F462313

General Info

Members Datasets Scaffolds Average Seq Length
549 305 517 483

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10011596|Ga0055530_100115963
Length 476
Sequence MADDAMLKFVARGQEYPAKREAELRAEDFREIADRYAVPEAEAQAGRCSQCGVPYCSVHCPLHNHIPDWLRLTAEGRLREAYALSNSTSTMPEICGRICPQDRLCEGNCVIEFSGHGAVTIGSVEKFITDKAWDEGWVEPVRVGPARGQSVVIGAGPAGLSAAEYLREMGYDVHVYDRHDRAGGLLTYGIPGFKLEKHIVMRRVARLEEAGIVFHTSFEIGRDATLEELRAKHDTILIATGVYKARGIKAPGVGAAGVVEALDYLTASNRKGFGDAVPAFDDGSLDADGKHVVVIGGGDTAMDCVRTAIRQGAASVKCLYRRDRANMPGSQREVANAEEEGVEFVWLSGPEAFDGTDKVTGVRASKMRLGAPDASGRRAPEVDPGGAFQLKADLVIKALGFEAEDLPRLFGSEGLGVTRWGTLRTDGKTMMTSLDGVFAAGDIVRGASLVVWAIRDGRDVAAHMHAWMRAKARVAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
6 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
7 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
8 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
14 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
15 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
16 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
17 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
18 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
19 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
20 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
21 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
22 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
23 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
24 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
25 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
26 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
27 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
28 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
29 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
30 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
31 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
32 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
33 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
37 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
38 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
39 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
40 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
41 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
42 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
43 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
44 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
59 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
203 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
204 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
254 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
255 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
263 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
264 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
267 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
272 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
273 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
274 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
275 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
276 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
289 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
290 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
300 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
301 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
302 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
305 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.91
Bulb 0
Endosphere 15.3
Nodule 0
Rhizoplane 2
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3720739 2162886007 Bacteria 2475
2 JGI24741J21665_1000381 3300001915 Bacteria 13336
3 JGI24752J21851_1000119 3300001976 Bacteria 10710
4 JGI24752J21851_1000925 3300001976 Bacteria 4003
5 JGI24740J21852_10001832 3300001979 Bacteria 9728
6 JGI24740J21852_10022222 3300001979 Bacteria 2187
7 JGI24739J22299_10003832 3300001989 Bacteria 5737
8 JGI24739J22299_10004559 3300001989 Bacteria 5299
9 JGI24739J22299_10008274 3300001989 Bacteria 3882
10 JGI24737J22298_10002081 3300001990 Bacteria 7150
11 JGI24737J22298_10004180 3300001990 Bacteria 5048
12 JGI24737J22298_10005013 3300001990 Bacteria 4587
13 JGI24737J22298_10005022 3300001990 Bacteria 4584
14 JGI24737J22298_10006317 3300001990 Bacteria 4053
15 JGI24735J21928_10000609 3300002067 Bacteria 12598
16 JGI24750J21931_1000002 3300002070 Bacteria 30758
17 JGI24748J21848_1000043 3300002074 Bacteria 61255
18 JGI24738J21930_10000306 3300002075 Bacteria 13473
19 JGI24738J21930_10002787 3300002075 Bacteria 4488
20 JGI24749J21850_1000008 3300002076 Bacteria 45410
21 JGI24034J26672_10000031 3300002239 Bacteria 93812
22 JGI24742J22300_10001114 3300002244 Bacteria 4164
23 JGI24751J29686_10000474 3300002459 Bacteria 12036
24 JGI25150J39212_1000067 3300002774 Bacteria 63491
25 JGI25165J46597_1000085 3300003214 Bacteria 171345
26 JGI25153J46596_10000073 3300003215 Bacteria 115166
27 JGI25153J46596_10003130 3300003215 Bacteria 9331
28 Ga0055526_1003015 3300003771 Bacteria 10993
29 Ga0055537_1000707 3300003773 Bacteria 17302
30 Ga0055537_1002484 3300003773 Bacteria 6155
31 Ga0055524_1000210 3300003775 Bacteria 62927
32 Ga0055530_10006489 3300003791 Bacteria 5208
33 Ga0055530_10006817 3300003791 Bacteria 4964
34 Ga0055530_10011596 3300003791 Bacteria 3149
35 Ga0055540_1002562 3300003792 Bacteria 9477
36 Ga0055531_10009474 3300003794 Bacteria 4972
37 Ga0055531_10016151 3300003794 Bacteria 3239
38 Ga0065165_1000213 3300005262 Bacteria 100746
39 Ga0065165_1008955 3300005262 Bacteria 4584
40 Ga0065165_1011705 3300005262 Bacteria 3627
41 Ga0065165_1030070 3300005262 Bacteria 1732
42 Ga0065704_10077651 3300005289 Bacteria 4670
43 Ga0065704_10091194 3300005289 Bacteria 2733
44 Ga0070658_10000798 3300005327 Bacteria 26966
45 Ga0070658_10004519 3300005327 Bacteria 11311
46 Ga0070676_10005454 3300005328 Bacteria 6776
47 Ga0070683_100123444 3300005329 Bacteria 2447
48 Ga0070690_100000010 3300005330 Bacteria 103492
49 Ga0070670_100000046 3300005331 Bacteria 138621
50 Ga0070670_100000572 3300005331 Bacteria 29143
51 Ga0070670_100001867 3300005331 Bacteria 17163
52 Ga0070670_100014275 3300005331 Bacteria 6815
53 Ga0068869_100000194 3300005334 Bacteria 31498
54 Ga0070666_10000006 3300005335 Bacteria 319173
55 Ga0068868_100001008 3300005338 Bacteria 19260
56 Ga0070660_100010606 3300005339 Bacteria 6514
57 Ga0070660_100017282 3300005339 Bacteria 5254
58 Ga0070660_100026594 3300005339 Bacteria 4310
59 Ga0070689_100017083 3300005340 Bacteria 5323
60 Ga0070661_100000462 3300005344 Bacteria 31045
61 Ga0070661_100036666 3300005344 Bacteria 3564
62 Ga0070661_100086686 3300005344 Bacteria 2315
63 Ga0070668_100000031 3300005347 Bacteria 87761
64 Ga0070668_100003546 3300005347 Bacteria 11508
65 Ga0070668_100005350 3300005347 Bacteria 9530
66 Ga0070668_100048322 3300005347 Bacteria 3272
67 Ga0070668_100103905 3300005347 Bacteria 2254
68 Ga0070669_100000168 3300005353 Bacteria 57587
69 Ga0070669_100002641 3300005353 Bacteria 12941
70 Ga0070669_100010502 3300005353 Bacteria 6576
71 Ga0070671_100000265 3300005355 Bacteria 35316
72 Ga0070674_100108008 3300005356 Bacteria 2038
73 Ga0070673_100000001 3300005364 Bacteria 239842
74 Ga0070688_100004394 3300005365 Bacteria 7328
75 Ga0070667_100000004 3300005367 Bacteria 444091
76 Ga0070667_100000088 3300005367 Bacteria 113956
77 Ga0070667_100000134 3300005367 Bacteria 94286
78 Ga0070667_100000689 3300005367 Bacteria 32591
79 Ga0070667_100000690 3300005367 Bacteria 32571
80 Ga0070667_100008948 3300005367 Bacteria 8290
81 Ga0070663_100004538 3300005455 Bacteria 8182
82 Ga0070663_100060573 3300005455 Bacteria 2723
83 Ga0070662_100017540 3300005457 Bacteria 4828
84 Ga0070662_100018051 3300005457 Bacteria 4767
85 Ga0070662_100047482 3300005457 Bacteria 3089
86 Ga0068867_100002256 3300005459 Bacteria 13557
87 Ga0068867_100095823 3300005459 Bacteria 2258
