metagRoot

F462286

General Info

Members	Datasets	Scaffolds	Average Seq Length
548	258	547	191

Family's Representative Sequence

Representative Sequence	3300049573\|Ga0501037_0063141\|Ga0501037_0063141_97_756
Length	219
Sequence	MRAHHEDASIVPHPEANAARASERQDKGRKMRVTSGKFGGRTLAAPADMRVRPTSDKVRQAIFNILEHRDFANGFALDDAAVIDLFAGTGALGIEALSRGARFCLFVDEDADSRGLQRRNVEALGLTGVTKIWRRDAGDLGPLNTGSGGPFNLAFLDPPYRKGLADKCLASLKAGGWLADDAVIVVETAIDETLAAPGFTLRDTRDYGETRATFLVTAA

Samples

	Sample ID	Description	Type	Environment
1	2828305725	Xanthobacter tagetidis DSM 11105	Isolate	Unclassified
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
5	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
6	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
7	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
8	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
9	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
10	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
11	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
12	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
13	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
14	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
15	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
16	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
17	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
18	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
19	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
20	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
21	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
22	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
23	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
24	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
25	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
26	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
27	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
28	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
29	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
30	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
31	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
32	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
33	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
34	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
35	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
36	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
37	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
38	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
39	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
40	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
41	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
42	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
43	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
44	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
45	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
46	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
47	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
48	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
49	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
50	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
51	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
52	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
53	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
54	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
55	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
56	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
57	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
58	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
59	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
60	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
61	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
62	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
63	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
64	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
65	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
66	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
67	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
68	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
69	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
70	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
71	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
72	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
73	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
74	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
75	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
76	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
77	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
78	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
114	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
115	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
116	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
117	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
118	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
119	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
120	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
121	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
122	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
123	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
124	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
125	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
126	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
127	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
128	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
129	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
130	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
131	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
132	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
133	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
134	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
135	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
136	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
137	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
138	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
139	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
140	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
141	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
142	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
143	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
144	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
145	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
146	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
147	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
148	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
149	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
150	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
151	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
152	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
153	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
154	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
155	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
156	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
157	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
158	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
159	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
160	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
161	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
162	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
163	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
164	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
165	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
166	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
167	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
168	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
169	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
170	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
171	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
172	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
173	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
174	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
175	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
176	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
177	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
178	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
179	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
180	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
181	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
182	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
183	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
184	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
185	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
186	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
187	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
188	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
189	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
190	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
191	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
192	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
193	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
194	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
195	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
196	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
197	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
198	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
199	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
200	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
201	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
202	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
203	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
204	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
205	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
206	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
207	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
208	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
209	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
210	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
211	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
239	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
244	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
245	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
246	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
247	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
248	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
249	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
250	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
251	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
252	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
253	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
254	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
255	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
256	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
257	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
258	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.82
Metatranscriptomes	0
Isolates	0.18

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.91
Nodule	0
Rhizoplane	5.11
Rhizosphere	91.79
Stem	0
Stem Tuber	0
Unclassified	2.19

