598
261 Ga0265340_10002795 3300031247 Bacteria 9932
262 Ga0307408_100658331 3300031548 Bacteria 937
263 Ga0307508_10424947 3300031616 Bacteria 920
264 Ga0307413_10520358 3300031824 Bacteria 959
265 Ga0307410_10056981 3300031852 Bacteria 2659
266 Ga0307406_10223622 3300031901 Bacteria 1401
267 Ga0307406_10263291 3300031901 Bacteria 1306
268 Ga0307409_100032855 3300031995 Bacteria 3768
269 Ga0307409_100151026 3300031995 Bacteria 2017
270 Ga0307409_100291582 3300031995 Bacteria 1513
271 Ga0307409_101304606 3300031995 Bacteria 751
272 Ga0307416_100306774 3300032002 Bacteria 1581
273 Ga0307416_100486315 3300032002 Bacteria 1295
274 Ga0307416_100561922 3300032002 Bacteria 1216
275 Ga0307414_10280333 3300032004 Bacteria 1400
276 Ga0307411_10189560 3300032005 Bacteria 1569
277 Ga0307415_100119530 3300032126 Bacteria 1973
278 Ga0307415_100138633 3300032126 Bacteria 1854
279 Ga0307415_100731221 3300032126 Bacteria 896
280 Ga0373926_0001724 3300035083 Bacteria 6769
281 Ga0373934_0000617 3300035086 Bacteria 12514
282 Ga0373934_0154541 3300035086 Bacteria 940
283 Ga0373944_0000692 3300035089 Bacteria 8111
284 Ga0373923_0231306 3300035111 Bacteria 861
285 Ga0373936_0001828 3300035113 Bacteria 7832
286 Ga0373936_0003698 3300035113 Bacteria 5742
287 Ga0373945_0002371 3300035116 Bacteria 5907
288 Ga0373953_0000138 3300035117 Bacteria 18268
289 Ga0373954_0076350 3300035118 Bacteria 1597
290 Ga0373956_0000951 3300035119 Bacteria 12044
291 Ga0373956_0270617 3300035119 Bacteria 808
292 Ga0373957_0000328 3300035120 Bacteria 11971
293 Ga0373957_0060907 3300035120 Bacteria 1462
294 Ga0373943_0002227 3300035170 Bacteria 8820
295 Ga0373946_0000163 3300035171 Bacteria 20283
296 Ga0373955_0000013 3300035172 Bacteria 73449
297 Ga0373924_0000385 3300035410 Bacteria 13577
298 Ga0373931_0631481 3300035691 Bacteria 702
299 Ga0373935_0122992 3300035692 Bacteria 1735
300 Ga0373935_0467119 3300035692 Bacteria 913
301 Ga0373927_0009072 3300035695 Bacteria 6675
302 Ga0373933_0000139 3300035724 Bacteria 46756
303 Ga0373933_0048277 3300035724 Bacteria 2534
304 Ga0373947_0007483 3300035725 Bacteria 6319
305 Ga0373947_0105611 3300035725 Bacteria 1774
306 Ga0373947_0252909 3300035725 Bacteria 1166
307 Ga0373937_0000112 3300036401 Bacteria 77473
308 Ga0373937_0481770 3300036401 Bacteria 1178
309 Ga0373937_0677171 3300036401 Bacteria 977
310 Ga0265778_022729 3300036457 Bacteria 782
311 Ga0373925_0016436 3300037068 Bacteria 5360
312 Ga0373925_0289213 3300037068 Bacteria 1321
313 Ga0373925_0673732 3300037068 Bacteria 852
314 Ga0373925_1197691 3300037068 Bacteria 624
315 Ga0395898_0271155 3300037466 Bacteria 1618
316 Ga0436364_0221389 3300037853 Bacteria 718
317 Ga0436364_0664769 3300037853 Bacteria 2158
318 Ga0436364_0982400 3300037853 Bacteria 1158
319 Ga0436364_1160647 3300037853 Bacteria 1175
320 Ga0436364_1449392 3300037853 Bacteria 5746
321 Ga0395901_0138759 3300038443 Bacteria 2555
322 Ga0436365_0009793 3300039437 Bacteria 767
323 Ga0436365_1465599 3300039437 Bacteria 1234
324 Ga0436360_0704114 3300039438 Bacteria 567
325 Ga0436363_0879956 3300039450 Bacteria 1272
326 Ga0439436_0235981 3300041404 Bacteria 528
327 Ga0451793_0010092 3300041452 Bacteria 803
328 Ga0451833_1400870 3300041491 Bacteria 1364
329 Ga0451849_0283202 3300041505 Bacteria 533
330 Ga0451843_0117617 3300041509 Bacteria 795
331 Ga0451853_0113190 3300041512 Bacteria 1689
332 Ga0451853_1295242 3300041512 Bacteria 1690
333 Ga0439432_056443 3300042006 Bacteria 1217
334 Ga0439456_114978 3300042013 Bacteria 614
335 Ga0439457_007769 3300042014 Bacteria 2562
336 Ga0450907_050248 3300042146 Bacteria 717
337 Ga0450901_012846 3300042533 Bacteria 875
338 Ga0466965_0101078 3300044683 Bacteria 1475
339 Ga0466963_0004113 3300044694 Bacteria 8416
340 Ga0466963_0143290 3300044694 Bacteria 1656
341 Ga0466970_0687559 3300044765 Bacteria 596
342 Ga0466960_0080702 3300044901 Bacteria 1639
343 Ga0466958_0534788 3300045836 Bacteria 761
344 Ga0466967_0025673 3300045976 Bacteria 4861
345 Ga0466967_2194471 3300045976 Bacteria 548
346 Ga0495592_0000094 3300046454 Bacteria 78801
347 Ga0495592_0015950 3300046454 Bacteria 5699
348 Ga0495641_0034299 3300046461 Bacteria 2400
349 Ga0495641_0236900 3300046461 Bacteria 820
350 Ga0495641_0377675 3300046461 Bacteria 642
351 Ga0495651_0000041 3300046462 Bacteria 94160
352 Ga0495651_0002063 3300046462 Bacteria 15529
353 Ga0495651_0097057 3300046462 Bacteria 2201
354 Ga0495653_0013086 3300046463 Bacteria 6764
355 Ga0495653_0013477 3300046463 Bacteria 6661
356 Ga0495653_0040650 3300046463 Bacteria 3633
357 Ga0495580_0005827 3300046472 Bacteria 10107
358 Ga0495582_0046247 3300046473 Bacteria 2397
359 Ga0495639_0074184 3300046475 Bacteria 1576
360 Ga0495662_0000390 3300046476 Bacteria 19590
361 Ga0495662_0022507 3300046476 Bacteria 3043
362 Ga0495664_0003456 3300046477 Bacteria 8593
363 Ga0495664_0022835 3300046477 Bacteria 3629
364 Ga0495608_0000081 3300046511 Bacteria 69898
365 Ga0495608_0006616 3300046511 Bacteria 8228
366 Ga0495608_0038981 3300046511 Bacteria 3187
367 Ga0495618_0081028 3300046514 Bacteria 2072
368 Ga0495628_0001589 3300046516 Bacteria 20837
369 Ga0495628_0036245 3300046516 Bacteria 3960
370 Ga0495628_0346170 3300046516 Bacteria 1093
371 Ga0495630_0038944 3300046517 Bacteria 3555
372 Ga0495630_0049467 3300046517 Bacteria 3146
373 Ga0495666_0018682 3300046526 Bacteria 3444
374 Ga0495652_0001330 3300046529 Bacteria 27552
375 Ga0495652_0010650 3300046529 Bacteria 8330
376 Ga0495652_0030673 3300046529 Bacteria 4712
377 Ga0495665_0011264 3300046531 Bacteria 4842
378 Ga0495665_0024076 3300046531 Bacteria 3270
379 Ga0495640_0010828 3300046533 Bacteria 7035
380 Ga0495640_0159766 3300046533 Bacteria 1445
381 Ga0495586_0016566 3300046535 Bacteria 3921
382 Ga0495587_0000038 3300046536 Bacteria 116118
383 Ga0495587_0005716 3300046536 Bacteria 8104