88 Ga0070685_10000346 3300005466 Bacteria 28404
89 Ga0070685_10054974 3300005466 Bacteria 2312
90 Ga0070679_100105238 3300005530 Bacteria 2808
91 Ga0070684_100134082 3300005535 Bacteria 2236
92 Ga0068853_100008157 3300005539 Bacteria 8406
93 Ga0070686_100000042 3300005544 Bacteria 103828
94 Ga0070665_100000019 3300005548 Bacteria 413972
95 Ga0068855_100000007 3300005563 Bacteria 273676
96 Ga0068855_100007391 3300005563 Bacteria 13300
97 Ga0068855_100058385 3300005563 Bacteria 4519
98 Ga0068855_100222858 3300005563 Bacteria 2114
99 Ga0068857_100047160 3300005577 Bacteria 3825
100 Ga0068857_100196726 3300005577 Bacteria 1837
101 Ga0068854_100019544 3300005578 Bacteria 4568
102 Ga0068854_100052281 3300005578 Bacteria 2930
103 Ga0068856_100026365 3300005614 Bacteria 5667
104 Ga0068856_100035094 3300005614 Bacteria 4914
105 Ga0068852_100014356 3300005616 Bacteria 6095
106 Ga0068859_100000918 3300005617 Bacteria 30168
107 Ga0068859_100009271 3300005617 Bacteria 9937
108 Ga0068859_100052021 3300005617 Bacteria 4119
109 Ga0068859_100061749 3300005617 Bacteria 3776
110 Ga0068864_100000010 3300005618 Bacteria 358723
111 Ga0068864_100000089 3300005618 Bacteria 97458
112 Ga0068864_100000367 3300005618 Bacteria 39365
113 Ga0068864_100003396 3300005618 Bacteria 13157
114 Ga0068864_100028067 3300005618 Bacteria 4756
115 Ga0068864_100074152 3300005618 Bacteria 2969
116 Ga0068861_100000201 3300005719 Bacteria 31934
117 Ga0068861_100002151 3300005719 Bacteria 12764
118 Ga0068851_10033029 3300005834 Bacteria 2577
119 Ga0068851_10036899 3300005834 Bacteria 2449
120 Ga0068863_100000084 3300005841 Bacteria 104480
121 Ga0068863_100000113 3300005841 Bacteria 85761
122 Ga0068863_100000379 3300005841 Bacteria 45297
123 Ga0068863_100023030 3300005841 Bacteria 5953
124 Ga0068863_100034191 3300005841 Bacteria 4842
125 Ga0068863_100064443 3300005841 Bacteria 3466
126 Ga0068858_100000309 3300005842 Bacteria 51918
127 Ga0068858_100001212 3300005842 Bacteria 26756
128 Ga0068858_100008931 3300005842 Bacteria 9606
129 Ga0068858_100020523 3300005842 Bacteria 6174
130 Ga0068860_100000014 3300005843 Bacteria 319437
131 Ga0068860_100000220 3300005843 Bacteria 89460
132 Ga0068860_100002695 3300005843 Bacteria 18486
133 Ga0068860_100013501 3300005843 Bacteria 8008
134 Ga0068860_100027898 3300005843 Bacteria 5437
135 Ga0068862_100000022 3300005844 Bacteria 214075
136 Ga0068862_100000112 3300005844 Bacteria 97458
137 Ga0068862_100000220 3300005844 Bacteria 63070
138 Ga0068862_100000287 3300005844 Bacteria 55746
139 Ga0068862_100010697 3300005844 Bacteria 7576
140 Ga0081455_10000220 3300005937 Bacteria 73579
141 Ga0081539_10010593 3300005985 Bacteria 7452
142 Ga0075363_100051287 3300006048 Bacteria 2200
143 Ga0097621_100043692 3300006237 Bacteria 3613
144 Ga0068865_100000047 3300006881 Bacteria 68268
145 Ga0097620_100000918 3300006931 Bacteria 30168
146 Ga0097620_100009271 3300006931 Bacteria 9937
147 Ga0097620_100052021 3300006931 Bacteria 4119
148 Ga0097620_100061750 3300006931 Bacteria 3776
149 Ga0105251_10001379 3300009011 Bacteria 21025
150 Ga0105245_10000078 3300009098 Bacteria 100583
151 Ga0105245_10001539 3300009098 Bacteria 20908
152 Ga0105243_10001427 3300009148 Bacteria 21061
153 Ga0105241_10014592 3300009174 Bacteria 5752
154 Ga0105242_10002235 3300009176 Bacteria 15269
155 Ga0105248_10000012 3300009177 Bacteria 333963
156 Ga0105248_10000157 3300009177 Bacteria 79064
157 Ga0105248_10004497 3300009177 Bacteria 15425
158 Ga0105248_10014579 3300009177 Bacteria 8651
159 Ga0105248_10019164 3300009177 Bacteria 7570
160 Ga0105248_10032098 3300009177 Bacteria 5869
161 Ga0105238_10055600 3300009551 Bacteria 3972
162 Ga0105238_10058121 3300009551 Bacteria 3877
163 Ga0105249_10000035 3300009553 Bacteria 201325
164 Ga0105249_10000065 3300009553 Bacteria 151159
165 Ga0105249_10000257 3300009553 Bacteria 57683
166 Ga0105148_100009 3300009978 Bacteria 31431
167 Ga0105239_10060427 3300010375 Bacteria 4160
168 Ga0157326_1000981 3300012513 Bacteria 3233
169 Ga0157373_10075851 3300013100 Bacteria 2372
170 Ga0157370_10010012 3300013104 Bacteria 10028
171 Ga0157369_10034738 3300013105 Bacteria 5530
172 Ga0157369_10069319 3300013105 Bacteria 3789
173 Ga0157374_10054073 3300013296 Bacteria 3744
174 Ga0157374_10079600 3300013296 Bacteria 3106
175 Ga0157378_10026422 3300013297 Bacteria 5118
176 Ga0163162_10114305 3300013306 Bacteria 2798
177 Ga0157372_10056429 3300013307 Bacteria 4388
178 Ga0157372_10057969 3300013307 Bacteria 4329
179 Ga0157375_10002551 3300013308 Bacteria 15805
180 Ga0163163_10024114 3300014325 Bacteria 5787
181 Ga0163163_10039258 3300014325 Bacteria 4620
182 Ga0157380_10000191 3300014326 Bacteria 35789
183 Ga0157380_10000303 3300014326 Bacteria 29608
184 Ga0157380_10004669 3300014326 Bacteria 9535
185 Ga0157380_10009498 3300014326 Bacteria 6972
186 Ga0157379_10020631 3300014968 Bacteria 5830
187 Ga0157379_10025729 3300014968 Bacteria 5231
188 Ga0157376_10000071 3300014969 Bacteria 82759
189 Ga0183363_1010 3300015690 Bacteria 108191
190 Ga0209674_102742 3300025226 Bacteria 3578
191 Ga0207427_101689 3300025231 Bacteria 7332
192 Ga0207425_1000005 3300025245 Bacteria 900502
193 Ga0207425_1001852 3300025245 Bacteria 8155
194 Ga0209026_1001212 3300025250 Bacteria 11926
195 Ga0209148_1000332 3300025254 Bacteria 64492
196 Ga0209148_1002364 3300025254 Bacteria 6638
197 Ga0209129_1002371 3300025258 Bacteria 9286
198 Ga0209233_1000044 3300025261 Bacteria 489783
199 Ga0209233_1000078 3300025261 Bacteria 348118
200 Ga0209565_1000029 3300025263 Bacteria 340335
201 Ga0209565_1000245 3300025263 Bacteria 58278
202 Ga0209455_1001318 3300025272 Bacteria 11490
203 Ga0209673_1000754 3300025273 Bacteria 44111
204 Ga0209673_1018262 3300025273 Bacteria 2558
205 Ga0209675_1009092 3300025291 Bacteria 3547
206 Ga0209676_1008954 3300025292 Bacteria 4393
207 Ga0209025_1000477 3300025294 Bacteria 77692
208 Ga0209564_1002334 3300025295 Bacteria 15353
209 Ga0209758_1000002 3300025297 Bacteria 1400310
210 Ga0209758_1004137 3300025297 Bacteria 12378
211 Ga0209050_1000001 3300025298 Bacteria 3563507
212 Ga0209050_1000213 3300025298 Bacteria 129359
213 Ga0209050_1000832 3300025298 Bacteria 42754
214 Ga0209050_1003097 3300025298 Bacteria 12758
215 Ga0209256_1000008 3300025299 Bacteria 975723
216 Ga0209257_1000801 3300025304 Bacteria 45834
217 Ga0209257_1000929 3300025304 Bacteria 40568
218 Ga0209257_1003826 3300025304 Bacteria 12343
219 Ga0209257_1006679 3300025304 Bacteria 7307
220 Ga0209257_1008557 3300025304 Bacteria 5772
221 Ga0209257_1008562 3300025304 Bacteria 5769
222 Ga0207656_10021680 3300025321 Bacteria 2569
223 Ga0207713_1003906 3300025735 Bacteria 9920
224 Ga0207713_1056397 3300025735 Bacteria 1526
225 Ga0207688_10072601 3300025901 Bacteria 1955
226 Ga0207680_10000011 3300025903 Bacteria 391225
227 Ga0207680_10005356 3300025903 Bacteria 6126
228 Ga0207647_10003177 3300025904 Bacteria 12332
229 Ga0207647_10003965 3300025904 Bacteria 11046
230 Ga0207647_10009594 3300025904 Bacteria 6872
231 Ga0207647_10016833 3300025904 Bacteria 4981
232 Ga0207647_10020493 3300025904 Bacteria 4432
233 Ga0207645_10010551 3300025907 Bacteria 6343
234 Ga0207705_10000018 3300025909 Bacteria 319792
235 Ga0207705_10000506 3300025909 Bacteria 33121
236 Ga0207654_10000715 3300025911 Bacteria 18532
237 Ga0207654_10004862 3300025911 Bacteria 6798
238 Ga0207695_10010928 3300025913 Bacteria 11043
239 Ga0207695_10024173 3300025913 Bacteria 6844
240 Ga0207695_10076141 3300025913 Bacteria 3412
241 Ga0207671_10007573 3300025914 Bacteria 9402
242 Ga0207671_10015473 3300025914 Bacteria 5970
243 Ga0207671_10018554 3300025914 Bacteria 5332
244 Ga0207657_10002298 3300025919 Bacteria 20713
245 Ga0207657_10036297 3300025919 Bacteria 4412
246 Ga0207657_10036487 3300025919 Bacteria 4399
247 Ga0207657_10053765 3300025919 Bacteria 3487
248 Ga0207649_10000970 3300025920 Bacteria 17781
249 Ga0207681_10000013 3300025923 Bacteria 357411
250 Ga0207681_10000317 3300025923 Bacteria 34992