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070658_10488637	3300005327	Bacteria	1063
2	Ga0068869_100160068	3300005334	Bacteria	1752
3	Ga0070680_100969250	3300005336	Bacteria	734
4	Ga0070689_100118332	3300005340	Bacteria	2114
5	Ga0070691_10001284	3300005341	Bacteria	10631
6	Ga0070661_100593103	3300005344	Bacteria	895
7	Ga0070692_10172086	3300005345	Bacteria	1249
8	Ga0070668_100399166	3300005347	Bacteria	1174
9	Ga0070668_101166119	3300005347	Bacteria	697
10	Ga0070673_100233000	3300005364	Bacteria	1598
11	Ga0070703_10066644	3300005406	Bacteria	1191
12	Ga0070709_10003322	3300005434	Bacteria	8654
13	Ga0070709_10018633	3300005434	Bacteria	4002
14	Ga0070714_100104123	3300005435	Unclassified	2504
15	Ga0070713_100000122	3300005436	Bacteria	50640
16	Ga0070713_100464867	3300005436	Bacteria	1190
17	Ga0070710_10420605	3300005437	Bacteria	900
18	Ga0070711_100011536	3300005439	Bacteria	5492
19	Ga0070711_100207356	3300005439	Bacteria	1516
20	Ga0070711_100569328	3300005439	Bacteria	942
21	Ga0070694_100064707	3300005444	Bacteria	2504
22	Ga0070694_100303433	3300005444	Bacteria	1224
23	Ga0070708_101445207	3300005445	Bacteria	641
24	Ga0070678_100443005	3300005456	Bacteria	1136
25	Ga0070678_100610330	3300005456	Bacteria	975
26	Ga0070681_10000010	3300005458	Bacteria	140126
27	Ga0070681_10107858	3300005458	Bacteria	2725
28	Ga0070699_100231714	3300005518	Bacteria	1647
29	Ga0070679_100000194	3300005530	Bacteria	49506
30	Ga0070679_100072181	3300005530	Bacteria	3444
31	Ga0070679_100755890	3300005530	Bacteria	915
32	Ga0070697_100550985	3300005536	Bacteria	1011
33	Ga0068853_100003923	3300005539	Bacteria	11416
34	Ga0068853_100013497	3300005539	Bacteria	6672
35	Ga0070672_100975950	3300005543	Bacteria	750
36	Ga0070695_100003485	3300005545	Bacteria	9185
37	Ga0070695_100006919	3300005545	Bacteria	6718
38	Ga0070695_100184686	3300005545	Bacteria	1480
39	Ga0070693_100138563	3300005547	Bacteria	1529
40	Ga0070665_100000561	3300005548	Bacteria	51782
41	Ga0070665_100192921	3300005548	Bacteria	2038
42	Ga0068855_100012131	3300005563	Bacteria	10413
43	Ga0068855_100148039	3300005563	Bacteria	2672
44	Ga0068855_100293574	3300005563	Bacteria	1802
45	Ga0070664_100657328	3300005564	Bacteria	974
46	Ga0068857_100000639	3300005577	Bacteria	25821
47	Ga0068856_100000318	3300005614	Bacteria	52944
48	Ga0068856_100001103	3300005614	Bacteria	28535
49	Ga0068856_100575753	3300005614	Bacteria	1147
50	Ga0070702_100032316	3300005615	Bacteria	2871
51	Ga0068852_100036369	3300005616	Bacteria	4118
52	Ga0068859_100276981	3300005617	Bacteria	1770
53	Ga0068864_100491030	3300005618	Bacteria	1180
54	Ga0068861_100707172	3300005719	Bacteria	937
55	Ga0068863_100926390	3300005841	Bacteria	872
56	Ga0068858_100234404	3300005842	Unclassified	1741
57	Ga0068858_100375758	3300005842	Bacteria	1363
58	Ga0068860_100241740	3300005843	Bacteria	1756
59	Ga0068862_100396539	3300005844	Bacteria	1290
60	Ga0068862_100416520	3300005844	Bacteria	1260
61	Ga0068862_101720453	3300005844	Bacteria	636
62	Ga0081455_10039433	3300005937	Bacteria	4174
63	Ga0075432_10018198	3300006058	Bacteria	2396
64	Ga0070712_100000019	3300006175	Bacteria	89020
65	Ga0070712_100002560	3300006175	Bacteria	11226
66	Ga0097621_100205051	3300006237	Bacteria	1713
67	Ga0068871_100229517	3300006358	Bacteria	1611
68	Ga0068871_100822699	3300006358	Bacteria	857
69	Ga0068871_101211675	3300006358	Unclassified	708
70	Ga0075428_100186116	3300006844	Bacteria	2247
71	Ga0075430_100994632	3300006846	Bacteria	691
72	Ga0075434_100036227	3300006871	Bacteria	4881
73	Ga0075434_100223219	3300006871	Bacteria	1904
74	Ga0075436_100000102	3300006914	Bacteria	50389
75	Ga0075436_100002687	3300006914	Bacteria	12236
76	Ga0097620_100276979	3300006931	Bacteria	1770
77	Ga0075435_100234646	3300007076	Bacteria	1559
78	Ga0075435_100370621	3300007076	Bacteria	1229
79	Ga0099794_10002201	3300007265	Bacteria	7122
80	Ga0105240_10000482	3300009093	Bacteria	73610
81	Ga0105240_10016338	3300009093	Bacteria	10052
82	Ga0105240_10030289	3300009093	Bacteria	7032
83	Ga0105240_10038588	3300009093	Bacteria	6125
84	Ga0105240_10059830	3300009093	Bacteria	4752
85	Ga0105240_10210996	3300009093	Bacteria	2269
86	Ga0105240_10304754	3300009093	Bacteria	1821
87	Ga0105240_10462990	3300009093	Bacteria	1416
88	Ga0105240_10874605	3300009093	Bacteria	968
89	Ga0105240_10914608	3300009093	Bacteria	943
90	Ga0105240_11399842	3300009093	Bacteria	735
91	Ga0111539_10730577	3300009094	Bacteria	1153
92	Ga0111539_10820596	3300009094	Bacteria	1082
93	Ga0105245_10276070	3300009098	Bacteria	1641
94	Ga0105247_10045681	3300009101	Bacteria	2688
95	Ga0105241_10058376	3300009174	Bacteria	2963
96	Ga0105241_10076605	3300009174	Bacteria	2609
97	Ga0105241_10159747	3300009174	Bacteria	1851
98	Ga0105241_10303328	3300009174	Bacteria	1371
99	Ga0105248_10000001	3300009177	Bacteria	1881304
100	Ga0105248_10099173	3300009177	Bacteria	3282
101	Ga0105248_10620615	3300009177	Bacteria	1220
102	Ga0105237_10000597	3300009545	Bacteria	50408
103	Ga0105237_10098837	3300009545	Bacteria	2909
104	Ga0105237_10138953	3300009545	Bacteria	2424
105	Ga0105237_10357159	3300009545	Bacteria	1465
106	Ga0105237_11115458	3300009545	Bacteria	796
107	Ga0105238_10000009	3300009551	Bacteria	288729
108	Ga0105238_10000601	3300009551	Bacteria	37812
109	Ga0105238_10004012	3300009551	Bacteria	14607
110	Ga0105238_10106581	3300009551	Bacteria	2784
111	Ga0105238_10332285	3300009551	Bacteria	1507
112	Ga0105238_10565380	3300009551	Bacteria	1142
113	Ga0105238_11048244	3300009551	Bacteria	837
114	Ga0105249_10194178	3300009553	Bacteria	1983
115	Ga0105239_10013535	3300010375	Bacteria	9056
116	Ga0105239_10327360	3300010375	Bacteria	1728
117	Ga0105239_10409196	3300010375	Bacteria	1536
118	Ga0105239_11703937	3300010375	Bacteria	730
119	Ga0157373_10001319	3300013100	Bacteria	18981
120	Ga0157370_10003886	3300013104	Bacteria	17408
121	Ga0157369_10001829	3300013105	Bacteria	25712
122	Ga0157369_10031015	3300013105	Bacteria	5891
123	Ga0157369_10591414	3300013105	Bacteria	1146
124	Ga0157374_10138249	3300013296	Bacteria	2363
125	Ga0157378_10451409	3300013297	Bacteria	1276
126	Ga0157378_10564189	3300013297	Bacteria	1145
127	Ga0163162_10507440	3300013306	Bacteria	1336
128	Ga0157372_10002101	3300013307	Bacteria	21678
129	Ga0157372_10014361	3300013307	Bacteria	8468
130	Ga0157372_10272347	3300013307	Bacteria	1968
131	Ga0157375_10784348	3300013308	Bacteria	1102
132	Ga0163163_10171929	3300014325	Bacteria	2213
133	Ga0163163_10519820	3300014325	Bacteria	1252
134	Ga0163163_10827074	3300014325	Bacteria	990
135	Ga0163163_10986250	3300014325	Bacteria	906
136	Ga0157380_10861972	3300014326	Bacteria	928
137	Ga0157379_10025270	3300014968	Bacteria	5275
138	Ga0157379_10025663	3300014968	Bacteria	5236
139	Ga0157379_10166038	3300014968	Bacteria	1992
140	Ga0157379_10276890	3300014968	Bacteria	1526
141	Ga0157379_10906936	3300014968	Bacteria	836
142	Ga0157376_10253418	3300014969	Bacteria	1645
143	Ga0213874_10002851	3300021377	Bacteria	3768
144	Ga0213874_10009920	3300021377	Bacteria	2370
145	Ga0213876_10002212	3300021384	Bacteria	11480
146	Ga0213876_10043981	3300021384	Bacteria	2360
147	Ga0207710_10339517	3300025900	Bacteria	764
148	Ga0207688_10248603	3300025901	Bacteria	1077
149	Ga0207699_10000221	3300025906	Bacteria	33589
150	Ga0207699_10006934	3300025906	Bacteria	5515
151	Ga0207705_10365124	3300025909	Bacteria	1114
152	Ga0207654_10041416	3300025911	Bacteria	2601
153	Ga0207654_10093218	3300025911	Bacteria	1841
154	Ga0207707_10000005	3300025912	Bacteria	382024
155	Ga0207695_10018345	3300025913	Bacteria	8094
156	Ga0207695_10020432	3300025913	Bacteria	7584
157	Ga0207695_10039932	3300025913	Bacteria	5039
158	Ga0207695_10059931	3300025913	Bacteria	3944
159	Ga0207695_10070999	3300025913	Bacteria	3557
160	Ga0207695_10098682	3300025913	Bacteria	2920
161	Ga0207695_10124518	3300025913	Bacteria	2541
162	Ga0207671_10447829	3300025914	Bacteria	1028
163	Ga0207693_10000227	3300025915	Bacteria	51454
164	Ga0207693_10001291	3300025915	Bacteria	22225
165	Ga0207693_10232355	3300025915	Bacteria	1448
166	Ga0207663_10102642	3300025916	Bacteria	1924
167	Ga0207663_10354388	3300025916	Bacteria	1112
168	Ga0207663_10879458	3300025916	Bacteria	716
169	Ga0207660_10004816	3300025917	Bacteria	8780
170	Ga0207660_10074133	3300025917	Bacteria	2483
171	Ga0207660_10630214	3300025917	Bacteria	874
172	Ga0207657_10136251	3300025919	Bacteria	2009
173	Ga0207652_10022166	3300025921	Bacteria	5250
174	Ga0207694_10000004	3300025924	Bacteria	967075
175	Ga0207694_10003504	3300025924	Bacteria	12469
176	Ga0207694_10029478	3300025924	Bacteria	4188
177	Ga0207694_10119638	3300025924	Bacteria	2102
178	Ga0207687_10148019	3300025927	Bacteria	1788
179	Ga0207687_10694796	3300025927	Bacteria	863
180	Ga0207700_10000088	3300025928	Bacteria	57845
181	Ga0207690_10135194	3300025932	Bacteria	1809
182	Ga0207665_10162270	3300025939	Bacteria	1608
183	Ga0207691_10815303	3300025940	Bacteria	784
184	Ga0207711_10000002	3300025941	Bacteria	1228676
185	Ga0207711_10152177	3300025941	Bacteria	2088
186	Ga0207667_10000546	3300025949	Bacteria	49677
187	Ga0207667_10438924	3300025949	Bacteria	1327
188	Ga0207667_10472880	3300025949	Bacteria	1273
189	Ga0207651_10201155	3300025960	Bacteria	1597
190	Ga0207712_10070634	3300025961	Bacteria	2509
191	Ga0207668_10063603	3300025972	Bacteria	2604
192	Ga0207668_10429171	3300025972	Bacteria	1123
193	Ga0207668_10934588	3300025972	Bacteria	773
194	Ga0207668_11027321	3300025972	Bacteria	737
195	Ga0207658_10135841	3300025986	Bacteria	1983
196	Ga0207658_10329680	3300025986	Bacteria	1324
197	Ga0207703_10134174	3300026035	Bacteria	2141
198	Ga0207703_10253372	3300026035	Bacteria	1588
199	Ga0207639_10005760	3300026041	Bacteria	8389
200	Ga0207702_10000238	3300026078	Bacteria	63877
201	Ga0207702_10000387	3300026078	Bacteria	50174
202	Ga0207648_10242600	3300026089	Bacteria	1605
203	Ga0207674_10000127	3300026116	Bacteria	88956
204	Ga0207675_100175322	3300026118	Bacteria	2051
205	Ga0207675_100732417	3300026118	Bacteria	999
206	Ga0209588_1000021	3300027671	Bacteria	92259
207	Ga0268266_10000110	3300028379	Bacteria	171840