384 Ga0495587_0243088 3300046536 Bacteria 1013
385 Ga0495645_0003715 3300046543 Bacteria 10377
386 Ga0495645_0244959 3300046543 Bacteria 1194
387 Ga0495667_0000070 3300046559 Bacteria 78776
388 Ga0495667_0008085 3300046559 Bacteria 7138
389 Ga0495667_0008797 3300046559 Bacteria 6864
390 Ga0495667_0094527 3300046559 Bacteria 1935
391 Ga0495634_0033793 3300046642 Bacteria 3512
392 Ga0495634_0061971 3300046642 Bacteria 2484
393 Ga0495635_0002519 3300046663 Bacteria 12529
394 Ga0495635_0012485 3300046663 Bacteria 5950
395 Ga0495635_0089299 3300046663 Bacteria 2108
396 Ga0495657_0001540 3300046675 Bacteria 19817
397 Ga0495657_0033029 3300046675 Bacteria 3606
398 Ga0495657_0210984 3300046675 Bacteria 1180
399 Ga0495657_0225287 3300046675 Bacteria 1135
400 Ga0495599_0000100 3300046678 Bacteria 60814
401 Ga0495599_0005565 3300046678 Bacteria 7556
402 Ga0495599_0093710 3300046678 Bacteria 1873
403 Ga0495623_0000609 3300046679 Bacteria 23835
404 Ga0495623_0007953 3300046679 Bacteria 6891
405 Ga0495646_0008190 3300046680 Bacteria 6642
406 Ga0495646_0010557 3300046680 Bacteria 5867
407 Ga0495613_0018672 3300046689 Bacteria 5170
408 Ga0495624_0012594 3300046690 Bacteria 5774
409 Ga0495600_0002560 3300046809 Bacteria 10482
410 Ga0495600_0047712 3300046809 Bacteria 2794
411 Ga0495600_0047729 3300046809 Bacteria 2794
412 Ga0495600_0414045 3300046809 Bacteria 837
413 Ga0495604_0000061 3300047317 Bacteria 94158
414 Ga0495604_0000113 3300047317 Bacteria 68389
415 Ga0495604_0203283 3300047317 Bacteria 1373
416 Ga0495604_0232143 3300047317 Bacteria 1265
417 Ga0495674_0000494 3300047319 Bacteria 35995
418 Ga0495674_0014322 3300047319 Bacteria 7426
419 Ga0495676_0165032 3300047321 Bacteria 1563
420 Ga0495680_0000099 3300047322 Bacteria 78801
421 Ga0495680_0028648 3300047322 Bacteria 4565
422 Ga0495680_0049370 3300047322 Bacteria 3295
423 Ga0495680_0349987 3300047322 Bacteria 1029
424 Ga0495680_0768952 3300047322 Bacteria 631
425 Ga0495675_0002112 3300047444 Bacteria 11852
426 Ga0495675_0003973 3300047444 Bacteria 8963
427 Ga0495675_0590308 3300047444 Bacteria 630
428 Ga0495684_0011762 3300047471 Bacteria 6755
429 Ga0495684_0014873 3300047471 Bacteria 5991
430 Ga0495684_0020734 3300047471 Bacteria 5064
431 Ga0495593_0003677 3300047673 Bacteria 9157
432 Ga0495602_0000649 3300048088 Bacteria 32571
433 Ga0495602_0015786 3300048088 Bacteria 7606
434 Ga0495602_0242024 3300048088 Bacteria 1349
435 Ga0496100_1279854 3300048903 Bacteria 579
436 Ga0496101_0217538 3300048904 Bacteria 1482
437 Ga0496101_0255739 3300048904 Bacteria 1365
438 Ga0496101_0451439 3300048904 Bacteria 1014
439 Ga0496104_0259859 3300048907 Bacteria 1649
440 Ga0496104_0435768 3300048907 Bacteria 1222
441 Ga0496105_0440495 3300048908 Bacteria 1029
442 Ga0496106_0135921 3300048909 Bacteria 1931
443 Ga0496106_0363736 3300048909 Bacteria 1162
444 Ga0496107_0275723 3300048910 Bacteria 1252
445 Ga0496108_0273398 3300048911 Bacteria 1471
446 Ga0496109_0010829 3300048912 Bacteria 7808
447 Ga0496109_0448909 3300048912 Bacteria 1218
448 Ga0496110_0009432 3300048913 Bacteria 7905
449 Ga0496111_0367834 3300048914 Bacteria 1064
450 Ga0496112_0631376 3300048915 Bacteria 1002
451 Ga0496115_0325156 3300048918 Bacteria 1257
452 Ga0496115_0746251 3300048918 Bacteria 766
453 Ga0496121_0564188 3300048924 Bacteria 710
454 Ga0496126_0229548 3300048929 Bacteria 1556
455 Ga0501306_010747 3300049127 Bacteria 1157
456 Ga0501308_006718 3300049128 Bacteria 1187
457 Ga0501309_014047 3300049129 Bacteria 1071
458 Ga0501310_009556 3300049130 Bacteria 1071
459 Ga0501310_009626 3300049130 Bacteria 1068
460 Ga0501304_003533 3300049160 Bacteria 1150
461 Ga0501305_013343 3300049161 Bacteria 1135
462 Ga0501307_008964 3300049162 Bacteria 1135
463 Ga0501311_012135 3300049527 Bacteria 1071
464 Ga0501311_035147 3300049527 Bacteria 740
465 Ga0501312_014450 3300049528 Bacteria 1110
466 Ga0501312_032451 3300049528 Bacteria 825
467 Ga0501313_006386 3300049529 Bacteria 1276
468 Ga0501314_004769 3300049530 Bacteria 1135
469 Ga0501315_009523 3300049531 Bacteria 1150
470 Ga0501315_027721 3300049531 Bacteria 801
471 Ga0501316_008319 3300049532 Bacteria 1144
472 Ga0501316_012735 3300049532 Bacteria 987
473 Ga0501317_009818 3300049533 Bacteria 1131
474 Ga0501317_012535 3300049533 Bacteria 1047
475 Ga0501317_061275 3300049533 Bacteria 618
476 Ga0501318_007614 3300049534 Bacteria 1137
477 Ga0501318_009684 3300049534 Bacteria 1056
478 Ga0501319_002776 3300049535 Bacteria 1133
479 Ga0501320_005938 3300049536 Bacteria 1130
480 Ga0501321_008384 3300049537 Bacteria 1095
481 Ga0501321_054497 3300049537 Bacteria 591
482 Ga0501322_002375 3300049538 Bacteria 1150
483 Ga0501323_018225 3300049539 Bacteria 907
484 Ga0501324_005072 3300049540 Bacteria 1070
485 Ga0501325_005925 3300049541 Bacteria 988
486 Ga0501328_04491 3300049544 Bacteria 679
487 Ga0501330_007298 3300049546 Bacteria 739
488 Ga0501332_07952 3300049548 Bacteria 683
489 Ga0501337_010335 3300049553 Bacteria 679
490 Ga0501033_0206149 3300049570 Bacteria 1403
491 Ga0501043_0372961 3300049579 Bacteria 1081
492 Ga0501035_0423786 3300049822 Bacteria 1104
493 Ga0501045_1040041 3300049824 Bacteria 600
494 nmdc:mga05p37_662627_c1 3300050507 Bacteria 1166
495 nmdc:mga08x19_726437_c1 3300050514 Bacteria 705
496 Ga0495601_0005598 3300053077 Bacteria 7326
497 Ga0495595_0000708 3300053084 Bacteria 12706
498 Ga0495619_0166497 3300053085 Bacteria 1523
499 Ga0495619_0217718 3300053085 Bacteria 1323
500 Ga0500573_0090421 3300053140 Bacteria 1730
501 Ga0500616_0000144 3300053153 Bacteria 121889
502 Ga0500645_041594 3300053730 Bacteria 1357
503 Ga0587093_029114 3300059478 Bacteria 785
504 Ga0587070_100377 3300059491 Bacteria 665
505 Ga0587082_061652 3300059504 Bacteria 741
506 Ga0587089_065246 3300059509 Bacteria 609
507 Ga0587090_095625 3300059510 Bacteria 615