251 Ga0207681_10024831 3300025923 Bacteria 3848
252 Ga0207694_10019708 3300025924 Bacteria 5102
253 Ga0207694_10035225 3300025924 Bacteria 3839
254 Ga0207694_10048587 3300025924 Bacteria 3283
255 Ga0207694_10059145 3300025924 Bacteria 2981
256 Ga0207650_10000008 3300025925 Bacteria 498534
257 Ga0207650_10001203 3300025925 Bacteria 18998
258 Ga0207650_10003268 3300025925 Bacteria 11174
259 Ga0207650_10020065 3300025925 Bacteria 4708
260 Ga0207687_10002418 3300025927 Bacteria 12670
261 Ga0207644_10000170 3300025931 Bacteria 46372
262 Ga0207644_10035284 3300025931 Bacteria 3503
263 Ga0207690_10031930 3300025932 Bacteria 3375
264 Ga0207706_10015684 3300025933 Bacteria 6849
265 Ga0207706_10025370 3300025933 Bacteria 5311
266 Ga0207706_10083561 3300025933 Bacteria 2807
267 Ga0207706_10108349 3300025933 Bacteria 2445
268 Ga0207706_10226158 3300025933 Bacteria 1637
269 Ga0207686_10000298 3300025934 Bacteria 36166
270 Ga0207670_10007785 3300025936 Bacteria 6010
271 Ga0207704_10000006 3300025938 Bacteria 220005
272 Ga0207711_10000004 3300025941 Bacteria 870636
273 Ga0207711_10001674 3300025941 Bacteria 20413
274 Ga0207711_10010479 3300025941 Bacteria 7697
275 Ga0207711_10019612 3300025941 Bacteria 5629
276 Ga0207711_10048119 3300025941 Bacteria 3648
277 Ga0207689_10003627 3300025942 Bacteria 14110
278 Ga0207679_10124338 3300025945 Bacteria 2059
279 Ga0207679_10137872 3300025945 Bacteria 1967
280 Ga0207667_10000038 3300025949 Bacteria 280720
281 Ga0207667_10001287 3300025949 Bacteria 31458
282 Ga0207667_10122092 3300025949 Bacteria 2684
283 Ga0207667_10179773 3300025949 Bacteria 2173
284 Ga0207651_10000001 3300025960 Bacteria 516823
285 Ga0207712_10000002 3300025961 Bacteria 706628
286 Ga0207712_10000013 3300025961 Bacteria 391208
287 Ga0207712_10000324 3300025961 Bacteria 43682
288 Ga0207668_10000024 3300025972 Bacteria 131871
289 Ga0207668_10002140 3300025972 Bacteria 11517
290 Ga0207668_10028705 3300025972 Bacteria 3641
291 Ga0207640_10000041 3300025981 Bacteria 105374
292 Ga0207640_10000073 3300025981 Bacteria 79417
293 Ga0207640_10015739 3300025981 Bacteria 4384
294 Ga0207640_10041261 3300025981 Bacteria 2934
295 Ga0207658_10000002 3300025986 Bacteria 1364188
296 Ga0207658_10000064 3300025986 Bacteria 117779
297 Ga0207658_10000292 3300025986 Bacteria 52512
298 Ga0207658_10001699 3300025986 Bacteria 16724
299 Ga0207658_10001712 3300025986 Bacteria 16630
300 Ga0207658_10002033 3300025986 Bacteria 15102
301 Ga0207677_10000016 3300026023 Bacteria 153771
302 Ga0207703_10000108 3300026035 Bacteria 97908
303 Ga0207703_10000167 3300026035 Bacteria 76517
304 Ga0207703_10000783 3300026035 Bacteria 31275
305 Ga0207639_10000160 3300026041 Bacteria 51548
306 Ga0207639_10004484 3300026041 Bacteria 9421
307 Ga0207639_10023835 3300026041 Bacteria 4423
308 Ga0207639_10075596 3300026041 Bacteria 2649
309 Ga0207678_10000083 3300026067 Bacteria 77023
310 Ga0207678_10009886 3300026067 Bacteria 8374
311 Ga0207678_10032574 3300026067 Bacteria 4542
312 Ga0207702_10001634 3300026078 Bacteria 22165
313 Ga0207702_10003308 3300026078 Bacteria 14835
314 Ga0207702_10005977 3300026078 Bacteria 10568
315 Ga0207702_10022405 3300026078 Bacteria 5237
316 Ga0207641_10000010 3300026088 Bacteria 402193
317 Ga0207641_10000161 3300026088 Bacteria 94555
318 Ga0207641_10000438 3300026088 Bacteria 47782
319 Ga0207641_10001251 3300026088 Bacteria 25345
320 Ga0207641_10002032 3300026088 Bacteria 19271
321 Ga0207641_10025108 3300026088 Bacteria 4912
322 Ga0207648_10004651 3300026089 Bacteria 14047
323 Ga0207648_10145402 3300026089 Bacteria 2091
324 Ga0207676_10000012 3300026095 Bacteria 353971
325 Ga0207676_10000051 3300026095 Bacteria 132645
326 Ga0207676_10000420 3300026095 Bacteria 35827
327 Ga0207676_10000644 3300026095 Bacteria 27992
328 Ga0207676_10015522 3300026095 Bacteria 5496
329 Ga0207676_10179585 3300026095 Bacteria 1852
330 Ga0207674_10053641 3300026116 Bacteria 4108
331 Ga0207674_10058909 3300026116 Bacteria 3888
332 Ga0207674_10068174 3300026116 Bacteria 3580
333 Ga0207675_100000018 3300026118 Bacteria 124200
334 Ga0207675_100014381 3300026118 Bacteria 7378
335 Ga0207675_100018074 3300026118 Bacteria 6575
336 Ga0207683_10010812 3300026121 Bacteria 7782
337 Ga0207698_10000136 3300026142 Bacteria 46199
338 Ga0207698_10027113 3300026142 Bacteria 4063
339 Ga0209813_10000011 3300027866 Bacteria 93114
340 Ga0268266_10000025 3300028379 Bacteria 477143
341 Ga0268265_10000006 3300028380 Bacteria 466482
342 Ga0268265_10000026 3300028380 Bacteria 246653
343 Ga0268265_10000096 3300028380 Bacteria 111507
344 Ga0268265_10000141 3300028380 Bacteria 91426
345 Ga0268265_10000358 3300028380 Bacteria 49394
346 Ga0268264_10000001 3300028381 Bacteria 1221000
347 Ga0268264_10000037 3300028381 Bacteria 391116
348 Ga0268264_10000384 3300028381 Bacteria 63602
349 Ga0268264_10001004 3300028381 Bacteria 28632
350 Ga0268264_10009346 3300028381 Bacteria 8117
351 Ga0307517_10015754 3300028786 Bacteria 10013
352 Ga0314311_1063452 3300030733 Bacteria 1855
353 Ga0265316_10049456 3300031344 Bacteria 3312
354 Ga0307513_10025726 3300031456 Bacteria 6808
355 Ga0307408_100037622 3300031548 Bacteria 3409
356 Ga0307408_100123980 3300031548 Bacteria 2006
357 Ga0307508_10000011 3300031616 Bacteria 248001
358 Ga0307406_10017224 3300031901 Bacteria 4207
359 Ga0307412_10000104 3300031911 Bacteria 67823
360 Ga0307412_10001138 3300031911 Bacteria 15231
361 Ga0307412_10015645 3300031911 Bacteria 4503
362 Ga0307412_10027729 3300031911 Bacteria 3535
363 Ga0307412_10147697 3300031911 Bacteria 1730
364 Ga0307414_10003516 3300032004 Bacteria 8378
365 Ga0307414_10007522 3300032004 Bacteria 6122
366 Ga0373937_0176925 3300036401 Bacteria 2003
367 Ga0395901_0066379 3300038443 Bacteria 3758
368 Ga0439465_0007264 3300041413 Bacteria 3520
369 Ga0439465_0009798 3300041413 Bacteria 3018
370 Ga0451806_518594 3300041462 Bacteria 4047
371 Ga0451845_0922901 3300041501 Bacteria 1758
372 Ga0439431_0002529 3300041997 Bacteria 4041
373 Ga0439448_0004408 3300042005 Bacteria 3971
374 Ga0439432_004958 3300042006 Bacteria 4820
375 Ga0439462_0004482 3300042015 Bacteria 3411
376 Ga0439458_0003133 3300042157 Bacteria 3929
377 Ga0439458_0008020 3300042157 Bacteria 2348
378 Ga0439434_0002420 3300042435 Bacteria 5427
379 Ga0466971_0013106 3300044719 Bacteria 3635
380 Ga0466960_0020334 3300044901 Bacteria 2939
381 Ga0495617_007631 3300046452 Bacteria 3747
382 Ga0495627_000180 3300046453 Bacteria 71282
383 Ga0495627_001471 3300046453 Bacteria 13706
384 Ga0495638_0000207 3300046460 Bacteria 83805
385 Ga0495638_0018129 3300046460 Bacteria 4678
386 Ga0495584_0059119 3300046491 Bacteria 1928
387 Ga0495607_0052457 3300046501 Bacteria 2362
388 Ga0495583_0000059 3300046506 Bacteria 199575
389 Ga0495583_0024855 3300046506 Bacteria 3002
390 Ga0495606_0012315 3300046507 Bacteria 6876
391 Ga0495610_0000083 3300046512 Bacteria 112946
392 Ga0495610_0059999 3300046512 Bacteria 1813
393 Ga0495632_0000023 3300046519 Bacteria 180933
394 Ga0495637_0008154 3300046520 Bacteria 5154
395 Ga0495637_0009893 3300046520 Bacteria 4637
396 Ga0495643_0000038 3300046522 Bacteria 236010
397 Ga0495643_0047514 3300046522 Bacteria 2324
398 Ga0495648_0013848 3300046524 Bacteria 5941
399 Ga0495648_0014337 3300046524 Bacteria 5808
400 Ga0495648_0024937 3300046524 Bacteria 4059
401 Ga0495648_0043442 3300046524 Bacteria 2817
402 Ga0495663_0000059 3300046525 Bacteria 51157
403 Ga0495654_0064643 3300046530 Bacteria 1748
404 Ga0495633_0000686 3300046558 Bacteria 31020
405 Ga0495633_0005297 3300046558 Bacteria 7933
406 Ga0495668_0000002 3300046616 Bacteria 763179
407 Ga0495668_0019510 3300046616 Bacteria 3907
408 Ga0495625_0000445 3300046660 Bacteria 62062
409 Ga0495625_0036233 3300046660 Bacteria 3628
410 Ga0495661_0062139 3300046665 Bacteria 2214
411 Ga0495670_0000019 3300046691 Bacteria 114488
412 Ga0495671_0000027 3300046692 Bacteria 236011
413 Ga0495677_0001331 3300047445 Bacteria 9876
414 Ga0495673_0029082 3300047469 Bacteria 2611