208	Ga0268266_10030250	3300028379	Bacteria	4602
209	Ga0268265_10094601	3300028380	Bacteria	2397
210	Ga0268265_10128986	3300028380	Bacteria	2098
211	Ga0268264_10052169	3300028381	Bacteria	3410
212	Ga0265318_10000998	3300028577	Bacteria	18151
213	Ga0265318_10001516	3300028577	Bacteria	13534
214	Ga0265330_10178329	3300031235	Bacteria	900
215	Ga0265332_10013622	3300031238	Bacteria	3602
216	Ga0265320_10000456	3300031240	Bacteria	32131
217	Ga0265320_10091704	3300031240	Bacteria	1407
218	Ga0265325_10000010	3300031241	Bacteria	172391
219	Ga0265325_10000422	3300031241	Bacteria	30297
220	Ga0265325_10003393	3300031241	Bacteria	10414
221	Ga0265325_10041870	3300031241	Bacteria	2398
222	Ga0265325_10057262	3300031241	Bacteria	1988
223	Ga0265325_10108654	3300031241	Bacteria	1351
224	Ga0265340_10005748	3300031247	Bacteria	6853
225	Ga0265340_10064375	3300031247	Bacteria	1748
226	Ga0265339_10003477	3300031249	Bacteria	11005
227	Ga0265339_10009693	3300031249	Bacteria	6023
228	Ga0265339_10028537	3300031249	Bacteria	3172
229	Ga0265331_10009909	3300031250	Bacteria	5304
230	Ga0265331_10062142	3300031250	Bacteria	1762
231	Ga0265331_10158091	3300031250	Bacteria	1028
232	Ga0265316_10093284	3300031344	Bacteria	2294
233	Ga0265316_10174533	3300031344	Unclassified	1602
234	Ga0307408_100143062	3300031548	Bacteria	1879
235	Ga0265313_10000906	3300031595	Bacteria	29647
236	Ga0265313_10001697	3300031595	Bacteria	20308
237	Ga0265313_10002185	3300031595	Bacteria	17304
238	Ga0265313_10006325	3300031595	Bacteria	8426
239	Ga0316579_10246527	3300031691	Bacteria	864
240	Ga0265314_10005817	3300031711	Bacteria	11045
241	Ga0265314_10007266	3300031711	Bacteria	9621
242	Ga0265314_10040876	3300031711	Bacteria	3324
243	Ga0265314_10066637	3300031711	Bacteria	2428
244	Ga0265342_10005548	3300031712	Bacteria	9576
245	Ga0307405_10004488	3300031731	Bacteria	6603
246	Ga0316577_10378039	3300031733	Bacteria	805
247	Ga0307413_10010972	3300031824	Bacteria	4427
248	Ga0307410_10002527	3300031852	Bacteria	8847
249	Ga0307416_100400666	3300032002	Bacteria	1409
250	Ga0307414_10198367	3300032004	Bacteria	1630
251	Ga0307415_100044728	3300032126	Bacteria	2962
252	Ga0373958_0046162	3300034819	Bacteria	907
253	Ga0373926_0027982	3300035083	Bacteria	1978
254	Ga0373944_0009923	3300035089	Bacteria	2589
255	Ga0373945_0137724	3300035116	Bacteria	982
256	Ga0373954_0235734	3300035118	Unclassified	901
257	Ga0373961_0224064	3300035241	Bacteria	671
258	Ga0373962_0006587	3300035242	Bacteria	2815
259	Ga0373931_0464495	3300035691	Bacteria	811
260	Ga0373935_0206110	3300035692	Bacteria	1361
261	Ga0373927_0047485	3300035695	Bacteria	2777
262	Ga0373927_0570085	3300035695	Bacteria	748
263	Ga0373927_0721710	3300035695	Bacteria	658
264	Ga0373933_0272103	3300035724	Bacteria	1093
265	Ga0373947_0007281	3300035725	Bacteria	6412
266	Ga0373947_0360325	3300035725	Bacteria	977
267	Ga0373937_0002008	3300036401	Bacteria	17011
268	Ga0373937_0086174	3300036401	Bacteria	2907
269	Ga0373937_0162366	3300036401	Bacteria	2095
270	Ga0373937_0693860	3300036401	Bacteria	964
271	Ga0316582_0005514	3300036647	Bacteria	6527
272	Ga0316582_0027343	3300036647	Unclassified	3444
273	Ga0316582_0075254	3300036647	Bacteria	2193
274	Ga0373925_0005093	3300037068	Bacteria	9840
275	Ga0373925_0020482	3300037068	Bacteria	4815
276	Ga0373925_0085424	3300037068	Bacteria	2406
277	Ga0373925_0567650	3300037068	Unclassified	934
278	Ga0395899_0069625	3300037312	Bacteria	2576
279	Ga0395899_0222168	3300037312	Bacteria	1308
280	Ga0395900_0012374	3300037418	Bacteria	8731
281	Ga0395898_0035568	3300037466	Bacteria	4950
282	Ga0395905_0001444	3300037471	Bacteria	28571
283	Ga0395901_0145590	3300038443	Bacteria	2490
284	Ga0400486_11461	3300038742	Bacteria	2759
285	Ga0436365_0507621	3300039437	Bacteria	122643
286	Ga0436365_0754952	3300039437	Bacteria	7400
287	Ga0436365_1338454	3300039437	Bacteria	115168
288	Ga0436365_1550511	3300039437	Bacteria	1767
289	Ga0436360_1351238	3300039438	Bacteria	1225
290	Ga0436363_0529237	3300039450	Bacteria	3026
291	Ga0436363_1195223	3300039450	Bacteria	11138
292	Ga0439464_0040547	3300042439	Bacteria	1326
293	Ga0451577_0000026	3300042876	Bacteria	400540
294	Ga0451577_0007361	3300042876	Bacteria	10807
295	Ga0451577_0048523	3300042876	Bacteria	3793
296	Ga0453683_0000083	3300044673	Bacteria	143013
297	Ga0453683_0018133	3300044673	Bacteria	4521
298	Ga0453683_0165854	3300044673	Bacteria	1398
299	Ga0453684_0000124	3300044712	Bacteria	337649
300	Ga0453684_0000378	3300044712	Bacteria	183374
301	Ga0453684_0380881	3300044712	Bacteria	1584
302	Ga0453684_0482985	3300044712	Bacteria	1374
303	Ga0453684_0695611	3300044712	Unclassified	1105
304	Ga0453684_0898748	3300044712	Bacteria	949
305	Ga0453684_1016759	3300044712	Bacteria	880
306	Ga0451576_0028768	3300045051	Bacteria	5952
307	Ga0451576_0169884	3300045051	Bacteria	2276
308	Ga0451576_0325791	3300045051	Bacteria	1608
309	Ga0451576_1043708	3300045051	Bacteria	856
310	Ga0451576_1683209	3300045051	Bacteria	657
311	Ga0495629_0002431	3300046459	Bacteria	14296
312	Ga0495641_0009996	3300046461	Bacteria	5568
313	Ga0495580_0002306	3300046472	Bacteria	16649
314	Ga0495582_0000649	3300046473	Bacteria	19104
315	Ga0495582_0223830	3300046473	Bacteria	1077
316	Ga0495582_0433586	3300046473	Unclassified	758
317	Ga0495639_0010703	3300046475	Bacteria	3949
318	Ga0495662_0076688	3300046476	Bacteria	1623
319	Ga0495662_0266518	3300046476	Bacteria	843
320	Ga0495664_0015143	3300046477	Bacteria	4382
321	Ga0495664_0199316	3300046477	Bacteria	1213
322	Ga0495584_0008335	3300046491	Bacteria	5368
323	Ga0495584_0123282	3300046491	Bacteria	1313
324	Ga0495584_0132868	3300046491	Bacteria	1263
325	Ga0495594_0000010	3300046499	Bacteria	118481
326	Ga0495594_0001670	3300046499	Bacteria	11539
327	Ga0495644_0061376	3300046523	Bacteria	1413
328	Ga0495663_0108613	3300046525	Bacteria	920
329	Ga0495666_0018948	3300046526	Bacteria	3419
330	Ga0495652_0207108	3300046529	Bacteria	1484
331	Ga0495652_0410267	3300046529	Bacteria	957
332	Ga0495665_0021107	3300046531	Bacteria	3498
333	Ga0495665_0022344	3300046531	Bacteria	3400
334	Ga0495587_0055039	3300046536	Bacteria	2344
335	Ga0495645_0020728	3300046543	Bacteria	4747
336	Ga0495622_0003233	3300046557	Bacteria	7717
337	Ga0495622_0081939	3300046557	Bacteria	1484
338	Ga0495667_0102292	3300046559	Unclassified	1853
339	Ga0495667_0358456	3300046559	Bacteria	921
340	Ga0495656_0041645	3300046615	Bacteria	1920
341	Ga0495634_0017180	3300046642	Bacteria	5167
342	Ga0495588_0003871	3300046674	Bacteria	6556
343	Ga0495647_0099365	3300046681	Bacteria	1203
344	Ga0495658_0012321	3300046683	Bacteria	4326
345	Ga0495613_0001431	3300046689	Bacteria	18211
346	Ga0495604_0417852	3300047317	Bacteria	881
347	Ga0495636_0444524	3300047318	Bacteria	622
348	Ga0495674_0384649	3300047319	Unclassified	1135
349	Ga0495676_0043071	3300047321	Bacteria	3698
350	Ga0495680_0020494	3300047322	Bacteria	5562
351	Ga0495680_0580775	3300047322	Bacteria	752
352	Ga0495675_0036993	3300047444	Unclassified	3110
353	Ga0495675_0438800	3300047444	Bacteria	757
354	Ga0495593_0000810	3300047673	Bacteria	18096
355	Ga0495602_0066645	3300048088	Bacteria	3101
356	Ga0495614_0003243	3300048089	Bacteria	7263
357	Ga0496100_0044396	3300048903	Bacteria	2847
358	Ga0496100_0223377	3300048903	Bacteria	1383
359	Ga0496101_0141155	3300048904	Bacteria	1836
360	Ga0496101_0242213	3300048904	Bacteria	1404
361	Ga0496102_0030694	3300048905	Bacteria	4811
362	Ga0496102_0090912	3300048905	Bacteria	2825
363	Ga0496102_0104247	3300048905	Bacteria	2638
364	Ga0496103_0003492	3300048906	Bacteria	9614
365	Ga0496104_0086042	3300048907	Bacteria	3001
366	Ga0496106_0008422	3300048909	Bacteria	7629
367	Ga0496106_0092140	3300048909	Bacteria	2341
368	Ga0496106_0303602	3300048909	Bacteria	1280
369	Ga0496107_0057483	3300048910	Bacteria	2812
370	Ga0496107_0246541	3300048910	Bacteria	1329
371	Ga0496107_0491879	3300048910	Bacteria	910
372	Ga0496108_0052295	3300048911	Bacteria	3422
373	Ga0496108_0578198	3300048911	Bacteria	979
374	Ga0496109_0246453	3300048912	Bacteria	1682
375	Ga0496109_0415984	3300048912	Bacteria	1270
376	Ga0496109_0776704	3300048912	Bacteria	896
377	Ga0496110_0128733	3300048913	Bacteria	2285
378	Ga0496110_0934554	3300048913	Bacteria	774
379	Ga0496111_0025481	3300048914	Bacteria	4173
380	Ga0496111_0370904	3300048914	Bacteria	1059
381	Ga0496113_0068811	3300048916	Bacteria	2687
382	Ga0496113_0246046	3300048916	Bacteria	1427
383	Ga0496114_0238147	3300048917	Bacteria	1600
384	Ga0496115_0844786	3300048918	Bacteria	710
385	Ga0495682_0248099	3300049460	Bacteria	630
386	Ga0501031_0102782	3300049568	Bacteria	1865
387	Ga0501033_0023217	3300049570	Bacteria	4679
388	Ga0501033_0023305	3300049570	Bacteria	4669
389	Ga0501033_0088331	3300049570	Bacteria	2268
390	Ga0501033_0336664	3300049570	Bacteria	1058
391	Ga0501034_0034642	3300049571	Bacteria	5120
392	Ga0501034_0178020	3300049571	Bacteria	2092
393	Ga0501034_0336658	3300049571	Bacteria	1440
394	Ga0501034_0848712	3300049571	Bacteria	804
395	Ga0501036_0071683	3300049572	Bacteria	2929
396	Ga0501036_0093373	3300049572	Bacteria	2542
397	Ga0501036_0136203	3300049572	Bacteria	2073
398	Ga0501036_0558438	3300049572	Bacteria	951
399	Ga0501037_0063141	3300049573	Bacteria	2700
400	Ga0501037_0085613	3300049573	Bacteria	2282
401	Ga0501037_0369487	3300049573	Bacteria	987
402	Ga0501037_0392915	3300049573	Bacteria	952
403	Ga0501038_0077172	3300049574	Bacteria	2813
404	Ga0501038_0218290	3300049574	Bacteria	1522
405	Ga0501038_0406905	3300049574	Bacteria	1052
406	Ga0501038_0650029	3300049574	Bacteria	794
407	Ga0501038_0835647	3300049574	Bacteria	683
408	Ga0501039_0173658	3300049575	Bacteria	1694
409	Ga0501039_0583466	3300049575	Bacteria	876
410	Ga0501040_0013429	3300049576	Bacteria	5382
411	Ga0501040_0052824	3300049576	Bacteria	2782
412	Ga0501040_0054332	3300049576	Bacteria	2745
413	Ga0501040_0522598	3300049576	Bacteria	856
414	Ga0501041_0139993	3300049577	Bacteria	1509
415	Ga0501041_0227596	3300049577	Bacteria	1171
416	Ga0501041_0231477	3300049577	Bacteria	1160
417	Ga0501042_0023956	3300049578	Bacteria	4277
418	Ga0501042_0144910	3300049578	Bacteria	1712
