F462261

General Info

Members Datasets Scaffolds Average Seq Length
548 301 1096 152

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0330777|Ga0466972_0330777_15_464
Length 149
Sequence MHALFALLAGLVFGIGLIVSGLANPAKVLAFLDFAGSWDPSLALVMGSALAPGLLAFSFARWRSLSLLGSPMQLPDVRHIDRRLVAGSALFGIGWGLAGICPGPALVLLGSGASGAIVFVLGMVGGMLLFELLEHVRLRRAAKAGGQAA

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
294 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.58
Nodule 0
Rhizoplane 8.39
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0330777 3300044658 Bacteria 712
2 rootH1_10099415 3300003316 Bacteria 1166
3 rootH1_10025378 3300003323 Bacteria 14771
4 rootH1_10056711 3300003323 Bacteria 3681
5 Ga0070670_100040762 3300005331 Bacteria 3991
6 Ga0070670_100911144 3300005331 Bacteria 797
7 Ga0068869_100135361 3300005334 Bacteria 1898
8 Ga0068869_100641811 3300005334 Bacteria 900
9 Ga0068869_101361056 3300005334 Bacteria 627
10 Ga0070682_100111349 3300005337 Bacteria 1825
11 Ga0070682_100387671 3300005337 Bacteria 1053
12 Ga0068868_100010593 3300005338 Bacteria 6682
13 Ga0070660_100119570 3300005339 Bacteria 2102
14 Ga0070660_100167213 3300005339 Bacteria 1775
15 Ga0070689_100140261 3300005340 Bacteria 1944
16 Ga0070687_100136042 3300005343 Bacteria 1425
17 Ga0070661_100219561 3300005344 Bacteria 1458
18 Ga0070661_100366095 3300005344 Bacteria 1134
19 Ga0070661_100581243 3300005344 Bacteria 904
20 Ga0070661_101559127 3300005344 Bacteria 558
21 Ga0070692_10072456 3300005345 Bacteria 1838
22 Ga0070668_100024387 3300005347 Bacteria 4582
23 Ga0070668_100099966 3300005347 Bacteria 2297
24 Ga0070668_100155298 3300005347 Bacteria 1853
25 Ga0070668_100669729 3300005347 Bacteria 913
26 Ga0070668_101503318 3300005347 Bacteria 616
27 Ga0070669_100701268 3300005353 Bacteria 855
28 Ga0070671_100044096 3300005355 Bacteria 3705
29 Ga0070671_100074720 3300005355 Bacteria 2832
30 Ga0070671_100160904 3300005355 Bacteria 1898
31 Ga0070674_100104667 3300005356 Bacteria 2068
32 Ga0070688_100223141 3300005365 Bacteria 1329
33 Ga0070713_101644312 3300005436 Bacteria 623
34 Ga0070701_10019913 3300005438 Bacteria 3175
35 Ga0070705_100262031 3300005440 Bacteria 1220
36 Ga0070700_100129407 3300005441 Bacteria 1701
37 Ga0070700_101234491 3300005441 Bacteria 625
38 Ga0070694_100330996 3300005444 Bacteria 1175
39 Ga0070663_100016682 3300005455 Bacteria 4777
40 Ga0070663_100042577 3300005455 Bacteria 3191
41 Ga0070663_100083402 3300005455 Bacteria 2354
42 Ga0070678_100031295 3300005456 Bacteria 3668
43 Ga0070678_100187600 3300005456 Bacteria 1698
44 Ga0070678_100722661 3300005456 Bacteria 899
45 Ga0070662_100333401 3300005457 Bacteria 1240
46 Ga0070662_100458712 3300005457 Bacteria 1059
47 Ga0070681_10037621 3300005458 Bacteria 4855
48 Ga0068867_101331855 3300005459 Bacteria 664
49 Ga0070685_10442464 3300005466 Bacteria 909
50 Ga0070706_101497683 3300005467 Bacteria 617
51 Ga0070698_100388830 3300005471 Bacteria 1328
52 Ga0070679_100756513 3300005530 Bacteria 914
53 Ga0070684_100532104 3300005535 Bacteria 1090
54 Ga0068853_100121470 3300005539 Bacteria 2331
55 Ga0068853_100216639 3300005539 Bacteria 1747
56 Ga0068853_100399708 3300005539 Bacteria 1286
57 Ga0068853_100575096 3300005539 Bacteria 1069