415 Ga0495673_0031779 3300047469 Bacteria 2469
416 Ga0495681_0000015 3300047470 Bacteria 183538
417 Ga0495681_0049165 3300047470 Bacteria 1994
418 Ga0495686_0073379 3300047472 Bacteria 2102
419 Ga0496101_0023490 3300048904 Bacteria 4261
420 Ga0496102_0000010 3300048905 Bacteria 324617
421 Ga0496102_0007248 3300048905 Bacteria 9465
422 Ga0496103_0000029 3300048906 Bacteria 213326
423 Ga0496103_0005824 3300048906 Bacteria 7358
424 Ga0496103_0030062 3300048906 Bacteria 3304
425 Ga0496108_0045855 3300048911 Bacteria 3651
426 Ga0496115_0001589 3300048918 Bacteria 16294
427 Ga0496116_0000362 3300048919 Bacteria 70379
428 Ga0496117_0000037 3300048920 Bacteria 324960
429 Ga0496118_0000034 3300048921 Bacteria 322764
430 Ga0496118_0000946 3300048921 Bacteria 45410
431 Ga0496118_0062868 3300048921 Bacteria 2736
432 Ga0496119_0005688 3300048922 Bacteria 11824
433 Ga0496120_0008904 3300048923 Bacteria 7190
434 Ga0496121_0000413 3300048924 Bacteria 84919
435 Ga0496121_0003525 3300048924 Bacteria 22206
436 Ga0496121_0082182 3300048924 Bacteria 2548
437 Ga0496122_0000216 3300048925 Bacteria 128675
438 Ga0496122_0001548 3300048925 Bacteria 36461
439 Ga0496122_0016874 3300048925 Bacteria 6868
440 Ga0496123_0000854 3300048926 Bacteria 48613
441 Ga0496123_0028185 3300048926 Bacteria 4164
442 Ga0496123_0045556 3300048926 Bacteria 2986
443 Ga0496124_0000033 3300048927 Bacteria 330586
444 Ga0496124_0012465 3300048927 Bacteria 8390
445 Ga0496124_0026137 3300048927 Bacteria 5270
446 Ga0496124_0026990 3300048927 Bacteria 5167
447 Ga0496124_0182628 3300048927 Bacteria 1613
448 Ga0496125_0039331 3300048928 Bacteria 4075
449 Ga0496125_0045539 3300048928 Bacteria 3690
450 Ga0495678_010043 3300049459 Bacteria 4624
451 Ga0501290_000101 3300049513 Bacteria 12782
452 Ga0501292_000192 3300049515 Bacteria 9776
453 Ga0501294_000091 3300049517 Bacteria 10019
454 Ga0501033_0054180 3300049570 Bacteria 2968
455 Ga0501034_0000369 3300049571 Bacteria 76727
456 Ga0501034_0067826 3300049571 Bacteria 3579
457 Ga0501039_0038946 3300049575 Bacteria 3671
458 Ga0501040_0161251 3300049576 Bacteria 1585
459 Ga0501048_0046806 3300049582 Bacteria 3088
460 Ga0501077_0112189 3300049593 Bacteria 1728
461 Ga0501223_000018 3300049663 Bacteria 67853
462 Ga0501223_000298 3300049663 Bacteria 12520
463 Ga0501223_005356 3300049663 Bacteria 2697
464 Ga0501224_000002 3300049664 Bacteria 229331
465 Ga0501235_002547 3300049669 Bacteria 3922
466 Ga0501249_000075 3300049679 Bacteria 34091
467 Ga0501257_000125 3300049686 Bacteria 17740
468 Ga0501261_000300 3300049690 Bacteria 6796
469 Ga0501225_0000034 3300049705 Bacteria 46629
470 Ga0501225_0000045 3300049705 Bacteria 41541
471 Ga0501225_0007307 3300049705 Bacteria 3202
472 Ga0501225_0021431 3300049705 Bacteria 1785
473 Ga0501079_0084648 3300049741 Bacteria 2453
474 Ga0501081_0110367 3300049743 Bacteria 1951
475 Ga0501241_005799 3300049758 Bacteria 2292
476 Ga0501279_000162 3300049775 Bacteria 9407
477 Ga0501280_000112 3300049776 Bacteria 21155
478 Ga0501281_01131 3300049777 Bacteria 2140
479 Ga0501282_000193 3300049778 Bacteria 7510
480 Ga0501283_000953 3300049779 Bacteria 3833
481 Ga0501035_0021245 3300049822 Bacteria 5966
482 Ga0501044_0081224 3300049823 Bacteria 3282
483 Ga0501045_0111065 3300049824 Bacteria 2032
484 Ga0501226_000026 3300049853 Bacteria 91031
485 nmdc:mga06z11_33_c1 3300050494 Bacteria 56150
486 nmdc:mga04h51_63_c1 3300050495 Bacteria 33559
487 nmdc:mga07m45_89096_c1 3300050496 Bacteria 1766
488 Ga0500643_000256 3300053087 Bacteria 48356
489 Ga0500643_000595 3300053087 Bacteria 24760
490 Ga0500643_002703 3300053087 Bacteria 8911
491 Ga0500643_003042 3300053087 Bacteria 8276
492 Ga0500643_007570 3300053087 Bacteria 4357
493 Ga0500643_008728 3300053087 Bacteria 3953
494 Ga0500643_011968 3300053087 Bacteria 3130
495 Ga0500641_0002375 3300053096 Bacteria 6669
496 Ga0500641_0041325 3300053096 Bacteria 1865
497 Ga0500555_000265 3300053103 Bacteria 22896
498 Ga0500556_0000055 3300053104 Bacteria 115798
499 Ga0500592_000002 3300053116 Bacteria 141670
500 Ga0500597_000863 3300053120 Bacteria 6998
501 Ga0500614_002429 3300053123 Bacteria 4159
502 Ga0500642_0000008 3300053130 Bacteria 293258
503 Ga0500655_000013 3300053133 Bacteria 50102
504 Ga0500658_0001172 3300053134 Bacteria 10679
505 Ga0500658_0006256 3300053134 Bacteria 4426
506 Ga0500559_0005351 3300053136 Bacteria 5910
507 Ga0500559_0010299 3300053136 Bacteria 4019
508 Ga0500568_0008216 3300053139 Bacteria 5052
509 Ga0500573_0000036 3300053140 Bacteria 110394
510 Ga0500590_000021 3300053148 Bacteria 42640
511 Ga0500622_0026803 3300053156 Bacteria 3039
512 Ga0500624_000293 3300053157 Bacteria 17119
513 Ga0500627_0000006 3300053158 Bacteria 165989
514 Ga0500627_0000026 3300053158 Bacteria 100362
515 Ga0500637_0000834 3300053178 Bacteria 12318
516 Ga0500570_000778 3300053724 Bacteria 13319
517 Ga0500645_000379 3300053730 Bacteria 31290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10068174 Ga0207674_100681743 462
2 3300031548 Ga0307408_100123980 Ga0307408_1001239801 462
3 3300002076 JGI24749J21850_1000008 JGI24749J21850_100000839 467
4 3300002459 JGI24751J29686_10000474 JGI24751J29686_100004746 467
5 3300005331 Ga0070670_100000046 Ga0070670_10000004654 467
6 3300005347 Ga0070668_100005350 Ga0070668_1000053503 467
7 3300005353 Ga0070669_100000168 Ga0070669_10000016810 467
8 3300005367 Ga0070667_100000689 Ga0070667_10000068920 467
9 3300005617 Ga0068859_100009271 Ga0068859_1000092713 467
10 3300005618 Ga0068864_100000010 Ga0068864_10000001020 467
11 3300005844 Ga0068862_100000022 Ga0068862_100000022117 467
12 3300006931 Ga0097620_100009271 Ga0097620_1000092713 467
13 3300009177 Ga0105248_10000157 Ga0105248_1000015751 467
14 3300014325 Ga0163163_10039258 Ga0163163_100392583 467
15 3300014326 Ga0157380_10000191 Ga0157380_100001919 467
16 3300025923 Ga0207681_10000013 Ga0207681_100000139 467
17 3300025925 Ga0207650_10000008 Ga0207650_1000000888 467
18 3300025941 Ga0207711_10019612 Ga0207711_100196123 467
19 3300025986 Ga0207658_10002033 Ga0207658_100020332 467
20 3300026095 Ga0207676_10000012 Ga0207676_10000012311 467
21 3300026118 Ga0207675_100014381 Ga0207675_1000143813 467
22 3300028380 Ga0268265_10000006 Ga0268265_10000006113 467
23 3300049571 Ga0501034_0000369 Ga0501034_0000369_8653_10074 470
24 iso_pu_bacteria 2840878972 2840881905 470
25 iso_pu_bacteria 3000017691 3000020656 470
26 3300003214 JGI25165J46597_1000085 JGI25165J46597_100008565 471
27 3300003791 Ga0055530_10011596 Ga0055530_100115963 471
28 3300025231 Ga0207427_101689 Ga0207427_1016893 471
29 3300025261 Ga0209233_1000078 Ga0209233_1000078253 471
30 3300003215 JGI25153J46596_10003130 JGI25153J46596_100031301 472
31 3300003773 Ga0055537_1000707 Ga0055537_10007076 472
32 3300003775 Ga0055524_1000210 Ga0055524_10002103 472
33 3300003794 Ga0055531_10016151 Ga0055531_100161512 472
34 3300005262 Ga0065165_1011705 Ga0065165_10117054 472
35 3300005985 Ga0081539_10010593 Ga0081539_100105932 472
36 3300015690 Ga0183363_1010 Ga0183363_10104 472
37 3300025245 Ga0207425_1001852 Ga0207425_10018523 472
38 3300025263 Ga0209565_1000029 Ga0209565_100002967 472
39 3300025273 Ga0209673_1000754 Ga0209673_10007546 472
40 3300025291 Ga0209675_1009092 Ga0209675_10090923 472
41 3300025297 Ga0209758_1004137 Ga0209758_10041379 472
42 3300025298 Ga0209050_1003097 Ga0209050_10030976 472
43 3300025299 Ga0209256_1000008 Ga0209256_1000008676 472
44 3300025304 Ga0209257_1000801 Ga0209257_10008019 472
45 3300025304 Ga0209257_1006679 Ga0209257_10066797 472
46 3300026041 Ga0207639_10023835 Ga0207639_100238353 472
47 3300049758 Ga0501241_005799 Ga0501241_005799_243_1661 472
48 3300053087 Ga0500643_011968 Ga0500643_011968_692_2137 472
49 3300053134 Ga0500658_0006256 Ga0500658_0006256_1531_2976 472
50 3300053139 Ga0500568_0008216 Ga0500568_0008216_2194_3639 472
51 iso_pu_bacteria 2830075706 2830075881 472
52 3300005331 Ga0070670_100001867 Ga0070670_1000018679 473
53 3300005347 Ga0070668_100000031 Ga0070668_10000003114 473