419	Ga0501042_0393346	3300049578	Bacteria	1004
420	Ga0501042_0503097	3300049578	Bacteria	880
421	Ga0501042_0737206	3300049578	Bacteria	717
422	Ga0501043_0020552	3300049579	Bacteria	5179
423	Ga0501043_0120554	3300049579	Bacteria	2057
424	Ga0501043_0222185	3300049579	Bacteria	1461
425	Ga0501043_0262411	3300049579	Bacteria	1328
426	Ga0501043_0383154	3300049579	Bacteria	1064
427	Ga0501043_0666070	3300049579	Bacteria	763
428	Ga0501046_0002058	3300049580	Bacteria	19092
429	Ga0501046_0059478	3300049580	Bacteria	2993
430	Ga0501046_0078975	3300049580	Bacteria	2545
431	Ga0501046_0096710	3300049580	Bacteria	2268
432	Ga0501046_0633807	3300049580	Bacteria	757
433	Ga0501047_0001925	3300049581	Bacteria	19957
434	Ga0501047_0008592	3300049581	Bacteria	9641
435	Ga0501047_0014906	3300049581	Bacteria	7398
436	Ga0501047_0108365	3300049581	Bacteria	2660
437	Ga0501047_0139619	3300049581	Bacteria	2302
438	Ga0501047_0414988	3300049581	Bacteria	1178
439	Ga0501047_0428456	3300049581	Bacteria	1154
440	Ga0501048_0043091	3300049582	Bacteria	3230
441	Ga0501048_0082838	3300049582	Bacteria	2262
442	Ga0501048_0102452	3300049582	Bacteria	2020
443	Ga0501048_0250315	3300049582	Bacteria	1258
444	Ga0501048_0251112	3300049582	Bacteria	1256
445	Ga0501048_0295742	3300049582	Bacteria	1152
446	Ga0501067_0019118	3300049583	Bacteria	3792
447	Ga0501067_0222065	3300049583	Bacteria	1052
448	Ga0501068_0160399	3300049584	Bacteria	1417
449	Ga0501069_0023137	3300049585	Bacteria	3385
450	Ga0501070_0059331	3300049586	Bacteria	3172
451	Ga0501070_0297795	3300049586	Bacteria	1314
452	Ga0501070_0546427	3300049586	Bacteria	928
453	Ga0501071_0006867	3300049587	Bacteria	7419
454	Ga0501071_0063454	3300049587	Bacteria	2678
455	Ga0501071_0206514	3300049587	Bacteria	1476
456	Ga0501071_0327026	3300049587	Bacteria	1165
457	Ga0501072_0150196	3300049588	Bacteria	1857
458	Ga0501072_0344156	3300049588	Bacteria	1184
459	Ga0501072_0968748	3300049588	Bacteria	663
460	Ga0501073_0022997	3300049589	Bacteria	4482
461	Ga0501073_0197602	3300049589	Bacteria	1391
462	Ga0501074_0302775	3300049590	Bacteria	1135
463	Ga0501074_0355414	3300049590	Bacteria	1040
464	Ga0501075_0027893	3300049591	Bacteria	4163
465	Ga0501075_0243471	3300049591	Bacteria	1371
466	Ga0501075_0952189	3300049591	Bacteria	652
467	Ga0501076_0011870	3300049592	Bacteria	6505
468	Ga0501076_0024181	3300049592	Bacteria	4692
469	Ga0501076_0137179	3300049592	Bacteria	1986
470	Ga0501076_0198604	3300049592	Bacteria	1637
471	Ga0501076_0368604	3300049592	Bacteria	1180
472	Ga0501076_0448057	3300049592	Unclassified	1063
473	Ga0501076_0666143	3300049592	Bacteria	859
474	Ga0501077_0003793	3300049593	Bacteria	9097
475	Ga0501077_0016765	3300049593	Bacteria	4619
476	Ga0501077_0087676	3300049593	Bacteria	1972
477	Ga0501077_0424121	3300049593	Bacteria	851
478	Ga0501079_0016621	3300049741	Bacteria	5620
479	Ga0501079_0069461	3300049741	Bacteria	2719
480	Ga0501079_0358045	3300049741	Bacteria	1143
481	Ga0501080_0080581	3300049742	Bacteria	3026
482	Ga0501080_0112116	3300049742	Bacteria	2528
483	Ga0501080_0125320	3300049742	Bacteria	2379
484	Ga0501080_0188959	3300049742	Bacteria	1893
485	Ga0501080_0195331	3300049742	Bacteria	1859
486	Ga0501080_0492593	3300049742	Bacteria	1096
487	Ga0501081_0008377	3300049743	Bacteria	6711
488	Ga0501081_0021717	3300049743	Bacteria	4285
489	Ga0501081_0024555	3300049743	Bacteria	4047
490	Ga0501081_0397679	3300049743	Bacteria	1020
491	Ga0501081_0475442	3300049743	Bacteria	930
492	Ga0501083_0044537	3300049744	Bacteria	3004
493	Ga0501083_0064920	3300049744	Bacteria	2432
494	Ga0501083_0196607	3300049744	Bacteria	1316
495	Ga0501083_0350849	3300049744	Bacteria	959
496	Ga0501035_0008306	3300049822	Bacteria	9669
497	Ga0501035_0013589	3300049822	Bacteria	7512
498	Ga0501035_0021199	3300049822	Bacteria	5973
499	Ga0501035_0035128	3300049822	Bacteria	4550
500	Ga0501035_0076858	3300049822	Bacteria	2951
501	Ga0501044_0001555	3300049823	Bacteria	26866
502	Ga0501044_0018202	3300049823	Bacteria	7534
503	Ga0501044_0019861	3300049823	Bacteria	7176
504	Ga0501044_0023232	3300049823	Bacteria	6598
505	Ga0501044_0112628	3300049823	Bacteria	2728
506	Ga0501044_0149876	3300049823	Bacteria	2315
507	Ga0501044_0150661	3300049823	Bacteria	2308
508	Ga0501044_0188153	3300049823	Bacteria	2028
509	Ga0501044_0243027	3300049823	Bacteria	1743
510	Ga0501044_0369765	3300049823	Bacteria	1350
511	Ga0501045_0039665	3300049824	Bacteria	3426
512	Ga0501045_0043545	3300049824	Bacteria	3269
513	Ga0501045_0086666	3300049824	Bacteria	2311
514	Ga0501045_0636036	3300049824	Bacteria	789
515	Ga0501045_0935403	3300049824	Bacteria	636
516	nmdc:mga0qj67_959741_c1	3300050509	Bacteria	672
517	nmdc:mga08y16_132006_c1	3300050511	Bacteria	2597
518	nmdc:mga0n895_47038_c1	3300050512	Bacteria	4217
519	nmdc:mga0rr50_4595_c1	3300050513	Bacteria	8128
520	nmdc:mga0rr50_893096_c1	3300050513	Bacteria	758
521	nmdc:mga08x19_272835_c1	3300050514	Bacteria	1171
522	nmdc:mga08x19_4911_c1	3300050514	Bacteria	7897
523	nmdc:mga08x19_91_c1	3300050514	Bacteria	81177
524	nmdc:mga0a205_383987_c1	3300050515	Bacteria	1269
525	Ga0495595_0034383	3300053084	Bacteria	2292
526	Ga0495595_0045372	3300053084	Bacteria	2022
527	Ga0495619_0009979	3300053085	Bacteria	5982
528	Ga0500646_0037245	3300053090	Bacteria	1358
529	Ga0500647_0047760	3300053091	Bacteria	2058
530	Ga0500595_018994	3300053119	Bacteria	2501
531	Ga0500588_0001414	3300053146	Bacteria	4552
532	Ga0500619_008010	3300053154	Bacteria	2540
533	Ga0501084_0000016	3300054114	Bacteria	155919
534	Ga0501084_0010455	3300054114	Bacteria	7670
535	Ga0501084_0014122	3300054114	Bacteria	6614
536	Ga0501084_0041930	3300054114	Bacteria	3827
537	Ga0501082_0074670	3300060353	Bacteria	2920
538	Ga0501082_0125594	3300060353	Bacteria	2225
539	Ga0501082_0130641	3300060353	Bacteria	2179
540	Ga0501082_0220330	3300060353	Bacteria	1651
541	Ga0501082_0297761	3300060353	Bacteria	1405
542	Ga0501082_0298134	3300060353	Bacteria	1404
543	Ga0501082_1090125	3300060353	Bacteria	698
544	Ga0530510_0031656	3300061734	Bacteria	3804
545	Ga0530510_0040984	3300061734	Bacteria	3343
546	Ga0530510_0045375	3300061734	Bacteria	3175
547	Ga0530510_0785387	3300061734	Bacteria	726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300014325	Ga0163163_10171929	Ga0163163_101719295	140
2	3300049593	Ga0501077_0424121	Ga0501077_0424121_373_840	150
3	3300047318	Ga0495636_0444524	Ga0495636_0444524_23_553	154
4	3300048912	Ga0496109_0776704	Ga0496109_0776704_32_562	154
5	3300049460	Ga0495682_0248099	Ga0495682_0248099_26_556	154
6	3300049579	Ga0501043_0666070	Ga0501043_0666070_57_587	154
7	3300049580	Ga0501046_0633807	Ga0501046_0633807_191_721	154
8	3300049588	Ga0501072_0968748	Ga0501072_0968748_33_530	154
9	3300049591	Ga0501075_0952189	Ga0501075_0952189_59_589	154
10	3300049593	Ga0501077_0087676	Ga0501077_0087676_1434_1931	154
11	3300049744	Ga0501083_0350849	Ga0501083_0350849_409_939	154
12	3300035695	Ga0373927_0570085	Ga0373927_0570085_211_702	158
13	3300005456	Ga0070678_100610330	Ga0070678_1006103302	163
14	3300009094	Ga0111539_10820596	Ga0111539_108205962	163
15	3300014326	Ga0157380_10861972	Ga0157380_108619722	163
16	3300031548	Ga0307408_100143062	Ga0307408_1001430622	163
17	3300031731	Ga0307405_10004488	Ga0307405_100044885	163
18	3300031824	Ga0307413_10010972	Ga0307413_100109722	163
19	3300031852	Ga0307410_10002527	Ga0307410_100025277	163
20	3300032002	Ga0307416_100400666	Ga0307416_1004006662	163
21	3300032004	Ga0307414_10198367	Ga0307414_101983672	163
22	3300032126	Ga0307415_100044728	Ga0307415_1000447283	163
23	3300061734	Ga0530510_0785387	Ga0530510_0785387_190_696	163
24	3300009177	Ga0105248_10099173	Ga0105248_100991732	164
25	3300025941	Ga0207711_10152177	Ga0207711_101521774	164
26	3300007265	Ga0099794_10002201	Ga0099794_100022011	167
27	3300027671	Ga0209588_1000021	Ga0209588_100002159	167
28	3300009551	Ga0105238_10000009	Ga0105238_1000000966	168
29	3300025924	Ga0207694_10000004	Ga0207694_10000004229	168
30	3300048911	Ga0496108_0052295	Ga0496108_0052295_1051_1587	169
31	3300048912	Ga0496109_0246453	Ga0496109_0246453_1032_1568	169
32	3300048916	Ga0496113_0068811	Ga0496113_0068811_1348_1884	169
33	3300009551	Ga0105238_10106581	Ga0105238_101065814	170
34	3300025924	Ga0207694_10119638	Ga0207694_101196384	170
35	3300048088	Ga0495602_0066645	Ga0495602_0066645_487_1026	170
36	3300046499	Ga0495594_0000010	Ga0495594_0000010_21102_21650	172
37	3300046557	Ga0495622_0003233	Ga0495622_0003233_958_1506	172
38	3300053091	Ga0500647_0047760	Ga0500647_0047760_62_613	174
39	3300049574	Ga0501038_0650029	Ga0501038_0650029_76_612	175
40	3300060353	Ga0501082_0220330	Ga0501082_0220330_155_739	175
41	3300049570	Ga0501033_0336664	Ga0501033_0336664_102_644	176
42	3300049571	Ga0501034_0336658	Ga0501034_0336658_786_1328	176
43	3300049572	Ga0501036_0558438	Ga0501036_0558438_222_764	176
44	3300049574	Ga0501038_0406905	Ga0501038_0406905_154_696	176
45	3300049742	Ga0501080_0492593	Ga0501080_0492593_133_675	176
46	3300060353	Ga0501082_0297761	Ga0501082_0297761_260_802	176
47	iso_pu_bacteria	2828305725	2828308782	176
48	3300021377	Ga0213874_10009920	Ga0213874_100099202	177
49	3300031595	Ga0265313_10006325	Ga0265313_100063256	177
50	3300031733	Ga0316577_10378039	Ga0316577_103780391	177
51	3300036647	Ga0316582_0005514	Ga0316582_0005514_4285_4845	177
52	3300036647	Ga0316582_0027343	Ga0316582_0027343_1226_1786	177
53	3300036647	Ga0316582_0075254	Ga0316582_0075254_1570_2130	177
54	3300042876	Ga0451577_0000026	Ga0451577_0000026_222427_222984	177
55	3300044712	Ga0453684_0000124	Ga0453684_0000124_88725_89282	177
56	3300045051	Ga0451576_1043708	Ga0451576_1043708_123_680	177
57	3300026078	Ga0207702_10000387	Ga0207702_1000038742	178
58	3300028577	Ga0265318_10001516	Ga0265318_1000151612	178
59	3300031691	Ga0316579_10246527	Ga0316579_102465272	178
60	3300005548	Ga0070665_100000561	Ga0070665_10000056118	179
61	3300005548	Ga0070665_100192921	Ga0070665_1001929212	179
62	3300005563	Ga0068855_100148039	Ga0068855_1001480394	179
63	3300009093	Ga0105240_10016338	Ga0105240_100163389	179
64	3300009093	Ga0105240_10059830	Ga0105240_100598304	179