508 Ga0587090_111017 3300059510 Bacteria 585
509 Ga0587125_053961 3300059607 Bacteria 573
510 Ga0587099_022632 3300059622 Bacteria 719
511 Ga0587099_039607 3300059622 Bacteria 600
512 Ga0587115_044976 3300059626 Bacteria 701
513 Ga0587075_033424 3300059644 Bacteria 830
514 Ga0587105_016021 3300059651 Bacteria 620
515 Ga0587119_042617 3300059658 Bacteria 656
516 Ga0587096_01975 3300060247 Bacteria 743
517 Ga0587071_066868 3300060344 Bacteria 775
518 Ga0587071_101738 3300060344 Bacteria 665

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_11307376 Ga0105243_113073761 143
2 3300060344 Ga0587071_101738 Ga0587071_101738_128_559 143
3 iso_pu_bacteria 2554235005 2554256753 143
4 iso_pu_bacteria 2643221601 2644014423 143
5 iso_pu_bacteria 2643221631 2644175860 143
6 iso_pu_bacteria 2643221678 2644439371 143
7 iso_pu_bacteria 2643221714 2644633255 143
8 iso_pu_bacteria 2675903060 2676494490 143
9 iso_pu_bacteria 2728369276 2729906649 143
10 iso_pu_bacteria 2808606359 2808843372 143
11 iso_pu_bacteria 2818991472 2819742288 143
12 iso_pu_bacteria 2848551377 2848553213 143
13 iso_pu_bacteria 2862178590 2862185290 143
14 iso_pu_bacteria 2867346516 2867349866 143
15 iso_pu_bacteria 2887443736 2887444586 143
16 iso_pu_bacteria 2919468124 2919470271 143
17 iso_pu_bacteria 2946072368 2946077146 143
18 iso_pu_bacteria 2990044586 2990044866 143
19 iso_pu_bacteria 3001889506 3001890624 143
20 iso_pu_bacteria 2585428094 2587863689 144
21 iso_pu_bacteria 2643221566 2643847814 144
22 iso_pu_bacteria 2643221635 2644197875 144
23 iso_pu_bacteria 2643221649 2644277761 144
24 iso_pu_bacteria 2757320536 2758224713 144
25 iso_pu_bacteria 2821268502 2821269074 144
26 iso_pu_bacteria 8002811521 8002811591 144
27 iso_pu_bacteria 2643221690 2644502871 145
28 iso_pu_bacteria 2643221694 2644525231 145
29 iso_pu_bacteria 2643221722 2644669319 145
30 iso_pu_bacteria 2758568522 2760304696 145
31 iso_pu_bacteria 2758568621 2760621488 145
32 iso_pu_bacteria 3002998708 3003001642 146
33 iso_pu_bacteria 8053945823 8053948683 146
34 3300003160 Ga0006779J45831_103482 Ga0006779J45831_1034821 147
35 3300003162 Ga0006778J45830_1006918 Ga0006778J45830_10069181 147
36 3300003163 Ga0006759J45824_1017117 Ga0006759J45824_10171171 147
37 3300003289 Ga0006776J48906_107582 Ga0006776J48906_1075821 147
38 3300003300 Ga0006758J48902_1021532 Ga0006758J48902_10215321 147
39 3300003305 Ga0006770J48903_1014969 Ga0006770J48903_10149691 147
40 3300003308 Ga0006777J48905_1007106 Ga0006777J48905_10071061 147
41 3300003544 Ga0007417J51691_1013042 Ga0007417J51691_10130421 147
42 3300003559 Ga0007427J51700_105626 Ga0007427J51700_1056261 147
43 3300003568 Ga0006781J51513_1004893 Ga0006781J51513_10048931 147
44 3300003574 Ga0007410J51695_1010777 Ga0007410J51695_10107771 147
45 3300003575 Ga0007409J51694_1026381 Ga0007409J51694_10263811 147
46 3300003577 Ga0007416J51690_1011832 Ga0007416J51690_10118321 147
47 3300003579 Ga0007429J51699_1006292 Ga0007429J51699_10062921 147
48 3300003613 Ga0007415J51800_110175 Ga0007415J51800_1101751 147
49 3300003693 Ga0032354_1006556 Ga0032354_10065561 147
50 3300003735 Ga0006780_1002139 Ga0006780_10021391 147
51 3300004785 Ga0058858_1422307 Ga0058858_14223071 147
52 3300004801 Ga0058860_12083826 Ga0058860_120838261 147
53 3300005288 Ga0065714_10021064 Ga0065714_100210641 147
54 3300005327 Ga0070658_10234640 Ga0070658_102346402 147
55 3300005327 Ga0070658_11836180 Ga0070658_118361801 147
56 3300005329 Ga0070683_100042888 Ga0070683_1000428883 147
57 3300005329 Ga0070683_100935755 Ga0070683_1009357551 147
58 3300005331 Ga0070670_101012322 Ga0070670_1010123221 147
59 3300005334 Ga0068869_100027886 Ga0068869_1000278864 147
60 3300005341 Ga0070691_10131642 Ga0070691_101316422 147
61 3300005344 Ga0070661_100028384 Ga0070661_1000283844 147
62 3300005344 Ga0070661_101091293 Ga0070661_1010912931 147
63 3300005347 Ga0070668_100028853 Ga0070668_1000288533 147
64 3300005354 Ga0070675_100006947 Ga0070675_1000069476 147
65 3300005356 Ga0070674_100031514 Ga0070674_1000315143 147
66 3300005366 Ga0070659_100071540 Ga0070659_1000715402 147
67 3300005366 Ga0070659_101040524 Ga0070659_1010405242 147
68 3300005367 Ga0070667_102015470 Ga0070667_1020154701 147
69 3300005434 Ga0070709_10130788 Ga0070709_101307883 147
70 3300005434 Ga0070709_10382677 Ga0070709_103826772 147
71 3300005435 Ga0070714_100088026 Ga0070714_1000880262 147
72 3300005435 Ga0070714_101753115 Ga0070714_1017531151 147
73 3300005436 Ga0070713_100436117 Ga0070713_1004361172 147
74 3300005436 Ga0070713_100457228 Ga0070713_1004572281 147
75 3300005436 Ga0070713_100535919 Ga0070713_1005359192 147
76 3300005436 Ga0070713_101990984 Ga0070713_1019909841 147
77 3300005437 Ga0070710_10419884 Ga0070710_104198842 147
78 3300005437 Ga0070710_11282728 Ga0070710_112827281 147
79 3300005439 Ga0070711_100182444 Ga0070711_1001824442 147
80 3300005439 Ga0070711_101203046 Ga0070711_1012030461 147
81 3300005440 Ga0070705_100013603 Ga0070705_1000136035 147
82 3300005441 Ga0070700_100014575 Ga0070700_1000145754 147
83 3300005445 Ga0070708_100002280 Ga0070708_10000228011 147
84 3300005445 Ga0070708_100126211 Ga0070708_1001262112 147
85 3300005455 Ga0070663_100002336 Ga0070663_10000233611 147
86 3300005455 Ga0070663_102037740 Ga0070663_1020377401 147
87 3300005456 Ga0070678_100200714 Ga0070678_1002007142 147
88 3300005456 Ga0070678_100866760 Ga0070678_1008667602 147
89 3300005457 Ga0070662_100006051 Ga0070662_1000060516 147
90 3300005458 Ga0070681_10413928 Ga0070681_104139281 147
91 3300005459 Ga0068867_100117960 Ga0068867_1001179602 147
92 3300005467 Ga0070706_100027836 Ga0070706_1000278365 147
93 3300005468 Ga0070707_100012421 Ga0070707_1000124212 147
94 3300005471 Ga0070698_100005171 Ga0070698_1000051719 147
95 3300005471 Ga0070698_100039124 Ga0070698_1000391243 147
96 3300005518 Ga0070699_100834899 Ga0070699_1008348991 147