54 3300005355 Ga0070671_100000265 Ga0070671_10000026523 473
55 3300005367 Ga0070667_100000004 Ga0070667_10000000414 473
56 3300005577 Ga0068857_100196726 Ga0068857_1001967262 473
57 3300005617 Ga0068859_100052021 Ga0068859_1000520211 473
58 3300005618 Ga0068864_100003396 Ga0068864_1000033964 473
59 3300005841 Ga0068863_100034191 Ga0068863_1000341914 473
60 3300005841 Ga0068863_100064443 Ga0068863_1000644432 473
61 3300005842 Ga0068858_100008931 Ga0068858_1000089314 473
62 3300005843 Ga0068860_100002695 Ga0068860_10000269514 473
63 3300005844 Ga0068862_100010697 Ga0068862_1000106974 473
64 3300006931 Ga0097620_100052021 Ga0097620_1000520213 473
65 3300025925 Ga0207650_10003268 Ga0207650_100032684 473
66 3300025931 Ga0207644_10000170 Ga0207644_1000017035 473
67 3300025972 Ga0207668_10000024 Ga0207668_1000002414 473
68 3300025986 Ga0207658_10000002 Ga0207658_10000002307 473
69 3300026035 Ga0207703_10000783 Ga0207703_1000078311 473
70 3300026088 Ga0207641_10025108 Ga0207641_100251083 473
71 3300026095 Ga0207676_10015522 Ga0207676_100155224 473
72 3300028380 Ga0268265_10000358 Ga0268265_1000035814 473
73 3300028381 Ga0268264_10000001 Ga0268264_10000001632 473
74 3300031344 Ga0265316_10049456 Ga0265316_100494562 473
75 3300031911 Ga0307412_10000104 Ga0307412_1000010436 473
76 3300031911 Ga0307412_10015645 Ga0307412_100156453 473
77 3300032004 Ga0307414_10003516 Ga0307414_100035163 473
78 3300032004 Ga0307414_10007522 Ga0307414_100075223 473
79 3300046524 Ga0495648_0024937 Ga0495648_0024937_1361_2809 473
80 3300046616 Ga0495668_0000002 Ga0495668_0000002_255241_256683 473
81 3300048923 Ga0496120_0008904 Ga0496120_0008904_4128_5582 473
82 3300048927 Ga0496124_0012465 Ga0496124_0012465_4770_6224 473
83 3300049570 Ga0501033_0054180 Ga0501033_0054180_1279_2721 473
84 3300049575 Ga0501039_0038946 Ga0501039_0038946_447_1889 473
85 3300049576 Ga0501040_0161251 Ga0501040_0161251_61_1500 473
86 3300049582 Ga0501048_0046806 Ga0501048_0046806_609_2051 473
87 3300049593 Ga0501077_0112189 Ga0501077_0112189_126_1565 473
88 3300049741 Ga0501079_0084648 Ga0501079_0084648_183_1622 473
89 3300049743 Ga0501081_0110367 Ga0501081_0110367_392_1831 473
90 3300049822 Ga0501035_0021245 Ga0501035_0021245_493_1935 473
91 3300049824 Ga0501045_0111065 Ga0501045_0111065_63_1502 473
92 3300053158 Ga0500627_0000006 Ga0500627_0000006_99670_101112 473
93 iso_pu_bacteria 2852680915 2852683707 473
94 iso_pu_bacteria 2885429604 2885432143 473
95 3300001976 JGI24752J21851_1000925 JGI24752J21851_10009253 474
96 3300001990 JGI24737J22298_10005013 JGI24737J22298_100050133 474
97 3300002774 JGI25150J39212_1000067 JGI25150J39212_100006766 474
98 3300003215 JGI25153J46596_10000073 JGI25153J46596_1000007351 474
99 3300003771 Ga0055526_1003015 Ga0055526_10030154 474
100 3300003773 Ga0055537_1002484 Ga0055537_10024844 474
101 3300003792 Ga0055540_1002562 Ga0055540_10025623 474
102 3300005289 Ga0065704_10077651 Ga0065704_100776513 474
103 3300005327 Ga0070658_10004519 Ga0070658_100045193 474
104 3300005331 Ga0070670_100000572 Ga0070670_10000057221 474
105 3300005339 Ga0070660_100010606 Ga0070660_1000106063 474
106 3300005367 Ga0070667_100000134 Ga0070667_1000001343 474
107 3300005563 Ga0068855_100000007 Ga0068855_100000007115 474
108 3300005563 Ga0068855_100058385 Ga0068855_1000583853 474
109 3300005578 Ga0068854_100019544 Ga0068854_1000195444 474
110 3300005617 Ga0068859_100000918 Ga0068859_10000091828 474
111 3300005618 Ga0068864_100000089 Ga0068864_10000008992 474
112 3300005719 Ga0068861_100000201 Ga0068861_10000020127 474
113 3300005834 Ga0068851_10033029 Ga0068851_100330292 474
114 3300005841 Ga0068863_100000084 Ga0068863_10000008492 474
115 3300005844 Ga0068862_100000112 Ga0068862_1000001128 474
116 3300006237 Ga0097621_100043692 Ga0097621_1000436923 474
117 3300006931 Ga0097620_100000918 Ga0097620_10000091828 474
118 3300009011 Ga0105251_10001379 Ga0105251_1000137914 474
119 3300009177 Ga0105248_10000012 Ga0105248_10000012240 474
120 3300009177 Ga0105248_10004497 Ga0105248_100044979 474
121 3300009553 Ga0105249_10000257 Ga0105249_100002578 474
122 3300010375 Ga0105239_10060427 Ga0105239_100604273 474
123 3300013296 Ga0157374_10054073 Ga0157374_100540733 474
124 3300014968 Ga0157379_10025729 Ga0157379_100257293 474
125 3300025245 Ga0207425_1000005 Ga0207425_1000005769 474
126 3300025254 Ga0209148_1000332 Ga0209148_100033245 474
127 3300025254 Ga0209148_1002364 Ga0209148_10023644 474
128 3300025258 Ga0209129_1002371 Ga0209129_10023715 474
129 3300025263 Ga0209565_1000245 Ga0209565_100024554 474
130 3300025272 Ga0209455_1001318 Ga0209455_10013185 474
131 3300025273 Ga0209673_1018262 Ga0209673_10182622 474
132 3300025292 Ga0209676_1008954 Ga0209676_10089542 474
133 3300025294 Ga0209025_1000477 Ga0209025_100047754 474
134 3300025295 Ga0209564_1002334 Ga0209564_10023344 474
135 3300025297 Ga0209758_1000002 Ga0209758_1000002576 474
136 3300025298 Ga0209050_1000001 Ga0209050_1000001525 474
137 3300025298 Ga0209050_1000213 Ga0209050_1000213107 474
138 3300025304 Ga0209257_1003826 Ga0209257_10038269 474
139 3300025304 Ga0209257_1008557 Ga0209257_10085574 474
140 3300025304 Ga0209257_1008562 Ga0209257_10085624 474
141 3300025735 Ga0207713_1003906 Ga0207713_10039063 474
142 3300025904 Ga0207647_10020493 Ga0207647_100204933 474
143 3300025909 Ga0207705_10000018 Ga0207705_1000001867 474
144 3300025913 Ga0207695_10076141 Ga0207695_100761413 474
145 3300025919 Ga0207657_10053765 Ga0207657_100537652 474
146 3300025925 Ga0207650_10001203 Ga0207650_1000120312 474
147 3300025941 Ga0207711_10000004 Ga0207711_10000004748 474
148 3300025941 Ga0207711_10001674 Ga0207711_100016744 474
149 3300025949 Ga0207667_10000038 Ga0207667_10000038113 474
150 3300025961 Ga0207712_10000324 Ga0207712_100003248 474
151 3300025981 Ga0207640_10000073 Ga0207640_100000732 474
152 3300025986 Ga0207658_10001712 Ga0207658_1000171214 474
153 3300026067 Ga0207678_10009886 Ga0207678_100098863 474
154 3300026088 Ga0207641_10000010 Ga0207641_10000010393 474
155 3300026095 Ga0207676_10000051 Ga0207676_100000518 474
156 3300026118 Ga0207675_100000018 Ga0207675_100000018101 474
157 3300028380 Ga0268265_10000026 Ga0268265_100000268 474
158 3300030733 Ga0314311_1063452 Ga0314311_10634522 474
159 3300036401 Ga0373937_0176925 Ga0373937_0176925_68_1522 474
160 3300041413 Ga0439465_0009798 Ga0439465_0009798_1183_2622 474
161 3300041997 Ga0439431_0002529 Ga0439431_0002529_2378_3817 474
162 3300042006 Ga0439432_004958 Ga0439432_004958_2105_3544 474
163 3300042015 Ga0439462_0004482 Ga0439462_0004482_679_2118 474
164 3300042435 Ga0439434_0002420 Ga0439434_0002420_2778_4217 474
165 3300048904 Ga0496101_0023490 Ga0496101_0023490_371_1822 474
166 3300048906 Ga0496103_0030062 Ga0496103_0030062_393_1844 474
167 3300048918 Ga0496115_0001589 Ga0496115_0001589_13136_14572 474
168 3300048921 Ga0496118_0000946 Ga0496118_0000946_12338_13789 474
169 3300048925 Ga0496122_0001548 Ga0496122_0001548_29876_31318 474
170 3300053096 Ga0500641_0041325 Ga0500641_0041325_246_1670 474
171 3300053123 Ga0500614_002429 Ga0500614_002429_1213_2637 474
172 3300053133 Ga0500655_000013 Ga0500655_000013_45368_46792 474
173 3300053148 Ga0500590_000021 Ga0500590_000021_38117_39541 474
174 3300053156 Ga0500622_0026803 Ga0500622_0026803_891_2315 474
175 3300053724 Ga0500570_000778 Ga0500570_000778_11295_12719 474
176 iso_pu_bacteria 2582581305 2585262872 474
177 iso_pu_bacteria 2879163058 2879163932 474
178 iso_pu_bacteria 8054002106 8054006500 474
179 iso_pu_bacteria 8057101203 8057105176 474
180 3300001990 JGI24737J22298_10004180 JGI24737J22298_100041804 475
181 3300001990 JGI24737J22298_10005022 JGI24737J22298_100050223 475
182 3300002075 JGI24738J21930_10002787 JGI24738J21930_100027873 475
183 3300003791 Ga0055530_10006489 Ga0055530_100064895 475
184 3300003791 Ga0055530_10006817 Ga0055530_100068173 475
185 3300003794 Ga0055531_10009474 Ga0055531_100094743 475
186 3300005262 Ga0065165_1000213 Ga0065165_100021391 475