65	3300009093	Ga0105240_10462990	Ga0105240_104629902	179
66	3300009093	Ga0105240_10874605	Ga0105240_108746052	179
67	3300009093	Ga0105240_11399842	Ga0105240_113998422	179
68	3300009545	Ga0105237_10098837	Ga0105237_100988374	179
69	3300009545	Ga0105237_10138953	Ga0105237_101389534	179
70	3300009545	Ga0105237_11115458	Ga0105237_111154582	179
71	3300009551	Ga0105238_10004012	Ga0105238_1000401214	179
72	3300009551	Ga0105238_11048244	Ga0105238_110482442	179
73	3300010375	Ga0105239_10327360	Ga0105239_103273602	179
74	3300014325	Ga0163163_10519820	Ga0163163_105198202	179
75	3300014968	Ga0157379_10906936	Ga0157379_109069361	179
76	3300025913	Ga0207695_10039932	Ga0207695_100399324	179
77	3300025913	Ga0207695_10070999	Ga0207695_100709994	179
78	3300025913	Ga0207695_10124518	Ga0207695_101245184	179
79	3300025914	Ga0207671_10447829	Ga0207671_104478292	179
80	3300025924	Ga0207694_10003504	Ga0207694_1000350411	179
81	3300025986	Ga0207658_10329680	Ga0207658_103296802	179
82	3300028379	Ga0268266_10000110	Ga0268266_10000110129	179
83	3300028379	Ga0268266_10030250	Ga0268266_100302504	179
84	3300042876	Ga0451577_0048523	Ga0451577_0048523_549_1115	179
85	3300045051	Ga0451576_0169884	Ga0451576_0169884_37_603	179
86	3300049823	Ga0501044_0112628	Ga0501044_0112628_1645_2196	179
87	3300053090	Ga0500646_0037245	Ga0500646_0037245_716_1267	179
88	3300053119	Ga0500595_018994	Ga0500595_018994_1205_1753	179
89	3300053146	Ga0500588_0001414	Ga0500588_0001414_991_1542	179
90	3300005347	Ga0070668_101166119	Ga0070668_1011661191	180
91	3300005444	Ga0070694_100303433	Ga0070694_1003034332	180
92	3300005545	Ga0070695_100003485	Ga0070695_10000348510	180
93	3300025972	Ga0207668_11027321	Ga0207668_110273212	180
94	3300044712	Ga0453684_1016759	Ga0453684_1016759_200_769	180
95	3300048905	Ga0496102_0090912	Ga0496102_0090912_2160_2714	180
96	3300048910	Ga0496107_0057483	Ga0496107_0057483_1579_2133	180
97	3300048911	Ga0496108_0578198	Ga0496108_0578198_365_919	180
98	3300050515	nmdc:mga0a205_383987_c1	nmdc:mga0a205_383987_c1_473_1027	180
99	3300005334	Ga0068869_100160068	Ga0068869_1001600682	181
100	3300005340	Ga0070689_100118332	Ga0070689_1001183322	181
101	3300005345	Ga0070692_10172086	Ga0070692_101720862	181
102	3300005347	Ga0070668_100399166	Ga0070668_1003991662	181
103	3300005364	Ga0070673_100233000	Ga0070673_1002330002	181
104	3300005439	Ga0070711_100207356	Ga0070711_1002073561	181
105	3300005444	Ga0070694_100064707	Ga0070694_1000647071	181
106	3300005456	Ga0070678_100443005	Ga0070678_1004430052	181
107	3300005543	Ga0070672_100975950	Ga0070672_1009759502	181
108	3300005545	Ga0070695_100184686	Ga0070695_1001846862	181
109	3300005547	Ga0070693_100138563	Ga0070693_1001385632	181
110	3300005614	Ga0068856_100575753	Ga0068856_1005757532	181
111	3300005615	Ga0070702_100032316	Ga0070702_1000323163	181
112	3300005617	Ga0068859_100276981	Ga0068859_1002769812	181
113	3300005719	Ga0068861_100707172	Ga0068861_1007071721	181
114	3300005844	Ga0068862_100396539	Ga0068862_1003965392	181
115	3300005844	Ga0068862_100416520	Ga0068862_1004165202	181
116	3300005937	Ga0081455_10039433	Ga0081455_100394333	181
117	3300006058	Ga0075432_10018198	Ga0075432_100181982	181
118	3300006931	Ga0097620_100276979	Ga0097620_1002769792	181
119	3300007076	Ga0075435_100370621	Ga0075435_1003706211	181
120	3300009101	Ga0105247_10045681	Ga0105247_100456813	181
121	3300009177	Ga0105248_10620615	Ga0105248_106206152	181
122	3300009553	Ga0105249_10194178	Ga0105249_101941782	181
123	3300010375	Ga0105239_11703937	Ga0105239_117039371	181
124	3300013297	Ga0157378_10564189	Ga0157378_105641892	181
125	3300013306	Ga0163162_10507440	Ga0163162_105074402	181
126	3300013308	Ga0157375_10784348	Ga0157375_107843482	181
127	3300014968	Ga0157379_10166038	Ga0157379_101660382	181
128	3300014969	Ga0157376_10253418	Ga0157376_102534182	181
129	3300025900	Ga0207710_10339517	Ga0207710_103395172	181
130	3300025901	Ga0207688_10248603	Ga0207688_102486032	181
131	3300025915	Ga0207693_10232355	Ga0207693_102323552	181
132	3300025919	Ga0207657_10136251	Ga0207657_101362512	181
133	3300025927	Ga0207687_10694796	Ga0207687_106947962	181
134	3300025932	Ga0207690_10135194	Ga0207690_101351942	181
135	3300025939	Ga0207665_10162270	Ga0207665_101622702	181
136	3300025940	Ga0207691_10815303	Ga0207691_108153032	181
137	3300025960	Ga0207651_10201155	Ga0207651_102011552	181
138	3300025961	Ga0207712_10070634	Ga0207712_100706342	181
139	3300025972	Ga0207668_10063603	Ga0207668_100636033	181
140	3300025972	Ga0207668_10429171	Ga0207668_104291712	181
141	3300025972	Ga0207668_10934588	Ga0207668_109345882	181
142	3300025986	Ga0207658_10135841	Ga0207658_101358413	181
143	3300026035	Ga0207703_10134174	Ga0207703_101341742	181
144	3300026089	Ga0207648_10242600	Ga0207648_102426003	181
145	3300026118	Ga0207675_100175322	Ga0207675_1001753222	181
146	3300026118	Ga0207675_100732417	Ga0207675_1007324171	181
147	3300028380	Ga0268265_10094601	Ga0268265_100946012	181
148	3300028380	Ga0268265_10128986	Ga0268265_101289863	181
149	3300034819	Ga0373958_0046162	Ga0373958_0046162_264_875	181
150	3300035083	Ga0373926_0027982	Ga0373926_0027982_151_711	181
151	3300035089	Ga0373944_0009923	Ga0373944_0009923_804_1364	181
152	3300035116	Ga0373945_0137724	Ga0373945_0137724_277_837	181
153	3300035241	Ga0373961_0224064	Ga0373961_0224064_49_660	181
154	3300035242	Ga0373962_0006587	Ga0373962_0006587_976_1587	181
155	3300035695	Ga0373927_0047485	Ga0373927_0047485_1908_2468	181
156	3300035695	Ga0373927_0721710	Ga0373927_0721710_57_617	181
157	3300035725	Ga0373947_0007281	Ga0373947_0007281_4345_4905	181
158	3300035725	Ga0373947_0360325	Ga0373947_0360325_328_888	181
159	3300036401	Ga0373937_0086174	Ga0373937_0086174_1837_2421	181
160	3300036401	Ga0373937_0162366	Ga0373937_0162366_1210_1770	181
161	3300036401	Ga0373937_0693860	Ga0373937_0693860_105_665	181
162	3300037068	Ga0373925_0005093	Ga0373925_0005093_7788_8348	181
163	3300037312	Ga0395899_0222168	Ga0395899_0222168_122_700	181
164	3300037418	Ga0395900_0012374	Ga0395900_0012374_3806_4384	181
165	3300037471	Ga0395905_0001444	Ga0395905_0001444_17604_18182	181
166	3300038742	Ga0400486_11461	Ga0400486_11461_767_1342	181
167	3300045051	Ga0451576_0028768	Ga0451576_0028768_3083_3649	181
168	3300046459	Ga0495629_0002431	Ga0495629_0002431_5547_6107	181
169	3300046461	Ga0495641_0009996	Ga0495641_0009996_1919_2479	181
170	3300046472	Ga0495580_0002306	Ga0495580_0002306_12319_12879	181
171	3300046473	Ga0495582_0000649	Ga0495582_0000649_2672_3232	181
172	3300046475	Ga0495639_0010703	Ga0495639_0010703_2955_3515	181
173	3300046476	Ga0495662_0076688	Ga0495662_0076688_793_1353	181
174	3300046491	Ga0495584_0008335	Ga0495584_0008335_4181_4792	181
175	3300046491	Ga0495584_0132868	Ga0495584_0132868_468_1079	181
176	3300046499	Ga0495594_0001670	Ga0495594_0001670_9116_9676	181
177	3300046523	Ga0495644_0061376	Ga0495644_0061376_324_935	181
178	3300046525	Ga0495663_0108613	Ga0495663_0108613_226_837	181
179	3300046526	Ga0495666_0018948	Ga0495666_0018948_162_722	181
180	3300046529	Ga0495652_0410267	Ga0495652_0410267_206_790	181
181	3300046531	Ga0495665_0022344	Ga0495665_0022344_1656_2216	181
182	3300046536	Ga0495587_0055039	Ga0495587_0055039_708_1292	181
183	3300046557	Ga0495622_0081939	Ga0495622_0081939_728_1288	181
184	3300046559	Ga0495667_0358456	Ga0495667_0358456_320_904	181
185	3300046615	Ga0495656_0041645	Ga0495656_0041645_1108_1719	181
186	3300046642	Ga0495634_0017180	Ga0495634_0017180_2358_2918	181
187	3300046674	Ga0495588_0003871	Ga0495588_0003871_1641_2201	181
188	3300046681	Ga0495647_0099365	Ga0495647_0099365_335_895	181
189	3300046683	Ga0495658_0012321	Ga0495658_0012321_1820_2380	181
190	3300046689	Ga0495613_0001431	Ga0495613_0001431_2519_3079	181
191	3300047321	Ga0495676_0043071	Ga0495676_0043071_1684_2244	181
192	3300047322	Ga0495680_0020494	Ga0495680_0020494_3032_3592	181
193	3300047673	Ga0495593_0000810	Ga0495593_0000810_15133_15693	181
194	3300048089	Ga0495614_0003243	Ga0495614_0003243_6615_7175	181
195	3300048903	Ga0496100_0044396	Ga0496100_0044396_1151_1762	181
196	3300048903	Ga0496100_0223377	Ga0496100_0223377_51_629	181
197	3300048904	Ga0496101_0141155	Ga0496101_0141155_689_1300	181
198	3300048904	Ga0496101_0242213	Ga0496101_0242213_430_1008	181
199	3300048905	Ga0496102_0030694	Ga0496102_0030694_3579_4190	181
200	3300048906	Ga0496103_0003492	Ga0496103_0003492_7390_8001	181
201	3300048907	Ga0496104_0086042	Ga0496104_0086042_1022_1600	181
202	3300048909	Ga0496106_0008422	Ga0496106_0008422_4647_5258	181
203	3300048910	Ga0496107_0246541	Ga0496107_0246541_699_1310	181
204	3300048912	Ga0496109_0415984	Ga0496109_0415984_107_685	181
205	3300048913	Ga0496110_0128733	Ga0496110_0128733_20_631	181
206	3300048914	Ga0496111_0025481	Ga0496111_0025481_3097_3708	181
207	3300048916	Ga0496113_0246046	Ga0496113_0246046_699_1310	181
208	3300048917	Ga0496114_0238147	Ga0496114_0238147_321_881	181
209	3300048918	Ga0496115_0844786	Ga0496115_0844786_51_611	181
210	3300049568	Ga0501031_0102782	Ga0501031_0102782_798_1358	181
211	3300049570	Ga0501033_0088331	Ga0501033_0088331_1630_2241	181
212	3300049572	Ga0501036_0093373	Ga0501036_0093373_1051_1629	181
213	3300049573	Ga0501037_0392915	Ga0501037_0392915_219_830	181
214	3300049574	Ga0501038_0077172	Ga0501038_0077172_1602_2162	181
215	3300049574	Ga0501038_0218290	Ga0501038_0218290_316_927	181
216	3300049575	Ga0501039_0173658	Ga0501039_0173658_221_832	181
217	3300049575	Ga0501039_0583466	Ga0501039_0583466_289_849	181
218	3300049576	Ga0501040_0013429	Ga0501040_0013429_4161_4739	181
219	3300049576	Ga0501040_0052824	Ga0501040_0052824_2046_2606	181
220	3300049576	Ga0501040_0054332	Ga0501040_0054332_1785_2396	181
221	3300049576	Ga0501040_0522598	Ga0501040_0522598_42_602	181
222	3300049577	Ga0501041_0139993	Ga0501041_0139993_145_705	181
223	3300049577	Ga0501041_0227596	Ga0501041_0227596_474_1034	181
224	3300049577	Ga0501041_0231477	Ga0501041_0231477_522_1133	181
225	3300049578	Ga0501042_0023956	Ga0501042_0023956_2220_2831	181
226	3300049578	Ga0501042_0144910	Ga0501042_0144910_774_1352	181