97 3300005535 Ga0070684_100724682 Ga0070684_1007246822 147
98 3300005543 Ga0070672_100133701 Ga0070672_1001337014 147
99 3300005546 Ga0070696_100077230 Ga0070696_1000772303 147
100 3300005547 Ga0070693_100027117 Ga0070693_1000271173 147
101 3300005564 Ga0070664_100001843 Ga0070664_10000184312 147
102 3300005577 Ga0068857_100182582 Ga0068857_1001825822 147
103 3300005577 Ga0068857_100223742 Ga0068857_1002237423 147
104 3300005614 Ga0068856_100035768 Ga0068856_1000357682 147
105 3300005615 Ga0070702_100000198 Ga0070702_10000019810 147
106 3300005616 Ga0068852_100201247 Ga0068852_1002012472 147
107 3300005616 Ga0068852_100653504 Ga0068852_1006535042 147
108 3300005616 Ga0068852_100737022 Ga0068852_1007370221 147
109 3300005618 Ga0068864_101050701 Ga0068864_1010507012 147
110 3300005718 Ga0068866_10196340 Ga0068866_101963402 147
111 3300005719 Ga0068861_100148656 Ga0068861_1001486562 147
112 3300005834 Ga0068851_10273997 Ga0068851_102739971 147
113 3300005841 Ga0068863_100043625 Ga0068863_1000436252 147
114 3300005843 Ga0068860_100435859 Ga0068860_1004358593 147
115 3300005843 Ga0068860_100825889 Ga0068860_1008258891 147
116 3300006028 Ga0070717_10006669 Ga0070717_100066695 147
117 3300006028 Ga0070717_11000170 Ga0070717_110001701 147
118 3300006163 Ga0070715_10087090 Ga0070715_100870903 147
119 3300006163 Ga0070715_10144323 Ga0070715_101443231 147
120 3300006173 Ga0070716_100037364 Ga0070716_1000373643 147
121 3300006237 Ga0097621_100195669 Ga0097621_1001956693 147
122 3300006358 Ga0068871_101134296 Ga0068871_1011342962 147
123 3300006844 Ga0075428_100751094 Ga0075428_1007510941 147
124 3300006881 Ga0068865_100092062 Ga0068865_1000920622 147
125 3300006881 Ga0068865_100564048 Ga0068865_1005640482 147
126 3300007076 Ga0075435_100893637 Ga0075435_1008936371 147
127 3300009101 Ga0105247_10148944 Ga0105247_101489442 147
128 3300009147 Ga0114129_11263372 Ga0114129_112633721 147
129 3300009148 Ga0105243_10009041 Ga0105243_100090418 147
130 3300009148 Ga0105243_11102760 Ga0105243_111027601 147
131 3300009174 Ga0105241_10413392 Ga0105241_104133922 147
132 3300009176 Ga0105242_10060234 Ga0105242_100602342 147
133 3300009545 Ga0105237_10626144 Ga0105237_106261442 147
134 3300009551 Ga0105238_10484427 Ga0105238_104844272 147
135 3300009551 Ga0105238_10698990 Ga0105238_106989902 147
136 3300010159 Ga0099796_10025254 Ga0099796_100252542 147
137 3300011119 Ga0105246_10222948 Ga0105246_102229482 147
138 3300013052 Ga0154014_152655 Ga0154014_1526551 147
139 3300013059 Ga0154012_129624 Ga0154012_1296242 147
140 3300013059 Ga0154012_174429 Ga0154012_1744291 147
141 3300013100 Ga0157373_10821137 Ga0157373_108211371 147
142 3300013104 Ga0157370_10355780 Ga0157370_103557802 147
143 3300013105 Ga0157369_10016634 Ga0157369_100166345 147
144 3300013297 Ga0157378_10014969 Ga0157378_100149693 147
145 3300013306 Ga0163162_10092421 Ga0163162_100924213 147
146 3300013306 Ga0163162_10751007 Ga0163162_107510071 147
147 3300013306 Ga0163162_11350474 Ga0163162_113504741 147
148 3300013307 Ga0157372_10025059 Ga0157372_100250595 147
149 3300013308 Ga0157375_10024756 Ga0157375_100247567 147
150 3300013308 Ga0157375_11158497 Ga0157375_111584972 147
151 3300014325 Ga0163163_10365258 Ga0163163_103652583 147
152 3300014325 Ga0163163_10868289 Ga0163163_108682892 147
153 3300014326 Ga0157380_10125706 Ga0157380_101257063 147
154 3300014326 Ga0157380_10883529 Ga0157380_108835292 147
155 3300014745 Ga0157377_10416225 Ga0157377_104162252 147
156 3300014969 Ga0157376_11199243 Ga0157376_111992431 147
157 3300017792 Ga0163161_10065215 Ga0163161_100652151 147
158 3300020069 Ga0197907_10601052 Ga0197907_106010522 147
159 3300020069 Ga0197907_10857789 Ga0197907_108577891 147
160 3300020069 Ga0197907_11149652 Ga0197907_111496521 147
161 3300020069 Ga0197907_11162759 Ga0197907_111627591 147
162 3300020069 Ga0197907_11331483 Ga0197907_113314832 147
163 3300020075 Ga0206349_1564623 Ga0206349_15646231 147
164 3300020075 Ga0206349_1821486 Ga0206349_18214861 147
165 3300020075 Ga0206349_1871115 Ga0206349_18711152 147
166 3300020076 Ga0206355_1044750 Ga0206355_10447503 147
167 3300020076 Ga0206355_1163317 Ga0206355_11633172 147
168 3300020076 Ga0206355_1455207 Ga0206355_14552071 147
169 3300020077 Ga0206351_10040481 Ga0206351_100404811 147
170 3300020077 Ga0206351_10300344 Ga0206351_103003442 147
171 3300020077 Ga0206351_10874627 Ga0206351_108746272 147
172 3300020078 Ga0206352_10035753 Ga0206352_100357532 147
173 3300020078 Ga0206352_10275810 Ga0206352_102758101 147
174 3300020078 Ga0206352_11105915 Ga0206352_111059151 147
175 3300020078 Ga0206352_11289692 Ga0206352_112896922 147
176 3300020080 Ga0206350_10071743 Ga0206350_100717431 147
177 3300020080 Ga0206350_11411288 Ga0206350_114112882 147
178 3300020081 Ga0206354_10666701 Ga0206354_106667012 147
179 3300020081 Ga0206354_11502833 Ga0206354_115028331 147
180 3300020081 Ga0206354_11643590 Ga0206354_116435902 147
181 3300020082 Ga0206353_10015581 Ga0206353_100155812 147
182 3300020082 Ga0206353_10319916 Ga0206353_103199162 147
183 3300020082 Ga0206353_10907110 Ga0206353_109071102 147
184 3300020082 Ga0206353_11676470 Ga0206353_116764702 147
185 3300021388 Ga0213875_10047878 Ga0213875_100478781 147
186 3300022467 Ga0224712_10172211 Ga0224712_101722111 147
187 3300022467 Ga0224712_10241241 Ga0224712_102412412 147
188 3300022467 Ga0224712_10422486 Ga0224712_104224861 147
189 3300023436 Ga0256743_123451 Ga0256743_1234512 147
190 3300023536 Ga0247552_100504 Ga0247552_1005042 147
191 3300023552 Ga0247551_100537 Ga0247551_1005372 147
192 3300023672 Ga0247553_103103 Ga0247553_1031032 147
193 3300024225 Ga0224572_1003783 Ga0224572_10037833 147
194 3300024227 Ga0228598_1021821 Ga0228598_10218211 147
195 3300024227 Ga0228598_1058895 Ga0228598_10588952 147
196 3300025321 Ga0207656_10194956 Ga0207656_101949561 147