187 3300005262 Ga0065165_1008955 Ga0065165_10089553 475
188 3300005262 Ga0065165_1030070 Ga0065165_10300701 475
189 3300005327 Ga0070658_10000798 Ga0070658_100007985 475
190 3300005328 Ga0070676_10005454 Ga0070676_100054545 475
191 3300005334 Ga0068869_100000194 Ga0068869_10000019418 475
192 3300005338 Ga0068868_100001008 Ga0068868_10000100811 475
193 3300005339 Ga0070660_100017282 Ga0070660_1000172823 475
194 3300005339 Ga0070660_100026594 Ga0070660_1000265943 475
195 3300005344 Ga0070661_100000462 Ga0070661_10000046222 475
196 3300005356 Ga0070674_100108008 Ga0070674_1001080082 475
197 3300005364 Ga0070673_100000001 Ga0070673_100000001243 475
198 3300005457 Ga0070662_100018051 Ga0070662_1000180513 475
199 3300005457 Ga0070662_100047482 Ga0070662_1000474823 475
200 3300005459 Ga0068867_100002256 Ga0068867_1000022568 475
201 3300005459 Ga0068867_100095823 Ga0068867_1000958232 475
202 3300005530 Ga0070679_100105238 Ga0070679_1001052383 475
203 3300005563 Ga0068855_100222858 Ga0068855_1002228582 475
204 3300005577 Ga0068857_100047160 Ga0068857_1000471603 475
205 3300005578 Ga0068854_100052281 Ga0068854_1000522813 475
206 3300005616 Ga0068852_100014356 Ga0068852_1000143563 475
207 3300005618 Ga0068864_100000367 Ga0068864_10000036722 475
208 3300005842 Ga0068858_100000309 Ga0068858_10000030932 475
209 3300005842 Ga0068858_100020523 Ga0068858_1000205234 475
210 3300006881 Ga0068865_100000047 Ga0068865_10000004723 475
211 3300009098 Ga0105245_10000078 Ga0105245_1000007865 475
212 3300009098 Ga0105245_10001539 Ga0105245_1000153910 475
213 3300009148 Ga0105243_10001427 Ga0105243_100014276 475
214 3300009176 Ga0105242_10002235 Ga0105242_100022359 475
215 3300009177 Ga0105248_10019164 Ga0105248_100191642 475
216 3300009551 Ga0105238_10055600 Ga0105238_100556002 475
217 3300009551 Ga0105238_10058121 Ga0105238_100581213 475
218 3300012513 Ga0157326_1000981 Ga0157326_10009813 475
219 3300013296 Ga0157374_10079600 Ga0157374_100796002 475
220 3300013297 Ga0157378_10026422 Ga0157378_100264223 475
221 3300013306 Ga0163162_10114305 Ga0163162_101143052 475
222 3300013308 Ga0157375_10002551 Ga0157375_100025513 475
223 3300014969 Ga0157376_10000071 Ga0157376_100000712 475
224 3300025226 Ga0209674_102742 Ga0209674_1027423 475
225 3300025261 Ga0209233_1000044 Ga0209233_100004439 475
226 3300025298 Ga0209050_1000832 Ga0209050_10008325 475
227 3300025304 Ga0209257_1000929 Ga0209257_10009295 475
228 3300025901 Ga0207688_10072601 Ga0207688_100726012 475
229 3300025904 Ga0207647_10003177 Ga0207647_100031773 475
230 3300025904 Ga0207647_10016833 Ga0207647_100168334 475
231 3300025907 Ga0207645_10010551 Ga0207645_100105513 475
232 3300025909 Ga0207705_10000506 Ga0207705_1000050626 475
233 3300025911 Ga0207654_10000715 Ga0207654_100007153 475
234 3300025914 Ga0207671_10015473 Ga0207671_100154736 475
235 3300025919 Ga0207657_10036297 Ga0207657_100362973 475
236 3300025920 Ga0207649_10000970 Ga0207649_100009707 475
237 3300025924 Ga0207694_10019708 Ga0207694_100197083 475
238 3300025924 Ga0207694_10035225 Ga0207694_100352253 475
239 3300025924 Ga0207694_10048587 Ga0207694_100485873 475
240 3300025927 Ga0207687_10002418 Ga0207687_1000241810 475
241 3300025931 Ga0207644_10035284 Ga0207644_100352843 475
242 3300025932 Ga0207690_10031930 Ga0207690_100319303 475
243 3300025933 Ga0207706_10015684 Ga0207706_100156843 475
244 3300025933 Ga0207706_10083561 Ga0207706_100835613 475
245 3300025934 Ga0207686_10000298 Ga0207686_1000029824 475
246 3300025938 Ga0207704_10000006 Ga0207704_1000000642 475
247 3300025941 Ga0207711_10010479 Ga0207711_100104792 475
248 3300025942 Ga0207689_10003627 Ga0207689_100036271 475
249 3300025949 Ga0207667_10179773 Ga0207667_101797732 475
250 3300025960 Ga0207651_10000001 Ga0207651_10000001231 475
251 3300025981 Ga0207640_10000041 Ga0207640_100000413 475
252 3300025981 Ga0207640_10041261 Ga0207640_100412611 475
253 3300026023 Ga0207677_10000016 Ga0207677_1000001652 475
254 3300026035 Ga0207703_10000108 Ga0207703_1000010875 475
255 3300026035 Ga0207703_10000167 Ga0207703_1000016727 475
256 3300026041 Ga0207639_10004484 Ga0207639_100044847 475
257 3300026078 Ga0207702_10001634 Ga0207702_100016343 475
258 3300026089 Ga0207648_10004651 Ga0207648_100046519 475
259 3300026089 Ga0207648_10145402 Ga0207648_101454021 475
260 3300026095 Ga0207676_10000420 Ga0207676_1000042014 475
261 3300026116 Ga0207674_10053641 Ga0207674_100536413 475
262 3300026121 Ga0207683_10010812 Ga0207683_100108124 475
263 3300026142 Ga0207698_10000136 Ga0207698_1000013624 475
264 3300028786 Ga0307517_10015754 Ga0307517_100157542 475
265 3300031456 Ga0307513_10025726 Ga0307513_100257263 475
266 3300031548 Ga0307408_100037622 Ga0307408_1000376222 475
267 3300031616 Ga0307508_10000011 Ga0307508_10000011197 475
268 3300031911 Ga0307412_10147697 Ga0307412_101476972 475
269 3300041413 Ga0439465_0007264 Ga0439465_0007264_1382_2821 475
270 3300041462 Ga0451806_518594 Ga0451806_518594_1312_2739 475
271 3300041501 Ga0451845_0922901 Ga0451845_0922901_177_1604 475
272 3300042005 Ga0439448_0004408 Ga0439448_0004408_784_2211 475
273 3300042157 Ga0439458_0003133 Ga0439458_0003133_1169_2629 475
274 3300044719 Ga0466971_0013106 Ga0466971_0013106_1158_2585 475
275 3300044901 Ga0466960_0020334 Ga0466960_0020334_680_2107 475
276 3300046460 Ga0495638_0000207 Ga0495638_0000207_80955_82397 475
277 3300046460 Ga0495638_0018129 Ga0495638_0018129_1022_2455 475
278 3300046501 Ga0495607_0052457 Ga0495607_0052457_575_2002 475
279 3300046506 Ga0495583_0000059 Ga0495583_0000059_194643_196076 475
280 3300046506 Ga0495583_0024855 Ga0495583_0024855_830_2272 475
281 3300046507 Ga0495606_0012315 Ga0495606_0012315_3368_4801 475
282 3300046524 Ga0495648_0043442 Ga0495648_0043442_1303_2745 475
283 3300046660 Ga0495625_0000445 Ga0495625_0000445_57791_59233 475
284 3300046660 Ga0495625_0036233 Ga0495625_0036233_2152_3594 475
285 3300046691 Ga0495670_0000019 Ga0495670_0000019_3965_5419 475
286 3300047445 Ga0495677_0001331 Ga0495677_0001331_6999_8441 475
287 3300047469 Ga0495673_0029082 Ga0495673_0029082_1042_2484 475
288 3300048921 Ga0496118_0062868 Ga0496118_0062868_1080_2507 475
289 3300048924 Ga0496121_0000413 Ga0496121_0000413_79582_81039 475
290 3300048924 Ga0496121_0082182 Ga0496121_0082182_1036_2478 475
291 3300048925 Ga0496122_0016874 Ga0496122_0016874_1525_2961 475
292 3300048926 Ga0496123_0028185 Ga0496123_0028185_985_2421 475
293 3300048926 Ga0496123_0045556 Ga0496123_0045556_696_2156 475
294 3300048927 Ga0496124_0026137 Ga0496124_0026137_913_2373 475
295 3300048927 Ga0496124_0026990 Ga0496124_0026990_1304_2764 475
296 3300049679 Ga0501249_000075 Ga0501249_000075_31708_33162 475
297 3300049686 Ga0501257_000125 Ga0501257_000125_12149_13594 475
298 3300050496 nmdc:mga07m45_89096_c1 nmdc:mga07m45_89096_c1_131_1573 475
299 3300053087 Ga0500643_008728 Ga0500643_008728_905_2347 475
300 3300053096 Ga0500641_0002375 Ga0500641_0002375_5101_6543 475
301 3300053103 Ga0500555_000265 Ga0500555_000265_1069_2502 475
302 3300053120 Ga0500597_000863 Ga0500597_000863_2348_3790 475
303 3300053134 Ga0500658_0001172 Ga0500658_0001172_5845_7287 475
304 3300053136 Ga0500559_0005351 Ga0500559_0005351_2166_3608 475
305 3300053140 Ga0500573_0000036 Ga0500573_0000036_3813_5255 475
306 3300053157 Ga0500624_000293 Ga0500624_000293_3237_4679 475
307 3300053178 Ga0500637_0000834 Ga0500637_0000834_3032_4474 475
308 iso_pu_bacteria 2511231221 2512034632 475
309 iso_pu_bacteria 2597490356 2599102279 475
310 iso_pu_bacteria 2599185354 2600202151 475
311 iso_pu_bacteria 2599185359 2600228387 475
312 iso_pu_bacteria 2643221605 2644036938 475
313 iso_pu_bacteria 2751185897 2753766377 475
314 iso_pu_bacteria 2818991466 2819715182 475
315 iso_pu_bacteria 2846952575 2846956942 475
316 iso_pu_bacteria 2848858292 2848861448 475
317 iso_pu_bacteria 2928526807 2928528077 475
318 iso_pu_bacteria 2928968154 2928971416 475
319 iso_pu_bacteria 2946787523 2946790036 475
320 iso_pu_bacteria 2990265787 2990268186 475