227	3300049578	Ga0501042_0393346	Ga0501042_0393346_44_604	181
228	3300049578	Ga0501042_0503097	Ga0501042_0503097_165_725	181
229	3300049578	Ga0501042_0737206	Ga0501042_0737206_82_642	181
230	3300049579	Ga0501043_0020552	Ga0501043_0020552_524_1102	181
231	3300049579	Ga0501043_0222185	Ga0501043_0222185_115_726	181
232	3300049579	Ga0501043_0262411	Ga0501043_0262411_358_918	181
233	3300049580	Ga0501046_0059478	Ga0501046_0059478_2117_2695	181
234	3300049580	Ga0501046_0078975	Ga0501046_0078975_1710_2270	181
235	3300049580	Ga0501046_0096710	Ga0501046_0096710_28_639	181
236	3300049581	Ga0501047_0428456	Ga0501047_0428456_106_717	181
237	3300049582	Ga0501048_0043091	Ga0501048_0043091_1792_2403	181
238	3300049582	Ga0501048_0082838	Ga0501048_0082838_536_1114	181
239	3300049582	Ga0501048_0102452	Ga0501048_0102452_171_731	181
240	3300049582	Ga0501048_0251112	Ga0501048_0251112_311_871	181
241	3300049582	Ga0501048_0295742	Ga0501048_0295742_128_688	181
242	3300049583	Ga0501067_0222065	Ga0501067_0222065_274_852	181
243	3300049584	Ga0501068_0160399	Ga0501068_0160399_310_888	181
244	3300049586	Ga0501070_0546427	Ga0501070_0546427_228_806	181
245	3300049587	Ga0501071_0006867	Ga0501071_0006867_1402_1962	181
246	3300049587	Ga0501071_0063454	Ga0501071_0063454_1747_2325	181
247	3300049587	Ga0501071_0206514	Ga0501071_0206514_487_1098	181
248	3300049587	Ga0501071_0327026	Ga0501071_0327026_308_868	181
249	3300049588	Ga0501072_0150196	Ga0501072_0150196_1003_1563	181
250	3300049588	Ga0501072_0344156	Ga0501072_0344156_159_770	181
251	3300049589	Ga0501073_0197602	Ga0501073_0197602_609_1169	181
252	3300049590	Ga0501074_0302775	Ga0501074_0302775_497_1108	181
253	3300049590	Ga0501074_0355414	Ga0501074_0355414_152_712	181
254	3300049591	Ga0501075_0027893	Ga0501075_0027893_1283_1861	181
255	3300049591	Ga0501075_0243471	Ga0501075_0243471_439_999	181
256	3300049592	Ga0501076_0011870	Ga0501076_0011870_4852_5412	181
257	3300049592	Ga0501076_0024181	Ga0501076_0024181_3161_3739	181
258	3300049592	Ga0501076_0137179	Ga0501076_0137179_426_1037	181
259	3300049592	Ga0501076_0198604	Ga0501076_0198604_571_1182	181
260	3300049592	Ga0501076_0448057	Ga0501076_0448057_108_668	181
261	3300049592	Ga0501076_0666143	Ga0501076_0666143_39_599	181
262	3300049593	Ga0501077_0003793	Ga0501077_0003793_6375_6986	181
263	3300049593	Ga0501077_0016765	Ga0501077_0016765_2079_2690	181
264	3300049741	Ga0501079_0069461	Ga0501079_0069461_1960_2571	181
265	3300049741	Ga0501079_0358045	Ga0501079_0358045_398_1009	181
266	3300049742	Ga0501080_0080581	Ga0501080_0080581_1564_2142	181
267	3300049742	Ga0501080_0112116	Ga0501080_0112116_1547_2107	181
268	3300049742	Ga0501080_0188959	Ga0501080_0188959_186_797	181
269	3300049743	Ga0501081_0008377	Ga0501081_0008377_978_1538	181
270	3300049743	Ga0501081_0021717	Ga0501081_0021717_3485_4096	181
271	3300049743	Ga0501081_0024555	Ga0501081_0024555_656_1234	181
272	3300049743	Ga0501081_0397679	Ga0501081_0397679_127_687	181
273	3300049743	Ga0501081_0475442	Ga0501081_0475442_66_626	181
274	3300049744	Ga0501083_0064920	Ga0501083_0064920_656_1234	181
275	3300049744	Ga0501083_0196607	Ga0501083_0196607_715_1275	181
276	3300049824	Ga0501045_0039665	Ga0501045_0039665_1447_2058	181
277	3300049824	Ga0501045_0043545	Ga0501045_0043545_1525_2136	181
278	3300049824	Ga0501045_0086666	Ga0501045_0086666_629_1207	181
279	3300049824	Ga0501045_0636036	Ga0501045_0636036_203_763	181
280	3300049824	Ga0501045_0935403	Ga0501045_0935403_50_610	181
281	3300050513	nmdc:mga0rr50_893096_c1	nmdc:mga0rr50_893096_c1_135_743	181
282	3300053084	Ga0495595_0034383	Ga0495595_0034383_222_782	181
283	3300053084	Ga0495595_0045372	Ga0495595_0045372_680_1264	181
284	3300053085	Ga0495619_0009979	Ga0495619_0009979_2385_2945	181
285	3300054114	Ga0501084_0010455	Ga0501084_0010455_1456_2034	181
286	3300054114	Ga0501084_0041930	Ga0501084_0041930_1519_2130	181
287	3300060353	Ga0501082_0074670	Ga0501082_0074670_716_1294	181
288	3300060353	Ga0501082_0125594	Ga0501082_0125594_1529_2089	181
289	3300060353	Ga0501082_0130641	Ga0501082_0130641_1352_1963	181
290	3300060353	Ga0501082_0298134	Ga0501082_0298134_612_1172	181
291	3300061734	Ga0530510_0031656	Ga0530510_0031656_2617_3228	181
292	3300061734	Ga0530510_0040984	Ga0530510_0040984_1812_2390	181
293	3300061734	Ga0530510_0045375	Ga0530510_0045375_2603_3163	181
294	3300005439	Ga0070711_100569328	Ga0070711_1005693281	182
295	3300005530	Ga0070679_100755890	Ga0070679_1007558901	182
296	3300014325	Ga0163163_10986250	Ga0163163_109862502	182
297	3300025916	Ga0207663_10879458	Ga0207663_108794581	182
298	3300031235	Ga0265330_10178329	Ga0265330_101783291	182
299	3300031711	Ga0265314_10066637	Ga0265314_100666372	182
300	3300044673	Ga0453683_0165854	Ga0453683_0165854_235_816	182
301	3300046473	Ga0495582_0223830	Ga0495582_0223830_134_715	182
302	3300046473	Ga0495582_0433586	Ga0495582_0433586_75_647	182
303	3300046531	Ga0495665_0021107	Ga0495665_0021107_166_747	182
304	3300047319	Ga0495674_0384649	Ga0495674_0384649_440_1012	182
305	3300005406	Ga0070703_10066644	Ga0070703_100666442	184
306	3300005842	Ga0068858_100375758	Ga0068858_1003757582	184
307	3300005843	Ga0068860_100241740	Ga0068860_1002417402	184
308	3300006358	Ga0068871_101211675	Ga0068871_1012116751	184
309	3300006844	Ga0075428_100186116	Ga0075428_1001861163	184
310	3300006846	Ga0075430_100994632	Ga0075430_1009946321	184
311	3300009094	Ga0111539_10730577	Ga0111539_107305772	184
312	3300014968	Ga0157379_10025663	Ga0157379_100256634	184
313	3300026035	Ga0207703_10253372	Ga0207703_102533722	184
314	3300028381	Ga0268264_10052169	Ga0268264_100521693	184
315	3300031247	Ga0265340_10064375	Ga0265340_100643752	184
316	3300037068	Ga0373925_0567650	Ga0373925_0567650_238_840	184
317	3300039450	Ga0436363_0529237	Ga0436363_0529237_1410_1976	184
318	3300042439	Ga0439464_0040547	Ga0439464_0040547_381_959	184
319	3300042876	Ga0451577_0007361	Ga0451577_0007361_1905_2486	184
320	3300044673	Ga0453683_0000083	Ga0453683_0000083_42779_43360	184
321	3300044673	Ga0453683_0018133	Ga0453683_0018133_610_1191	184
322	3300044712	Ga0453684_0000378	Ga0453684_0000378_83573_84154	184
323	3300044712	Ga0453684_0380881	Ga0453684_0380881_37_615	184
324	3300044712	Ga0453684_0482985	Ga0453684_0482985_315_878	184
325	3300044712	Ga0453684_0695611	Ga0453684_0695611_157_747	184
326	3300044712	Ga0453684_0898748	Ga0453684_0898748_82_645	184
327	3300045051	Ga0451576_0325791	Ga0451576_0325791_391_963	184
328	3300045051	Ga0451576_1683209	Ga0451576_1683209_50_631	184
329	3300046491	Ga0495584_0123282	Ga0495584_0123282_79_654	184
330	3300047444	Ga0495675_0438800	Ga0495675_0438800_89_664	184
331	3300049592	Ga0501076_0368604	Ga0501076_0368604_556_1128	184
332	3300050509	nmdc:mga0qj67_959741_c1	nmdc:mga0qj67_959741_c1_71_640	184
333	3300050511	nmdc:mga08y16_132006_c1	nmdc:mga08y16_132006_c1_376_945	184
334	3300005437	Ga0070710_10420605	Ga0070710_104206051	185
335	3300005439	Ga0070711_100011536	Ga0070711_1000115364	185
336	3300006175	Ga0070712_100002560	Ga0070712_1000025603	185
337	3300013307	Ga0157372_10272347	Ga0157372_102723472	185
338	3300014968	Ga0157379_10276890	Ga0157379_102768902	185
339	3300025915	Ga0207693_10001291	Ga0207693_100012918	185
340	3300025916	Ga0207663_10102642	Ga0207663_101026422	185
341	3300025916	Ga0207663_10354388	Ga0207663_103543881	185
342	3300031238	Ga0265332_10013622	Ga0265332_100136225	185
343	3300031240	Ga0265320_10000456	Ga0265320_1000045625	185
344	3300031241	Ga0265325_10003393	Ga0265325_100033937	185
345	3300031241	Ga0265325_10041870	Ga0265325_100418702	185
346	3300031241	Ga0265325_10057262	Ga0265325_100572622	185
347	3300031247	Ga0265340_10005748	Ga0265340_100057486	185
348	3300031249	Ga0265339_10028537	Ga0265339_100285372	185
349	3300031711	Ga0265314_10007266	Ga0265314_100072665	185
350	3300031712	Ga0265342_10005548	Ga0265342_100055487	185
351	3300036401	Ga0373937_0002008	Ga0373937_0002008_8423_8995	185
352	3300037068	Ga0373925_0020482	Ga0373925_0020482_1887_2459	185
353	3300039437	Ga0436365_1550511	Ga0436365_1550511_192_761	185
354	3300047322	Ga0495680_0580775	Ga0495680_0580775_144_722	185
355	3300048909	Ga0496106_0092140	Ga0496106_0092140_1182_1754	185
356	3300049571	Ga0501034_0178020	Ga0501034_0178020_537_1103	185
357	3300049571	Ga0501034_0848712	Ga0501034_0848712_195_758	185
358	3300049581	Ga0501047_0108365	Ga0501047_0108365_1139_1702	185
359	3300049823	Ga0501044_0369765	Ga0501044_0369765_438_1001	185
360	3300054114	Ga0501084_0000016	Ga0501084_0000016_40432_41004	185
361	3300060353	Ga0501082_1090125	Ga0501082_1090125_86_658	185
362	3300005327	Ga0070658_10488637	Ga0070658_104886372	186
363	3300005336	Ga0070680_100969250	Ga0070680_1009692502	186
364	3300005341	Ga0070691_10001284	Ga0070691_100012844	186
365	3300005344	Ga0070661_100593103	Ga0070661_1005931032	186
366	3300005434	Ga0070709_10003322	Ga0070709_100033223	186
367	3300005434	Ga0070709_10018633	Ga0070709_100186332	186
368	3300005435	Ga0070714_100104123	Ga0070714_1001041232	186
369	3300005436	Ga0070713_100000122	Ga0070713_1000001226	186
370	3300005436	Ga0070713_100464867	Ga0070713_1004648672	186
371	3300005445	Ga0070708_101445207	Ga0070708_1014452071	186
372	3300005458	Ga0070681_10000010	Ga0070681_10000010148	186
373	3300005458	Ga0070681_10107858	Ga0070681_101078582	186
374	3300005518	Ga0070699_100231714	Ga0070699_1002317142	186
375	3300005530	Ga0070679_100000194	Ga0070679_10000019410	186
376	3300005530	Ga0070679_100072181	Ga0070679_1000721812	186
377	3300005536	Ga0070697_100550985	Ga0070697_1005509852	186
378	3300005539	Ga0068853_100003923	Ga0068853_1000039236	186
379	3300005539	Ga0068853_100013497	Ga0068853_1000134973	186
380	3300005545	Ga0070695_100006919	Ga0070695_1000069196	186
381	3300005563	Ga0068855_100012131	Ga0068855_1000121316	186
382	3300005563	Ga0068855_100293574	Ga0068855_1002935742	186
383	3300005564	Ga0070664_100657328	Ga0070664_1006573282	186
384	3300005577	Ga0068857_100000639	Ga0068857_10000063912	186
385	3300005614	Ga0068856_100000318	Ga0068856_10000031816	186
386	3300005614	Ga0068856_100001103	Ga0068856_1000011035	186