197 3300025898 Ga0207692_10168898 Ga0207692_101688982 147
198 3300025898 Ga0207692_10212414 Ga0207692_102124142 147
199 3300025901 Ga0207688_10133551 Ga0207688_101335513 147
200 3300025905 Ga0207685_10015597 Ga0207685_100155972 147
201 3300025905 Ga0207685_10095578 Ga0207685_100955782 147
202 3300025906 Ga0207699_10102062 Ga0207699_101020621 147
203 3300025908 Ga0207643_10392583 Ga0207643_103925831 147
204 3300025908 Ga0207643_10658402 Ga0207643_106584021 147
205 3300025909 Ga0207705_10375352 Ga0207705_103753522 147
206 3300025910 Ga0207684_10145920 Ga0207684_101459202 147
207 3300025910 Ga0207684_10263568 Ga0207684_102635681 147
208 3300025913 Ga0207695_11652738 Ga0207695_116527381 147
209 3300025915 Ga0207693_10083322 Ga0207693_100833222 147
210 3300025915 Ga0207693_10137136 Ga0207693_101371362 147
211 3300025915 Ga0207693_10875090 Ga0207693_108750902 147
212 3300025916 Ga0207663_10023704 Ga0207663_100237044 147
213 3300025916 Ga0207663_10409044 Ga0207663_104090442 147
214 3300025919 Ga0207657_10034194 Ga0207657_100341944 147
215 3300025920 Ga0207649_11074212 Ga0207649_110742121 147
216 3300025922 Ga0207646_10347531 Ga0207646_103475312 147
217 3300025924 Ga0207694_10485394 Ga0207694_104853942 147
218 3300025926 Ga0207659_10014142 Ga0207659_100141423 147
219 3300025927 Ga0207687_10020636 Ga0207687_100206365 147
220 3300025928 Ga0207700_10615967 Ga0207700_106159672 147
221 3300025928 Ga0207700_10998090 Ga0207700_109980902 147
222 3300025929 Ga0207664_10100179 Ga0207664_101001791 147
223 3300025929 Ga0207664_10111385 Ga0207664_101113852 147
224 3300025929 Ga0207664_10209153 Ga0207664_102091533 147
225 3300025929 Ga0207664_10307892 Ga0207664_103078923 147
226 3300025931 Ga0207644_10481626 Ga0207644_104816262 147
227 3300025932 Ga0207690_10332460 Ga0207690_103324602 147
228 3300025933 Ga0207706_10065674 Ga0207706_100656743 147
229 3300025934 Ga0207686_10059204 Ga0207686_100592042 147
230 3300025935 Ga0207709_10095939 Ga0207709_100959391 147
231 3300025937 Ga0207669_10053009 Ga0207669_100530091 147
232 3300025937 Ga0207669_10477145 Ga0207669_104771452 147
233 3300025938 Ga0207704_10017593 Ga0207704_100175932 147
234 3300025938 Ga0207704_10395241 Ga0207704_103952412 147
235 3300025939 Ga0207665_10012742 Ga0207665_100127423 147
236 3300025940 Ga0207691_10071731 Ga0207691_100717313 147
237 3300025942 Ga0207689_10009163 Ga0207689_100091636 147
238 3300025944 Ga0207661_10287466 Ga0207661_102874662 147
239 3300025944 Ga0207661_11065674 Ga0207661_110656741 147
240 3300025945 Ga0207679_10003555 Ga0207679_100035556 147
241 3300026067 Ga0207678_10012901 Ga0207678_100129017 147
242 3300026075 Ga0207708_10003635 Ga0207708_1000363512 147
243 3300026078 Ga0207702_10278630 Ga0207702_102786301 147
244 3300026078 Ga0207702_10316034 Ga0207702_103160342 147
245 3300026089 Ga0207648_10185813 Ga0207648_101858132 147
246 3300026116 Ga0207674_10003200 Ga0207674_1000320014 147
247 3300026116 Ga0207674_10049600 Ga0207674_100496006 147
248 3300026116 Ga0207674_10087111 Ga0207674_100871113 147
249 3300026118 Ga0207675_100220457 Ga0207675_1002204574 147
250 3300026121 Ga0207683_10150972 Ga0207683_101509722 147
251 3300026121 Ga0207683_10242834 Ga0207683_102428343 147
252 3300026142 Ga0207698_10265011 Ga0207698_102650112 147
253 3300026142 Ga0207698_10473427 Ga0207698_104734272 147
254 3300027907 Ga0207428_10049480 Ga0207428_100494804 147
255 3300028381 Ga0268264_11364600 Ga0268264_113646001 147
256 3300028573 Ga0265334_10025340 Ga0265334_100253403 147
257 3300028794 Ga0307515_10195134 Ga0307515_101951342 147
258 3300028794 Ga0307515_10239157 Ga0307515_102391572 147
259 3300029282 Ga0311003_165979 Ga0311003_1659791 147
260 3300029282 Ga0311003_169922 Ga0311003_1699221 147
261 3300029285 Ga0310981_1086556 Ga0310981_10865561 147
262 3300030763 Ga0265763_1016447 Ga0265763_10164472 147
263 3300030882 Ga0265764_104361 Ga0265764_1043611 147
264 3300030889 Ga0265761_106896 Ga0265761_1068961 147
265 3300031018 Ga0265773_1011800 Ga0265773_10118001 147
266 3300031090 Ga0265760_10014888 Ga0265760_100148882 147
267 3300031247 Ga0265340_10002795 Ga0265340_100027954 147
268 3300031548 Ga0307408_100658331 Ga0307408_1006583311 147
269 3300031616 Ga0307508_10424947 Ga0307508_104249471 147
270 3300031824 Ga0307413_10520358 Ga0307413_105203581 147
271 3300031852 Ga0307410_10056981 Ga0307410_100569814 147
272 3300031901 Ga0307406_10223622 Ga0307406_102236222 147
273 3300031901 Ga0307406_10263291 Ga0307406_102632912 147
274 3300031995 Ga0307409_100032855 Ga0307409_1000328555 147
275 3300031995 Ga0307409_100151026 Ga0307409_1001510263 147
276 3300031995 Ga0307409_100291582 Ga0307409_1002915822 147
277 3300031995 Ga0307409_101304606 Ga0307409_1013046062 147
278 3300032002 Ga0307416_100306774 Ga0307416_1003067742 147
279 3300032002 Ga0307416_100486315 Ga0307416_1004863151 147
280 3300032002 Ga0307416_100561922 Ga0307416_1005619222 147
281 3300032004 Ga0307414_10280333 Ga0307414_102803331 147
282 3300032005 Ga0307411_10189560 Ga0307411_101895603 147
283 3300032126 Ga0307415_100119530 Ga0307415_1001195302 147
284 3300032126 Ga0307415_100138633 Ga0307415_1001386332 147
285 3300032126 Ga0307415_100731221 Ga0307415_1007312212 147
286 3300035083 Ga0373926_0001724 Ga0373926_0001724_3460_3903 147
287 3300035086 Ga0373934_0154541 Ga0373934_0154541_238_681 147
288 3300035089 Ga0373944_0000692 Ga0373944_0000692_3392_3835 147
289 3300035111 Ga0373923_0231306 Ga0373923_0231306_166_609 147
290 3300035113 Ga0373936_0001828 Ga0373936_0001828_1794_2237 147
291 3300035113 Ga0373936_0003698 Ga0373936_0003698_650_1093 147
292 3300035116 Ga0373945_0002371 Ga0373945_0002371_3191_3634 147
293 3300035118 Ga0373954_0076350 Ga0373954_0076350_595_1038 147
294 3300035119 Ga0373956_0270617 Ga0373956_0270617_168_611 147
295 3300035120 Ga0373957_0060907 Ga0373957_0060907_435_878 147