321 iso_pu_bacteria 2993693658 2993696789 475
322 3300001989 JGI24739J22299_10008274 JGI24739J22299_100082742 476
323 3300005614 Ga0068856_100035094 Ga0068856_1000350942 476
324 3300013105 Ga0157369_10034738 Ga0157369_100347382 476
325 3300013307 Ga0157372_10056429 Ga0157372_100564293 476
326 3300025250 Ga0209026_1001212 Ga0209026_100121212 476
327 3300025933 Ga0207706_10108349 Ga0207706_101083492 476
328 3300026078 Ga0207702_10022405 Ga0207702_100224053 476
329 3300042157 Ga0439458_0008020 Ga0439458_0008020_362_1828 476
330 3300046452 Ga0495617_007631 Ga0495617_007631_1895_3379 476
331 3300046453 Ga0495627_001471 Ga0495627_001471_5453_6937 476
332 3300046491 Ga0495584_0059119 Ga0495584_0059119_372_1817 476
333 3300046512 Ga0495610_0000083 Ga0495610_0000083_97374_98858 476
334 3300046512 Ga0495610_0059999 Ga0495610_0059999_234_1679 476
335 3300046519 Ga0495632_0000023 Ga0495632_0000023_153656_155101 476
336 3300046520 Ga0495637_0008154 Ga0495637_0008154_2152_3597 476
337 3300046520 Ga0495637_0009893 Ga0495637_0009893_2273_3757 476
338 3300046522 Ga0495643_0000038 Ga0495643_0000038_100742_102187 476
339 3300046522 Ga0495643_0047514 Ga0495643_0047514_73_1518 476
340 3300046524 Ga0495648_0013848 Ga0495648_0013848_3241_4686 476
341 3300046525 Ga0495663_0000059 Ga0495663_0000059_25833_27278 476
342 3300046558 Ga0495633_0000686 Ga0495633_0000686_25807_27252 476
343 3300046558 Ga0495633_0005297 Ga0495633_0005297_2681_4126 476
344 3300046665 Ga0495661_0062139 Ga0495661_0062139_376_1860 476
345 3300046692 Ga0495671_0000027 Ga0495671_0000027_133825_135270 476
346 3300047470 Ga0495681_0000015 Ga0495681_0000015_181286_182770 476
347 3300047470 Ga0495681_0049165 Ga0495681_0049165_299_1744 476
348 3300047472 Ga0495686_0073379 Ga0495686_0073379_524_2008 476
349 3300048925 Ga0496122_0000216 Ga0496122_0000216_116265_117710 476
350 3300048926 Ga0496123_0000854 Ga0496123_0000854_3640_5085 476
351 3300048928 Ga0496125_0039331 Ga0496125_0039331_1313_2758 476
352 3300049459 Ga0495678_010043 Ga0495678_010043_2593_4110 476
353 3300049513 Ga0501290_000101 Ga0501290_000101_2000_3433 476
354 3300049515 Ga0501292_000192 Ga0501292_000192_5078_6511 476
355 3300049663 Ga0501223_005356 Ga0501223_005356_981_2414 476
356 3300049690 Ga0501261_000300 Ga0501261_000300_2074_3507 476
357 3300049705 Ga0501225_0021431 Ga0501225_0021431_257_1705 476
358 3300049775 Ga0501279_000162 Ga0501279_000162_5158_6591 476
359 3300049776 Ga0501280_000112 Ga0501280_000112_16623_18056 476
360 3300049777 Ga0501281_01131 Ga0501281_01131_644_2092 476
361 3300053087 Ga0500643_000595 Ga0500643_000595_22286_23731 476
362 3300053087 Ga0500643_007570 Ga0500643_007570_787_2232 476
363 3300053104 Ga0500556_0000055 Ga0500556_0000055_3462_4907 476
364 3300053130 Ga0500642_0000008 Ga0500642_0000008_204676_206121 476
365 3300053730 Ga0500645_000379 Ga0500645_000379_11533_12978 476
366 3300009177 Ga0105248_10014579 Ga0105248_100145793 477
367 3300025941 Ga0207711_10048119 Ga0207711_100481192 477
368 3300038443 Ga0395901_0066379 Ga0395901_0066379_2075_3529 477
369 3300048905 Ga0496102_0000010 Ga0496102_0000010_136808_138274 477
370 3300048906 Ga0496103_0000029 Ga0496103_0000029_25517_26983 477
371 3300048919 Ga0496116_0000362 Ga0496116_0000362_65376_66842 477
372 3300048920 Ga0496117_0000037 Ga0496117_0000037_137410_138876 477
373 3300048921 Ga0496118_0000034 Ga0496118_0000034_135214_136680 477
374 3300048922 Ga0496119_0005688 Ga0496119_0005688_697_2163 477
375 3300048927 Ga0496124_0000033 Ga0496124_0000033_135214_136680 477
376 3300048928 Ga0496125_0045539 Ga0496125_0045539_812_2245 477
377 3300053087 Ga0500643_000256 Ga0500643_000256_43936_45387 477
378 3300053116 Ga0500592_000002 Ga0500592_000002_139668_141119 477
379 3300053158 Ga0500627_0000026 Ga0500627_0000026_518_1969 477
380 2162886007 SwRhRL2b_contig_3720739 SwRhRL2b_0915.00004080 478
381 3300001915 JGI24741J21665_1000381 JGI24741J21665_10003812 478
382 3300001976 JGI24752J21851_1000119 JGI24752J21851_10001195 478
383 3300001979 JGI24740J21852_10001832 JGI24740J21852_100018324 478
384 3300001979 JGI24740J21852_10022222 JGI24740J21852_100222222 478
385 3300001989 JGI24739J22299_10003832 JGI24739J22299_100038323 478
386 3300001989 JGI24739J22299_10004559 JGI24739J22299_100045592 478
387 3300001990 JGI24737J22298_10002081 JGI24737J22298_100020812 478
388 3300001990 JGI24737J22298_10006317 JGI24737J22298_100063173 478
389 3300002067 JGI24735J21928_10000609 JGI24735J21928_1000060915 478
390 3300002070 JGI24750J21931_1000002 JGI24750J21931_100000216 478
391 3300002074 JGI24748J21848_1000043 JGI24748J21848_100004350 478
392 3300002075 JGI24738J21930_10000306 JGI24738J21930_100003068 478
393 3300002239 JGI24034J26672_10000031 JGI24034J26672_1000003154 478
394 3300002244 JGI24742J22300_10001114 JGI24742J22300_100011143 478
395 3300005289 Ga0065704_10091194 Ga0065704_100911941 478
396 3300005329 Ga0070683_100123444 Ga0070683_1001234442 478
397 3300005330 Ga0070690_100000010 Ga0070690_10000001050 478
398 3300005331 Ga0070670_100014275 Ga0070670_1000142751 478
399 3300005335 Ga0070666_10000006 Ga0070666_10000006286 478
400 3300005340 Ga0070689_100017083 Ga0070689_1000170836 478
401 3300005344 Ga0070661_100036666 Ga0070661_1000366662 478
402 3300005344 Ga0070661_100086686 Ga0070661_1000866862 478
403 3300005347 Ga0070668_100003546 Ga0070668_1000035463 478
404 3300005347 Ga0070668_100048322 Ga0070668_1000483223 478
405 3300005347 Ga0070668_100103905 Ga0070668_1001039051 478
406 3300005353 Ga0070669_100002641 Ga0070669_1000026417 478
407 3300005353 Ga0070669_100010502 Ga0070669_1000105022 478
408 3300005365 Ga0070688_100004394 Ga0070688_1000043944 478
409 3300005367 Ga0070667_100000088 Ga0070667_1000000885 478
410 3300005367 Ga0070667_100000690 Ga0070667_1000006904 478
411 3300005367 Ga0070667_100008948 Ga0070667_1000089483 478
412 3300005455 Ga0070663_100004538 Ga0070663_1000045384 478
413 3300005455 Ga0070663_100060573 Ga0070663_1000605732 478
414 3300005457 Ga0070662_100017540 Ga0070662_1000175401 478
415 3300005466 Ga0070685_10000346 Ga0070685_100003467 478
416 3300005466 Ga0070685_10054974 Ga0070685_100549742 478
417 3300005535 Ga0070684_100134082 Ga0070684_1001340822 478
418 3300005539 Ga0068853_100008157 Ga0068853_1000081574 478
419 3300005544 Ga0070686_100000042 Ga0070686_10000004250 478
420 3300005548 Ga0070665_100000019 Ga0070665_10000001949 478
421 3300005563 Ga0068855_100007391 Ga0068855_1000073918 478
422 3300005614 Ga0068856_100026365 Ga0068856_1000263653 478
423 3300005617 Ga0068859_100061749 Ga0068859_1000617492 478
424 3300005618 Ga0068864_100028067 Ga0068864_1000280673 478
425 3300005618 Ga0068864_100074152 Ga0068864_1000741522 478
426 3300005719 Ga0068861_100002151 Ga0068861_1000021519 478
427 3300005834 Ga0068851_10036899 Ga0068851_100368992 478
428 3300005841 Ga0068863_100000113 Ga0068863_10000011314 478
429 3300005841 Ga0068863_100000379 Ga0068863_10000037919 478
430 3300005841 Ga0068863_100023030 Ga0068863_1000230303 478
431 3300005842 Ga0068858_100001212 Ga0068858_10000121211 478
432 3300005843 Ga0068860_100000014 Ga0068860_100000014286 478
433 3300005843 Ga0068860_100000220 Ga0068860_10000022089 478
434 3300005843 Ga0068860_100013501 Ga0068860_1000135014 478
435 3300005843 Ga0068860_100027898 Ga0068860_1000278982 478
436 3300005844 Ga0068862_100000220 Ga0068862_10000022025 478
437 3300005844 Ga0068862_100000287 Ga0068862_10000028733 478
438 3300005937 Ga0081455_10000220 Ga0081455_100002209 478
439 3300006048 Ga0075363_100051287 Ga0075363_1000512872 478
440 3300006931 Ga0097620_100061750 Ga0097620_1000617502 478
441 3300009174 Ga0105241_10014592 Ga0105241_100145923 478
442 3300009177 Ga0105248_10032098 Ga0105248_100320984 478
443 3300009553 Ga0105249_10000035 Ga0105249_1000003546 478
444 3300009553 Ga0105249_10000065 Ga0105249_10000065135 478
445 3300009978 Ga0105148_100009 Ga0105148_10000910 478
446 3300013100 Ga0157373_10075851 Ga0157373_100758512 478