387	3300005616	Ga0068852_100036369	Ga0068852_1000363692	186
388	3300005618	Ga0068864_100491030	Ga0068864_1004910302	186
389	3300005841	Ga0068863_100926390	Ga0068863_1009263902	186
390	3300005842	Ga0068858_100234404	Ga0068858_1002344042	186
391	3300005844	Ga0068862_101720453	Ga0068862_1017204532	186
392	3300006175	Ga0070712_100000019	Ga0070712_10000001962	186
393	3300006237	Ga0097621_100205051	Ga0097621_1002050512	186
394	3300006358	Ga0068871_100229517	Ga0068871_1002295172	186
395	3300006358	Ga0068871_100822699	Ga0068871_1008226992	186
396	3300006871	Ga0075434_100036227	Ga0075434_1000362273	186
397	3300006871	Ga0075434_100223219	Ga0075434_1002232192	186
398	3300006914	Ga0075436_100000102	Ga0075436_1000001026	186
399	3300006914	Ga0075436_100002687	Ga0075436_1000026876	186
400	3300007076	Ga0075435_100234646	Ga0075435_1002346462	186
401	3300009093	Ga0105240_10000482	Ga0105240_1000048229	186
402	3300009093	Ga0105240_10030289	Ga0105240_100302895	186
403	3300009093	Ga0105240_10038588	Ga0105240_100385884	186
404	3300009093	Ga0105240_10210996	Ga0105240_102109962	186
405	3300009093	Ga0105240_10304754	Ga0105240_103047542	186
406	3300009093	Ga0105240_10914608	Ga0105240_109146081	186
407	3300009098	Ga0105245_10276070	Ga0105245_102760702	186
408	3300009174	Ga0105241_10058376	Ga0105241_100583764	186
409	3300009174	Ga0105241_10076605	Ga0105241_100766052	186
410	3300009174	Ga0105241_10159747	Ga0105241_101597472	186
411	3300009174	Ga0105241_10303328	Ga0105241_103033282	186
412	3300009177	Ga0105248_10000001	Ga0105248_1000000192	186
413	3300009545	Ga0105237_10000597	Ga0105237_1000059712	186
414	3300009545	Ga0105237_10357159	Ga0105237_103571592	186
415	3300009551	Ga0105238_10000601	Ga0105238_1000060119	186
416	3300009551	Ga0105238_10332285	Ga0105238_103322852	186
417	3300009551	Ga0105238_10565380	Ga0105238_105653802	186
418	3300010375	Ga0105239_10013535	Ga0105239_100135353	186
419	3300010375	Ga0105239_10409196	Ga0105239_104091961	186
420	3300013100	Ga0157373_10001319	Ga0157373_100013196	186
421	3300013104	Ga0157370_10003886	Ga0157370_1000388612	186
422	3300013105	Ga0157369_10001829	Ga0157369_1000182912	186
423	3300013105	Ga0157369_10031015	Ga0157369_100310153	186
424	3300013105	Ga0157369_10591414	Ga0157369_105914142	186
425	3300013296	Ga0157374_10138249	Ga0157374_101382492	186
426	3300013297	Ga0157378_10451409	Ga0157378_104514092	186
427	3300013307	Ga0157372_10002101	Ga0157372_1000210117	186
428	3300013307	Ga0157372_10014361	Ga0157372_100143619	186
429	3300014325	Ga0163163_10827074	Ga0163163_108270741	186
430	3300014968	Ga0157379_10025270	Ga0157379_100252703	186
431	3300021377	Ga0213874_10002851	Ga0213874_100028513	186
432	3300021384	Ga0213876_10002212	Ga0213876_100022124	186
433	3300021384	Ga0213876_10043981	Ga0213876_100439812	186
434	3300025906	Ga0207699_10000221	Ga0207699_100002216	186
435	3300025906	Ga0207699_10006934	Ga0207699_100069346	186
436	3300025909	Ga0207705_10365124	Ga0207705_103651241	186
437	3300025911	Ga0207654_10041416	Ga0207654_100414162	186
438	3300025911	Ga0207654_10093218	Ga0207654_100932181	186
439	3300025912	Ga0207707_10000005	Ga0207707_10000005148	186
440	3300025913	Ga0207695_10018345	Ga0207695_100183456	186
441	3300025913	Ga0207695_10020432	Ga0207695_100204325	186
442	3300025913	Ga0207695_10059931	Ga0207695_100599312	186
443	3300025913	Ga0207695_10098682	Ga0207695_100986825	186
444	3300025915	Ga0207693_10000227	Ga0207693_1000022722	186
445	3300025917	Ga0207660_10004816	Ga0207660_100048163	186
446	3300025917	Ga0207660_10074133	Ga0207660_100741332	186
447	3300025917	Ga0207660_10630214	Ga0207660_106302142	186
448	3300025921	Ga0207652_10022166	Ga0207652_100221662	186
449	3300025924	Ga0207694_10029478	Ga0207694_100294783	186
450	3300025927	Ga0207687_10148019	Ga0207687_101480192	186
451	3300025928	Ga0207700_10000088	Ga0207700_1000008853	186
452	3300025941	Ga0207711_10000002	Ga0207711_10000002793	186
453	3300025949	Ga0207667_10000546	Ga0207667_1000054630	186
454	3300025949	Ga0207667_10438924	Ga0207667_104389242	186
455	3300025949	Ga0207667_10472880	Ga0207667_104728802	186
456	3300026041	Ga0207639_10005760	Ga0207639_100057606	186
457	3300026078	Ga0207702_10000238	Ga0207702_1000023818	186
458	3300026116	Ga0207674_10000127	Ga0207674_1000012748	186
459	3300028577	Ga0265318_10000998	Ga0265318_100009987	186
460	3300031240	Ga0265320_10091704	Ga0265320_100917042	186
461	3300031241	Ga0265325_10000010	Ga0265325_1000001073	186
462	3300031241	Ga0265325_10000422	Ga0265325_100004223	186
463	3300031241	Ga0265325_10108654	Ga0265325_101086541	186
464	3300031249	Ga0265339_10003477	Ga0265339_100034777	186
465	3300031249	Ga0265339_10009693	Ga0265339_100096935	186
466	3300031250	Ga0265331_10009909	Ga0265331_100099093	186
467	3300031250	Ga0265331_10062142	Ga0265331_100621421	186
468	3300031250	Ga0265331_10158091	Ga0265331_101580912	186
469	3300031344	Ga0265316_10093284	Ga0265316_100932843	186
470	3300031344	Ga0265316_10174533	Ga0265316_101745332	186
471	3300031595	Ga0265313_10000906	Ga0265313_100009065	186
472	3300031595	Ga0265313_10001697	Ga0265313_100016978	186
473	3300031595	Ga0265313_10002185	Ga0265313_100021853	186
474	3300031711	Ga0265314_10005817	Ga0265314_100058173	186
475	3300031711	Ga0265314_10040876	Ga0265314_100408763	186
476	3300035118	Ga0373954_0235734	Ga0373954_0235734_111_686	186
477	3300035691	Ga0373931_0464495	Ga0373931_0464495_35_610	186
478	3300035692	Ga0373935_0206110	Ga0373935_0206110_607_1182	186
479	3300035724	Ga0373933_0272103	Ga0373933_0272103_461_1036	186
480	3300037068	Ga0373925_0085424	Ga0373925_0085424_1692_2267	186
481	3300037312	Ga0395899_0069625	Ga0395899_0069625_1361_1930	186
482	3300037466	Ga0395898_0035568	Ga0395898_0035568_1315_1884	186
483	3300038443	Ga0395901_0145590	Ga0395901_0145590_1225_1794	186
484	3300039437	Ga0436365_0507621	Ga0436365_0507621_14089_14664	186
485	3300039437	Ga0436365_0754952	Ga0436365_0754952_4817_5383	186
486	3300039437	Ga0436365_1338454	Ga0436365_1338454_48333_48905	186
487	3300039438	Ga0436360_1351238	Ga0436360_1351238_353_922	186
488	3300039450	Ga0436363_1195223	Ga0436363_1195223_8707_9276	186
489	3300046476	Ga0495662_0266518	Ga0495662_0266518_138_722	186
490	3300046477	Ga0495664_0015143	Ga0495664_0015143_2244_2822	186
491	3300046477	Ga0495664_0199316	Ga0495664_0199316_27_599	186
492	3300046529	Ga0495652_0207108	Ga0495652_0207108_215_793	186
493	3300046543	Ga0495645_0020728	Ga0495645_0020728_251_829	186
494	3300046559	Ga0495667_0102292	Ga0495667_0102292_652_1230	186
495	3300047317	Ga0495604_0417852	Ga0495604_0417852_108_677	186
496	3300047444	Ga0495675_0036993	Ga0495675_0036993_2014_2592	186
497	3300048905	Ga0496102_0104247	Ga0496102_0104247_1881_2456	186
498	3300048909	Ga0496106_0303602	Ga0496106_0303602_547_1122	186
499	3300048910	Ga0496107_0491879	Ga0496107_0491879_191_760	186
500	3300048913	Ga0496110_0934554	Ga0496110_0934554_78_653	186
501	3300048914	Ga0496111_0370904	Ga0496111_0370904_89_664	186
502	3300049570	Ga0501033_0023217	Ga0501033_0023217_3840_4409	186
503	3300049570	Ga0501033_0023305	Ga0501033_0023305_1460_2032	186
504	3300049571	Ga0501034_0034642	Ga0501034_0034642_340_909	186
505	3300049572	Ga0501036_0071683	Ga0501036_0071683_2001_2618	186
506	3300049572	Ga0501036_0136203	Ga0501036_0136203_36_605	186
507	3300049573	Ga0501037_0063141	Ga0501037_0063141_97_756	186
508	3300049573	Ga0501037_0085613	Ga0501037_0085613_1636_2208	186
509	3300049573	Ga0501037_0369487	Ga0501037_0369487_75_644	186
510	3300049574	Ga0501038_0835647	Ga0501038_0835647_13_585	186
511	3300049579	Ga0501043_0120554	Ga0501043_0120554_221_826	186
512	3300049579	Ga0501043_0383154	Ga0501043_0383154_374_1033	186
513	3300049580	Ga0501046_0002058	Ga0501046_0002058_542_1111	186
514	3300049581	Ga0501047_0001925	Ga0501047_0001925_16369_16938	186
515	3300049581	Ga0501047_0008592	Ga0501047_0008592_3871_4476	186
516	3300049581	Ga0501047_0014906	Ga0501047_0014906_1858_2475	186
517	3300049581	Ga0501047_0139619	Ga0501047_0139619_1340_1909	186
518	3300049581	Ga0501047_0414988	Ga0501047_0414988_576_1145	186
519	3300049582	Ga0501048_0250315	Ga0501048_0250315_55_714	186
520	3300049583	Ga0501067_0019118	Ga0501067_0019118_2547_3164	186
521	3300049585	Ga0501069_0023137	Ga0501069_0023137_1876_2493	186
522	3300049586	Ga0501070_0059331	Ga0501070_0059331_969_1544	186
523	3300049586	Ga0501070_0297795	Ga0501070_0297795_385_954	186
524	3300049589	Ga0501073_0022997	Ga0501073_0022997_3795_4412	186
525	3300049741	Ga0501079_0016621	Ga0501079_0016621_861_1478	186
526	3300049742	Ga0501080_0125320	Ga0501080_0125320_1200_1769	186
527	3300049742	Ga0501080_0195331	Ga0501080_0195331_711_1280	186
528	3300049744	Ga0501083_0044537	Ga0501083_0044537_2313_2930	186
529	3300049822	Ga0501035_0008306	Ga0501035_0008306_8427_9044	186
530	3300049822	Ga0501035_0013589	Ga0501035_0013589_559_1140	186
531	3300049822	Ga0501035_0021199	Ga0501035_0021199_288_857	186
532	3300049822	Ga0501035_0035128	Ga0501035_0035128_585_1157	186
533	3300049822	Ga0501035_0076858	Ga0501035_0076858_1617_2276	186
534	3300049823	Ga0501044_0001555	Ga0501044_0001555_14719_15291	186
535	3300049823	Ga0501044_0018202	Ga0501044_0018202_1858_2475	186
536	3300049823	Ga0501044_0019861	Ga0501044_0019861_182_787	186
537	3300049823	Ga0501044_0023232	Ga0501044_0023232_5159_5728	186
538	3300049823	Ga0501044_0149876	Ga0501044_0149876_151_720	186
539	3300049823	Ga0501044_0150661	Ga0501044_0150661_1142_1801	186
540	3300049823	Ga0501044_0188153	Ga0501044_0188153_915_1496	186
541	3300049823	Ga0501044_0243027	Ga0501044_0243027_1108_1674	186
542	3300050512	nmdc:mga0n895_47038_c1	nmdc:mga0n895_47038_c1_1099_1674	186
543	3300050513	nmdc:mga0rr50_4595_c1	nmdc:mga0rr50_4595_c1_6798_7373	186
544	3300050514	nmdc:mga08x19_272835_c1	nmdc:mga08x19_272835_c1_321_896	186
545	3300050514	nmdc:mga08x19_4911_c1	nmdc:mga08x19_4911_c1_2541_3116	186
546	3300050514	nmdc:mga08x19_91_c1	nmdc:mga08x19_91_c1_35156_35731	186
547	3300053154	Ga0500619_008010	Ga0500619_008010_1545_2114	186
548	3300054114	Ga0501084_0014122	Ga0501084_0014122_5599_6216	186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