296 3300035170 Ga0373943_0002227 Ga0373943_0002227_6470_6913 147
297 3300035171 Ga0373946_0000163 Ga0373946_0000163_5212_5655 147
298 3300035691 Ga0373931_0631481 Ga0373931_0631481_138_581 147
299 3300035692 Ga0373935_0122992 Ga0373935_0122992_1142_1585 147
300 3300035692 Ga0373935_0467119 Ga0373935_0467119_160_603 147
301 3300035695 Ga0373927_0009072 Ga0373927_0009072_5954_6397 147
302 3300035724 Ga0373933_0048277 Ga0373933_0048277_1038_1481 147
303 3300035725 Ga0373947_0007483 Ga0373947_0007483_2537_2980 147
304 3300035725 Ga0373947_0105611 Ga0373947_0105611_34_477 147
305 3300035725 Ga0373947_0252909 Ga0373947_0252909_555_998 147
306 3300036401 Ga0373937_0481770 Ga0373937_0481770_370_813 147
307 3300036401 Ga0373937_0677171 Ga0373937_0677171_488_931 147
308 3300036457 Ga0265778_022729 Ga0265778_022729_36_479 147
309 3300037068 Ga0373925_0016436 Ga0373925_0016436_4639_5082 147
310 3300037068 Ga0373925_0289213 Ga0373925_0289213_434_877 147
311 3300037068 Ga0373925_0673732 Ga0373925_0673732_338_781 147
312 3300037068 Ga0373925_1197691 Ga0373925_1197691_70_513 147
313 3300037466 Ga0395898_0271155 Ga0395898_0271155_88_531 147
314 3300037853 Ga0436364_0221389 Ga0436364_0221389_125_568 147
315 3300037853 Ga0436364_0664769 Ga0436364_0664769_1689_2132 147
316 3300037853 Ga0436364_0982400 Ga0436364_0982400_339_782 147
317 3300037853 Ga0436364_1160647 Ga0436364_1160647_562_1005 147
318 3300037853 Ga0436364_1449392 Ga0436364_1449392_821_1264 147
319 3300038443 Ga0395901_0138759 Ga0395901_0138759_2043_2486 147
320 3300039437 Ga0436365_0009793 Ga0436365_0009793_277_720 147
321 3300039437 Ga0436365_1465599 Ga0436365_1465599_113_556 147
322 3300039438 Ga0436360_0704114 Ga0436360_0704114_87_530 147
323 3300039450 Ga0436363_0879956 Ga0436363_0879956_155_598 147
324 3300041404 Ga0439436_0235981 Ga0439436_0235981_23_466 147
325 3300041452 Ga0451793_0010092 Ga0451793_0010092_124_567 147
326 3300041491 Ga0451833_1400870 Ga0451833_1400870_764_1207 147
327 3300041505 Ga0451849_0283202 Ga0451849_0283202_54_497 147
328 3300041509 Ga0451843_0117617 Ga0451843_0117617_246_689 147
329 3300041512 Ga0451853_0113190 Ga0451853_0113190_1231_1674 147
330 3300041512 Ga0451853_1295242 Ga0451853_1295242_1025_1468 147
331 3300042006 Ga0439432_056443 Ga0439432_056443_186_629 147
332 3300042013 Ga0439456_114978 Ga0439456_114978_131_574 147
333 3300042014 Ga0439457_007769 Ga0439457_007769_2000_2443 147
334 3300042146 Ga0450907_050248 Ga0450907_050248_91_534 147
335 3300042533 Ga0450901_012846 Ga0450901_012846_414_857 147
336 3300044683 Ga0466965_0101078 Ga0466965_0101078_135_578 147
337 3300044694 Ga0466963_0004113 Ga0466963_0004113_4355_4798 147
338 3300044694 Ga0466963_0143290 Ga0466963_0143290_62_505 147
339 3300044765 Ga0466970_0687559 Ga0466970_0687559_21_464 147
340 3300044901 Ga0466960_0080702 Ga0466960_0080702_765_1208 147
341 3300045836 Ga0466958_0534788 Ga0466958_0534788_235_678 147
342 3300045976 Ga0466967_0025673 Ga0466967_0025673_628_1071 147
343 3300045976 Ga0466967_2194471 Ga0466967_2194471_28_471 147
344 3300046454 Ga0495592_0015950 Ga0495592_0015950_1956_2399 147
345 3300046461 Ga0495641_0034299 Ga0495641_0034299_1161_1604 147
346 3300046461 Ga0495641_0236900 Ga0495641_0236900_272_715 147
347 3300046461 Ga0495641_0377675 Ga0495641_0377675_164_607 147
348 3300046462 Ga0495651_0002063 Ga0495651_0002063_4562_5005 147
349 3300046462 Ga0495651_0097057 Ga0495651_0097057_543_986 147
350 3300046463 Ga0495653_0013086 Ga0495653_0013086_3209_3652 147
351 3300046463 Ga0495653_0013477 Ga0495653_0013477_4985_5428 147
352 3300046472 Ga0495580_0005827 Ga0495580_0005827_9036_9479 147
353 3300046473 Ga0495582_0046247 Ga0495582_0046247_1256_1699 147
354 3300046475 Ga0495639_0074184 Ga0495639_0074184_554_997 147
355 3300046476 Ga0495662_0000390 Ga0495662_0000390_1828_2271 147
356 3300046476 Ga0495662_0022507 Ga0495662_0022507_2022_2465 147
357 3300046477 Ga0495664_0003456 Ga0495664_0003456_5750_6193 147
358 3300046477 Ga0495664_0022835 Ga0495664_0022835_1743_2186 147
359 3300046511 Ga0495608_0006616 Ga0495608_0006616_3225_3668 147
360 3300046511 Ga0495608_0038981 Ga0495608_0038981_2688_3131 147
361 3300046514 Ga0495618_0081028 Ga0495618_0081028_1055_1498 147
362 3300046516 Ga0495628_0036245 Ga0495628_0036245_1962_2405 147
363 3300046516 Ga0495628_0346170 Ga0495628_0346170_394_837 147
364 3300046517 Ga0495630_0038944 Ga0495630_0038944_1285_1728 147
365 3300046517 Ga0495630_0049467 Ga0495630_0049467_851_1294 147
366 3300046526 Ga0495666_0018682 Ga0495666_0018682_1046_1489 147
367 3300046529 Ga0495652_0010650 Ga0495652_0010650_662_1105 147
368 3300046529 Ga0495652_0030673 Ga0495652_0030673_3113_3556 147
369 3300046531 Ga0495665_0011264 Ga0495665_0011264_1812_2255 147
370 3300046531 Ga0495665_0024076 Ga0495665_0024076_2650_3093 147
371 3300046533 Ga0495640_0010828 Ga0495640_0010828_4071_4514 147
372 3300046533 Ga0495640_0159766 Ga0495640_0159766_731_1174 147
373 3300046535 Ga0495586_0016566 Ga0495586_0016566_2517_2960 147
374 3300046536 Ga0495587_0005716 Ga0495587_0005716_3927_4370 147
375 3300046536 Ga0495587_0243088 Ga0495587_0243088_178_621 147
376 3300046543 Ga0495645_0003715 Ga0495645_0003715_5983_6426 147
377 3300046543 Ga0495645_0244959 Ga0495645_0244959_331_774 147
378 3300046559 Ga0495667_0008085 Ga0495667_0008085_2892_3335 147
379 3300046559 Ga0495667_0008797 Ga0495667_0008797_2460_2903 147
380 3300046559 Ga0495667_0094527 Ga0495667_0094527_1071_1514 147
381 3300046642 Ga0495634_0033793 Ga0495634_0033793_1700_2143 147
382 3300046642 Ga0495634_0061971 Ga0495634_0061971_1828_2271 147
383 3300046663 Ga0495635_0002519 Ga0495635_0002519_5509_5952 147
384 3300046663 Ga0495635_0012485 Ga0495635_0012485_2985_3428 147
385 3300046663 Ga0495635_0089299 Ga0495635_0089299_1468_1911 147