58 Ga0068853_101230157 3300005539 Bacteria 723
59 Ga0070672_100085525 3300005543 Bacteria 2535
60 Ga0070672_100939166 3300005543 Bacteria 765
61 Ga0070686_100091680 3300005544 Bacteria 2034
62 Ga0070693_100022656 3300005547 Bacteria 3343
63 Ga0070693_100202946 3300005547 Bacteria 1289
64 Ga0070665_100010436 3300005548 Bacteria 9398
65 Ga0070665_100016851 3300005548 Bacteria 7326
66 Ga0070665_100097577 3300005548 Bacteria 2943
67 Ga0070665_100200977 3300005548 Bacteria 1993
68 Ga0070665_100358754 3300005548 Bacteria 1463
69 Ga0070665_100527249 3300005548 Bacteria 1193
70 Ga0070665_100700839 3300005548 Bacteria 1026
71 Ga0070704_100208883 3300005549 Bacteria 1581
72 Ga0068855_100009486 3300005563 Bacteria 11753
73 Ga0070664_100060691 3300005564 Bacteria 3220
74 Ga0070664_100244127 3300005564 Bacteria 1613
75 Ga0070664_100263651 3300005564 Bacteria 1551
76 Ga0070664_100374398 3300005564 Bacteria 1299
77 Ga0068857_101825723 3300005577 Bacteria 595
78 Ga0068856_100094872 3300005614 Bacteria 2970
79 Ga0068856_100521733 3300005614 Bacteria 1209
80 Ga0068856_101044223 3300005614 Bacteria 835
81 Ga0070702_100099838 3300005615 Bacteria 1778
82 Ga0070702_100549720 3300005615 Bacteria 857
83 Ga0070702_100894485 3300005615 Bacteria 695
84 Ga0068852_100449299 3300005616 Bacteria 1276
85 Ga0068852_100925707 3300005616 Bacteria 889
86 Ga0068859_100458608 3300005617 Bacteria 1370
87 Ga0068859_102261960 3300005617 Bacteria 600
88 Ga0068864_100041216 3300005618 Bacteria 3949
89 Ga0068864_100584581 3300005618 Bacteria 1082
90 Ga0068864_101514113 3300005618 Bacteria 674
91 Ga0068866_10472129 3300005718 Bacteria 825
92 Ga0068861_100167847 3300005719 Bacteria 1816
93 Ga0068861_100185325 3300005719 Bacteria 1735
94 Ga0068861_100285293 3300005719 Bacteria 1423
95 Ga0068861_100522772 3300005719 Bacteria 1076
96 Ga0068861_100713219 3300005719 Bacteria 933
97 Ga0068870_10051822 3300005840 Bacteria 2174
98 Ga0068870_10143139 3300005840 Bacteria 1401
99 Ga0068863_100240149 3300005841 Bacteria 1749
100 Ga0068863_100460307 3300005841 Bacteria 1249
101 Ga0068858_100210817 3300005842 Bacteria 1838
102 Ga0068858_100314870 3300005842 Bacteria 1495
103 Ga0068858_100620306 3300005842 Bacteria 1050
104 Ga0068860_100120295 3300005843 Bacteria 2514
105 Ga0068860_100131485 3300005843 Bacteria 2402
106 Ga0068860_101080212 3300005843 Bacteria 821
107 Ga0068862_100115408 3300005844 Bacteria 2361
108 Ga0068862_100171549 3300005844 Bacteria 1942
109 Ga0068862_100244254 3300005844 Bacteria 1634
110 Ga0068862_100612742 3300005844 Bacteria 1046
111 Ga0068862_100736856 3300005844 Bacteria 958
112 Ga0068862_101709982 3300005844 Bacteria 637
113 Ga0081455_10029937 3300005937 Bacteria 4956
114 Ga0081538_10095347 3300005981 Bacteria 1520
115 Ga0081540_1001402 3300005983 Bacteria 20842
116 Ga0081540_1006969 3300005983 Bacteria 8140
117 Ga0081540_1008266 3300005983 Bacteria 7288
118 Ga0081540_1117663 3300005983 Bacteria 1110
119 Ga0081540_1149535 3300005983 Bacteria 924
120 Ga0081540_1237171 3300005983 Bacteria 641
121 Ga0081539_10035009 3300005985 Bacteria 3025
122 Ga0070717_10176183 3300006028 Bacteria 1862
123 Ga0075368_10011295 3300006042 Bacteria 3246
124 Ga0075368_10055936 3300006042 Bacteria 1573