447 3300013104 Ga0157370_10010012 Ga0157370_100100125 478
448 3300013105 Ga0157369_10069319 Ga0157369_100693191 478
449 3300013307 Ga0157372_10057969 Ga0157372_100579692 478
450 3300014325 Ga0163163_10024114 Ga0163163_100241142 478
451 3300014326 Ga0157380_10000303 Ga0157380_1000030315 478
452 3300014326 Ga0157380_10004669 Ga0157380_100046694 478
453 3300014326 Ga0157380_10009498 Ga0157380_100094983 478
454 3300014968 Ga0157379_10020631 Ga0157379_100206314 478
455 3300025321 Ga0207656_10021680 Ga0207656_100216802 478
456 3300025735 Ga0207713_1056397 Ga0207713_10563971 478
457 3300025903 Ga0207680_10000011 Ga0207680_10000011283 478
458 3300025903 Ga0207680_10005356 Ga0207680_100053562 478
459 3300025904 Ga0207647_10003965 Ga0207647_100039655 478
460 3300025904 Ga0207647_10009594 Ga0207647_100095941 478
461 3300025911 Ga0207654_10004862 Ga0207654_100048621 478
462 3300025913 Ga0207695_10010928 Ga0207695_100109284 478
463 3300025913 Ga0207695_10024173 Ga0207695_100241733 478
464 3300025914 Ga0207671_10007573 Ga0207671_100075735 478
465 3300025914 Ga0207671_10018554 Ga0207671_100185543 478
466 3300025919 Ga0207657_10002298 Ga0207657_1000229820 478
467 3300025919 Ga0207657_10036487 Ga0207657_100364873 478
468 3300025923 Ga0207681_10000317 Ga0207681_100003177 478
469 3300025923 Ga0207681_10024831 Ga0207681_100248313 478
470 3300025924 Ga0207694_10059145 Ga0207694_100591451 478
471 3300025925 Ga0207650_10020065 Ga0207650_100200651 478
472 3300025933 Ga0207706_10025370 Ga0207706_100253704 478
473 3300025933 Ga0207706_10226158 Ga0207706_102261581 478
474 3300025936 Ga0207670_10007785 Ga0207670_100077853 478
475 3300025945 Ga0207679_10124338 Ga0207679_101243382 478
476 3300025945 Ga0207679_10137872 Ga0207679_101378721 478
477 3300025949 Ga0207667_10001287 Ga0207667_1000128727 478
478 3300025949 Ga0207667_10122092 Ga0207667_101220922 478
479 3300025961 Ga0207712_10000002 Ga0207712_10000002239 478
480 3300025961 Ga0207712_10000013 Ga0207712_10000013283 478
481 3300025972 Ga0207668_10002140 Ga0207668_100021403 478
482 3300025972 Ga0207668_10028705 Ga0207668_100287052 478
483 3300025981 Ga0207640_10015739 Ga0207640_100157393 478
484 3300025986 Ga0207658_10000064 Ga0207658_10000064112 478
485 3300025986 Ga0207658_10000292 Ga0207658_100002928 478
486 3300025986 Ga0207658_10001699 Ga0207658_100016999 478
487 3300026041 Ga0207639_10000160 Ga0207639_1000016018 478
488 3300026041 Ga0207639_10075596 Ga0207639_100755963 478
489 3300026067 Ga0207678_10000083 Ga0207678_1000008342 478
490 3300026067 Ga0207678_10032574 Ga0207678_100325743 478
491 3300026078 Ga0207702_10003308 Ga0207702_1000330811 478
492 3300026078 Ga0207702_10005977 Ga0207702_100059776 478
493 3300026088 Ga0207641_10000161 Ga0207641_1000016114 478
494 3300026088 Ga0207641_10000438 Ga0207641_1000043819 478
495 3300026088 Ga0207641_10001251 Ga0207641_100012513 478
496 3300026088 Ga0207641_10002032 Ga0207641_100020322 478
497 3300026095 Ga0207676_10000644 Ga0207676_100006443 478
498 3300026095 Ga0207676_10179585 Ga0207676_101795851 478
499 3300026116 Ga0207674_10058909 Ga0207674_100589094 478
500 3300026118 Ga0207675_100018074 Ga0207675_1000180744 478
501 3300026142 Ga0207698_10027113 Ga0207698_100271133 478
502 3300027866 Ga0209813_10000011 Ga0209813_1000001171 478
503 3300028379 Ga0268266_10000025 Ga0268266_10000025440 478
504 3300028380 Ga0268265_10000096 Ga0268265_1000009692 478
505 3300028380 Ga0268265_10000141 Ga0268265_1000014170 478
506 3300028381 Ga0268264_10000037 Ga0268264_10000037283 478
507 3300028381 Ga0268264_10000384 Ga0268264_1000038455 478
508 3300028381 Ga0268264_10001004 Ga0268264_100010042 478
509 3300028381 Ga0268264_10009346 Ga0268264_100093462 478
510 3300031901 Ga0307406_10017224 Ga0307406_100172242 478
511 3300031911 Ga0307412_10001138 Ga0307412_100011386 478
512 3300031911 Ga0307412_10027729 Ga0307412_100277293 478
513 3300046453 Ga0495627_000180 Ga0495627_000180_24226_25677 478
514 3300046524 Ga0495648_0014337 Ga0495648_0014337_1547_2998 478
515 3300046530 Ga0495654_0064643 Ga0495654_0064643_232_1698 478
516 3300046616 Ga0495668_0019510 Ga0495668_0019510_992_2458 478
517 3300047469 Ga0495673_0031779 Ga0495673_0031779_11_1447 478
518 3300048905 Ga0496102_0007248 Ga0496102_0007248_5645_7096 478
519 3300048906 Ga0496103_0005824 Ga0496103_0005824_263_1714 478
520 3300048911 Ga0496108_0045855 Ga0496108_0045855_1551_3002 478
521 3300048924 Ga0496121_0003525 Ga0496121_0003525_19580_21016 478
522 3300048927 Ga0496124_0182628 Ga0496124_0182628_123_1574 478
523 3300049517 Ga0501294_000091 Ga0501294_000091_5136_6590 478
524 3300049571 Ga0501034_0067826 Ga0501034_0067826_586_2037 478
525 3300049663 Ga0501223_000018 Ga0501223_000018_3178_4629 478
526 3300049663 Ga0501223_000298 Ga0501223_000298_3324_4775 478
527 3300049664 Ga0501224_000002 Ga0501224_000002_110350_111801 478
528 3300049669 Ga0501235_002547 Ga0501235_002547_585_2036 478
529 3300049705 Ga0501225_0000034 Ga0501225_0000034_37380_38831 478
530 3300049705 Ga0501225_0000045 Ga0501225_0000045_32335_33786 478
531 3300049705 Ga0501225_0007307 Ga0501225_0007307_400_1851 478
532 3300049778 Ga0501282_000193 Ga0501282_000193_5960_7414 478
533 3300049779 Ga0501283_000953 Ga0501283_000953_1808_3262 478
534 3300049823 Ga0501044_0081224 Ga0501044_0081224_1811_3268 478
535 3300049853 Ga0501226_000026 Ga0501226_000026_70349_71800 478
536 3300050494 nmdc:mga06z11_33_c1 nmdc:mga06z11_33_c1_386_1837 478
537 3300050495 nmdc:mga04h51_63_c1 nmdc:mga04h51_63_c1_30268_31719 478
538 3300053087 Ga0500643_002703 Ga0500643_002703_7100_8551 478
539 3300053087 Ga0500643_003042 Ga0500643_003042_6026_7477 478
540 3300053136 Ga0500559_0010299 Ga0500559_0010299_359_1810 478
541 iso_pu_bacteria 2512564014 2512642960 478
542 iso_pu_bacteria 2643221541 2643727438 478
543 iso_pu_bacteria 2643221606 2644041402 478
544 iso_pu_bacteria 2643221671 2644394942 478
545 iso_pu_bacteria 2775507255 2778125922 478
546 iso_pu_bacteria 2928027323 2928028799 478
547 iso_pu_bacteria 2984555340 2984556440 478
548 iso_pu_bacteria 2984564862 2984565370 478
549 iso_pu_bacteria 2993356040 2993356463 478

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14691

Fer4_20

Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster

25

137

0.97

PF01494

FAD_binding_3

FAD binding domain

147

185

0.92

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

152

200

0.89

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

291

368

0.86

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

149

222

0.81

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

148

457

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9667 144 180
2bi8-assembly1.cif.gz_A udp-galactopyranose mutase from klebsiella pneumoniae with reduced fad 0.9634 144 180
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.9618 144 180
3inr-assembly1.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (oxidized) 0.9569 144 180
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9462 144 180
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9716 146 179 3.50.50.60
af_Q8VYV2_23_370_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.967 147 182 3.50.50.60
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9471 144 244 3.40.50.720
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9394 146 267 3.50.50.60
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9367 146 262 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A383CBH0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9536 111 351 GO:0016491
AF-A0A4Q4CL55-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9515 124 473 GO:0016491
AF-A0A383CBH0-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9498 111 351 GO:0016491
AF-A0A529A8E4-F1-model_v4 FAD-dependent oxidoreductase 0.947 114 220 GO:0016491
AF-A0A4Q4CL55-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9441 124 473 GO:0016491

Feature Viewer

pLDDT pTM Quality
79.57 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map