386 3300046675 Ga0495657_0033029 Ga0495657_0033029_342_785 147
387 3300046675 Ga0495657_0210984 Ga0495657_0210984_455_898 147
388 3300046675 Ga0495657_0225287 Ga0495657_0225287_630_1073 147
389 3300046678 Ga0495599_0005565 Ga0495599_0005565_4133_4576 147
390 3300046678 Ga0495599_0093710 Ga0495599_0093710_963_1406 147
391 3300046679 Ga0495623_0007953 Ga0495623_0007953_3499_3942 147
392 3300046680 Ga0495646_0008190 Ga0495646_0008190_2273_2716 147
393 3300046689 Ga0495613_0018672 Ga0495613_0018672_2189_2632 147
394 3300046690 Ga0495624_0012594 Ga0495624_0012594_586_1029 147
395 3300046809 Ga0495600_0002560 Ga0495600_0002560_5862_6305 147
396 3300046809 Ga0495600_0047712 Ga0495600_0047712_56_499 147
397 3300046809 Ga0495600_0414045 Ga0495600_0414045_143_586 147
398 3300047317 Ga0495604_0000113 Ga0495604_0000113_12277_12720 147
399 3300047317 Ga0495604_0203283 Ga0495604_0203283_314_757 147
400 3300047317 Ga0495604_0232143 Ga0495604_0232143_198_641 147
401 3300047319 Ga0495674_0000494 Ga0495674_0000494_16415_16858 147
402 3300047319 Ga0495674_0014322 Ga0495674_0014322_4445_4888 147
403 3300047321 Ga0495676_0165032 Ga0495676_0165032_842_1285 147
404 3300047322 Ga0495680_0028648 Ga0495680_0028648_3880_4323 147
405 3300047322 Ga0495680_0049370 Ga0495680_0049370_365_808 147
406 3300047322 Ga0495680_0349987 Ga0495680_0349987_315_758 147
407 3300047322 Ga0495680_0768952 Ga0495680_0768952_159_602 147
408 3300047444 Ga0495675_0002112 Ga0495675_0002112_8588_9031 147
409 3300047444 Ga0495675_0590308 Ga0495675_0590308_36_479 147
410 3300047471 Ga0495684_0011762 Ga0495684_0011762_3594_4037 147
411 3300047471 Ga0495684_0014873 Ga0495684_0014873_1992_2435 147
412 3300047471 Ga0495684_0020734 Ga0495684_0020734_3445_3888 147
413 3300047673 Ga0495593_0003677 Ga0495593_0003677_2098_2541 147
414 3300048088 Ga0495602_0015786 Ga0495602_0015786_2539_2982 147
415 3300048088 Ga0495602_0242024 Ga0495602_0242024_71_514 147
416 3300048903 Ga0496100_1279854 Ga0496100_1279854_41_484 147
417 3300048904 Ga0496101_0217538 Ga0496101_0217538_536_979 147
418 3300048904 Ga0496101_0255739 Ga0496101_0255739_182_625 147
419 3300048904 Ga0496101_0451439 Ga0496101_0451439_107_550 147
420 3300048907 Ga0496104_0259859 Ga0496104_0259859_1058_1501 147
421 3300048907 Ga0496104_0435768 Ga0496104_0435768_706_1149 147
422 3300048908 Ga0496105_0440495 Ga0496105_0440495_539_982 147
423 3300048909 Ga0496106_0135921 Ga0496106_0135921_1377_1820 147
424 3300048909 Ga0496106_0363736 Ga0496106_0363736_186_629 147
425 3300048910 Ga0496107_0275723 Ga0496107_0275723_138_581 147
426 3300048911 Ga0496108_0273398 Ga0496108_0273398_269_712 147
427 3300048912 Ga0496109_0010829 Ga0496109_0010829_590_1033 147
428 3300048912 Ga0496109_0448909 Ga0496109_0448909_38_481 147
429 3300048913 Ga0496110_0009432 Ga0496110_0009432_594_1037 147
430 3300048914 Ga0496111_0367834 Ga0496111_0367834_252_695 147
431 3300048915 Ga0496112_0631376 Ga0496112_0631376_403_846 147
432 3300048918 Ga0496115_0325156 Ga0496115_0325156_226_669 147
433 3300048918 Ga0496115_0746251 Ga0496115_0746251_161_604 147
434 3300048924 Ga0496121_0564188 Ga0496121_0564188_112_555 147
435 3300048929 Ga0496126_0229548 Ga0496126_0229548_589_1032 147
436 3300049127 Ga0501306_010747 Ga0501306_010747_137_580 147
437 3300049128 Ga0501308_006718 Ga0501308_006718_140_583 147
438 3300049129 Ga0501309_014047 Ga0501309_014047_139_582 147
439 3300049130 Ga0501310_009556 Ga0501310_009556_139_582 147
440 3300049130 Ga0501310_009626 Ga0501310_009626_131_574 147
441 3300049160 Ga0501304_003533 Ga0501304_003533_137_580 147
442 3300049161 Ga0501305_013343 Ga0501305_013343_138_581 147
443 3300049162 Ga0501307_008964 Ga0501307_008964_138_581 147
444 3300049527 Ga0501311_012135 Ga0501311_012135_493_936 147
445 3300049527 Ga0501311_035147 Ga0501311_035147_25_468 147
446 3300049528 Ga0501312_014450 Ga0501312_014450_139_582 147
447 3300049528 Ga0501312_032451 Ga0501312_032451_79_522 147
448 3300049529 Ga0501313_006386 Ga0501313_006386_137_580 147
449 3300049530 Ga0501314_004769 Ga0501314_004769_138_581 147
450 3300049531 Ga0501315_009523 Ga0501315_009523_137_580 147
451 3300049531 Ga0501315_027721 Ga0501315_027721_96_539 147
452 3300049532 Ga0501316_008319 Ga0501316_008319_490_933 147
453 3300049532 Ga0501316_012735 Ga0501316_012735_293_736 147
454 3300049533 Ga0501317_009818 Ga0501317_009818_159_602 147
455 3300049533 Ga0501317_012535 Ga0501317_012535_118_561 147
456 3300049533 Ga0501317_061275 Ga0501317_061275_129_572 147
457 3300049534 Ga0501318_007614 Ga0501318_007614_555_998 147
458 3300049534 Ga0501318_009684 Ga0501318_009684_59_502 147
459 3300049535 Ga0501319_002776 Ga0501319_002776_138_581 147
460 3300049536 Ga0501320_005938 Ga0501320_005938_139_582 147
461 3300049537 Ga0501321_008384 Ga0501321_008384_139_582 147
462 3300049537 Ga0501321_054497 Ga0501321_054497_78_521 147
463 3300049538 Ga0501322_002375 Ga0501322_002375_138_581 147
464 3300049539 Ga0501323_018225 Ga0501323_018225_139_582 147
465 3300049540 Ga0501324_005072 Ga0501324_005072_138_581 147
466 3300049541 Ga0501325_005925 Ga0501325_005925_136_579 147
467 3300049544 Ga0501328_04491 Ga0501328_04491_132_575 147
468 3300049546 Ga0501330_007298 Ga0501330_007298_165_608 147
469 3300049548 Ga0501332_07952 Ga0501332_07952_132_575 147
470 3300049553 Ga0501337_010335 Ga0501337_010335_132_575 147
471 3300049570 Ga0501033_0206149 Ga0501033_0206149_360_803 147
472 3300049579 Ga0501043_0372961 Ga0501043_0372961_509_952 147
473 3300049822 Ga0501035_0423786 Ga0501035_0423786_69_512 147
474 3300049824 Ga0501045_1040041 Ga0501045_1040041_10_453 147
475 3300050507 nmdc:mga05p37_662627_c1 nmdc:mga05p37_662627_c1_98_541 147
476 3300050514 nmdc:mga08x19_726437_c1 nmdc:mga08x19_726437_c1_173_616 147
477 3300053077 Ga0495601_0005598 Ga0495601_0005598_587_1030 147
478 3300053085 Ga0495619_0166497 Ga0495619_0166497_395_838 147