31

216

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3p9n-assembly1.cif.gz_A	rv2966c of m. tuberculosis is a rsmd-like methyltransferase	0.8915	1	186
6m1c-assembly1.cif.gz_A	crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions	0.888	1	185
2fpo-assembly5.cif.gz_E	putative methyltransferase yhhf from escherichia coli.	0.8813	1	185
2fpo-assembly1.cif.gz_A	putative methyltransferase yhhf from escherichia coli.	0.8807	1	185
3p9n-assembly1.cif.gz_A	rv2966c of m. tuberculosis is a rsmd-like methyltransferase	0.8776	1	186

ID	Description	Score	Start	End	Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9001	43	105	3.40.50.150
6aieC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8885	1	186	3.40.50.150
af_P0ADX9_1_198_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8878	1	185	3.40.50.150
af_K7LTE4_237_888_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8818	26	106	3.40.50.150
6aieC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.8746	1	186	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A3B9YP39-F1-model_v4	16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD	0.9825	1	127	GO:0008168 GO:0031167
AF-A0A2H0QLI4-F1-model_v4	16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD	0.9809	1	184	GO:0003676 GO:0008168 GO:0031167
AF-A0A3D5ZVG2-F1-model_v4	deleted	0.9723	24	186
AF-A0A2E0U6C8-F1-model_v4	16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD	0.9721	1	184	GO:0003676 GO:0008168 GO:0031167
AF-A0A258B0U4-F1-model_v4	16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD	0.9718	1	183	GO:0003676 GO:0008168 GO:0031167

Feature Viewer

pLDDT	pTM	Quality
94.39	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462286

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

31

216

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map