479 3300053085 Ga0495619_0217718 Ga0495619_0217718_300_743 147
480 3300053140 Ga0500573_0090421 Ga0500573_0090421_454_897 147
481 3300053153 Ga0500616_0000144 Ga0500616_0000144_21841_22284 147
482 3300053730 Ga0500645_041594 Ga0500645_041594_453_899 147
483 3300059478 Ga0587093_029114 Ga0587093_029114_186_629 147
484 3300059491 Ga0587070_100377 Ga0587070_100377_136_579 147
485 3300059504 Ga0587082_061652 Ga0587082_061652_93_536 147
486 3300059509 Ga0587089_065246 Ga0587089_065246_105_548 147
487 3300059510 Ga0587090_095625 Ga0587090_095625_97_540 147
488 3300059510 Ga0587090_111017 Ga0587090_111017_94_540 147
489 3300059607 Ga0587125_053961 Ga0587125_053961_77_520 147
490 3300059622 Ga0587099_022632 Ga0587099_022632_246_689 147
491 3300059622 Ga0587099_039607 Ga0587099_039607_19_462 147
492 3300059626 Ga0587115_044976 Ga0587115_044976_89_532 147
493 3300059644 Ga0587075_033424 Ga0587075_033424_203_646 147
494 3300059651 Ga0587105_016021 Ga0587105_016021_157_600 147
495 3300059658 Ga0587119_042617 Ga0587119_042617_97_540 147
496 3300060247 Ga0587096_01975 Ga0587096_01975_193_648 147
497 3300060344 Ga0587071_066868 Ga0587071_066868_191_634 147
498 3300030889 Ga0265761_103986 Ga0265761_1039861 149
499 3300031090 Ga0265760_10266353 Ga0265760_102663531 149
500 3300002067 JGI24735J21928_10130353 JGI24735J21928_101303532 150
501 3300004799 Ga0058863_10102788 Ga0058863_101027881 150
502 3300004799 Ga0058863_10103508 Ga0058863_101035082 150
503 3300005327 Ga0070658_10811873 Ga0070658_108118731 150
504 3300005329 Ga0070683_100241552 Ga0070683_1002415521 150
505 3300005336 Ga0070680_100071213 Ga0070680_1000712132 150
506 3300005366 Ga0070659_101052696 Ga0070659_1010526961 150
507 3300005467 Ga0070706_100084548 Ga0070706_1000845482 150
508 3300005468 Ga0070707_100231672 Ga0070707_1002316723 150
509 3300005471 Ga0070698_100005168 Ga0070698_10000516811 150
510 3300013044 Ga0154019_134497 Ga0154019_1344971 150
511 3300020070 Ga0206356_10828527 Ga0206356_108285272 150
512 3300020076 Ga0206355_1231465 Ga0206355_12314651 150
513 3300020080 Ga0206350_10290155 Ga0206350_102901552 150
514 3300020080 Ga0206350_10434865 Ga0206350_104348652 150
515 3300020082 Ga0206353_10427005 Ga0206353_104270052 150
516 3300022467 Ga0224712_10136689 Ga0224712_101366892 150
517 3300022467 Ga0224712_10166025 Ga0224712_101660251 150
518 3300025910 Ga0207684_10065003 Ga0207684_100650032 150
519 3300025910 Ga0207684_10074216 Ga0207684_100742161 150
520 3300025920 Ga0207649_10520788 Ga0207649_105207882 150
521 3300025921 Ga0207652_10904114 Ga0207652_109041141 150
522 3300025922 Ga0207646_10288504 Ga0207646_102885041 150
523 3300025944 Ga0207661_10441525 Ga0207661_104415251 150
524 3300035086 Ga0373934_0000617 Ga0373934_0000617_4876_5346 150
525 3300035117 Ga0373953_0000138 Ga0373953_0000138_16113_16583 150
526 3300035119 Ga0373956_0000951 Ga0373956_0000951_7339_7809 150
527 3300035120 Ga0373957_0000328 Ga0373957_0000328_6357_6827 150
528 3300035172 Ga0373955_0000013 Ga0373955_0000013_66577_67047 150
529 3300035410 Ga0373924_0000385 Ga0373924_0000385_10711_11181 150
530 3300035724 Ga0373933_0000139 Ga0373933_0000139_3360_3830 150
531 3300036401 Ga0373937_0000112 Ga0373937_0000112_49309_49779 150
532 3300046454 Ga0495592_0000094 Ga0495592_0000094_6403_6873 150
533 3300046462 Ga0495651_0000041 Ga0495651_0000041_21762_22232 150
534 3300046463 Ga0495653_0040650 Ga0495653_0040650_1280_1750 150
535 3300046511 Ga0495608_0000081 Ga0495608_0000081_6403_6873 150
536 3300046516 Ga0495628_0001589 Ga0495628_0001589_13969_14439 150
537 3300046529 Ga0495652_0001330 Ga0495652_0001330_14652_15122 150
538 3300046536 Ga0495587_0000038 Ga0495587_0000038_66340_66810 150
539 3300046559 Ga0495667_0000070 Ga0495667_0000070_71922_72392 150
540 3300046675 Ga0495657_0001540 Ga0495657_0001540_12911_13381 150
541 3300046678 Ga0495599_0000100 Ga0495599_0000100_21709_22179 150
542 3300046679 Ga0495623_0000609 Ga0495623_0000609_14996_15466 150
543 3300046680 Ga0495646_0010557 Ga0495646_0010557_699_1169 150
544 3300046809 Ga0495600_0047729 Ga0495600_0047729_1574_2044 150
545 3300047317 Ga0495604_0000061 Ga0495604_0000061_71929_72399 150
546 3300047322 Ga0495680_0000099 Ga0495680_0000099_71929_72399 150
547 3300047444 Ga0495675_0003973 Ga0495675_0003973_2141_2611 150
548 3300048088 Ga0495602_0000649 Ga0495602_0000649_6403_6873 150
549 3300053084 Ga0495595_0000708 Ga0495595_0000708_6575_7045 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

43

161

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9208 2 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9205 1 142
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9188 7 143
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9162 1 142
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9146 2 142
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9103 12 150 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9078 1 142 3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.907 10 143 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9062 12 150 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9018 1 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A7K1DJB2-F1-model_v4 50S ribosomal protein L13 0.9491 14 142 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904
AF-A0A6J6JL86-F1-model_v4 Unannotated protein 0.9486 2 147 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7Y5LT23-F1-model_v4 Large ribosomal subunit protein uL13 0.9468 5 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A381R3J9-F1-model_v4 50S ribosomal protein L13 0.946 1 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A534TBT7-F1-model_v4 Large ribosomal subunit protein uL13 0.9451 12 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.86 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map