125 Ga0075363_100244314 3300006048 Bacteria 1033
126 Ga0075363_100376843 3300006048 Bacteria 831
127 Ga0070715_10297317 3300006163 Bacteria 862
128 Ga0075367_10536807 3300006178 Bacteria 743
129 Ga0075367_11115511 3300006178 Bacteria 504
130 Ga0075369_10187713 3300006186 Bacteria 952
131 Ga0075369_10287241 3300006186 Bacteria 767
132 Ga0075366_10205784 3300006195 Bacteria 1197
133 Ga0075366_10638221 3300006195 Bacteria 661
134 Ga0097621_100205166 3300006237 Bacteria 1712
135 Ga0075370_10119832 3300006353 Bacteria 1531
136 Ga0068871_100292039 3300006358 Bacteria 1429
137 Ga0068871_101830115 3300006358 Unclassified 577
138 Ga0075430_100586806 3300006846 Bacteria 919
139 Ga0075431_100120794 3300006847 Bacteria 2703
140 Ga0075429_100163829 3300006880 Bacteria 1947
141 Ga0068865_100121003 3300006881 Bacteria 1946
142 Ga0068865_100181743 3300006881 Bacteria 1620
143 Ga0097620_100458604 3300006931 Bacteria 1370
144 Ga0097620_102261740 3300006931 Bacteria 600
145 Ga0105250_10070775 3300009092 Bacteria 1408
146 Ga0111539_10097050 3300009094 Bacteria 3462
147 Ga0111539_10235282 3300009094 Bacteria 2133
148 Ga0105245_10057496 3300009098 Bacteria 3498
149 Ga0105245_10272781 3300009098 Bacteria 1650
150 Ga0105247_11658676 3300009101 Bacteria 527
151 Ga0114129_10003546 3300009147 Bacteria 21965
152 Ga0114129_10340286 3300009147 Bacteria 1990
153 Ga0105243_10131437 3300009148 Bacteria 2124
154 Ga0105243_10716015 3300009148 Bacteria 977
155 Ga0105243_11354805 3300009148 Bacteria 731
156 Ga0105241_10360508 3300009174 Bacteria 1265
157 Ga0105241_12388473 3300009174 Bacteria 527
158 Ga0105242_10257229 3300009176 Bacteria 1576
159 Ga0105242_10393193 3300009176 Bacteria 1292
160 Ga0105242_11638758 3300009176 Bacteria 678
161 Ga0105242_12244006 3300009176 Bacteria 592
162 Ga0105248_10061755 3300009177 Bacteria 4208
163 Ga0105237_10063824 3300009545 Bacteria 3680
164 Ga0105237_10935545 3300009545 Bacteria 874
165 Ga0105237_11458098 3300009545 Bacteria 691
166 Ga0105237_12513094 3300009545 Bacteria 525
167 Ga0105238_10138539 3300009551 Bacteria 2411
168 Ga0105238_10446963 3300009551 Bacteria 1289
169 Ga0105249_10307716 3300009553 Bacteria 1592
170 Ga0105239_10166312 3300010375 Bacteria 2466
171 Ga0105239_10195271 3300010375 Bacteria 2266
172 Ga0105239_10246392 3300010375 Bacteria 2006
173 Ga0105239_10886486 3300010375 Bacteria 1024
174 Ga0105246_10009073 3300011119 Bacteria 6124
175 Ga0105246_10137796 3300011119 Bacteria 1831
176 Ga0105246_10162845 3300011119 Bacteria 1701
177 Ga0105246_10299505 3300011119 Bacteria 1297
178 Ga0157370_10330259 3300013104 Bacteria 1406
179 Ga0157374_10095933 3300013296 Bacteria 2836
180 Ga0157374_10161071 3300013296 Bacteria 2185
181 Ga0157378_10424443 3300013297 Bacteria 1315
182 Ga0157378_10797719 3300013297 Bacteria 970
183 Ga0163162_10117727 3300013306 Bacteria 2758
184 Ga0163162_10279304 3300013306 Bacteria 1802
185 Ga0163162_10873260 3300013306 Bacteria 1014
186 Ga0157375_10165213 3300013308 Bacteria 2358
187 Ga0157375_10177677 3300013308 Bacteria 2279
188 Ga0157375_11064282 3300013308 Bacteria 946
189 Ga0163163_10040294 3300014325 Bacteria 4560
190 Ga0163163_10101290 3300014325 Bacteria 2903
191 Ga0163163_10173543 3300014325 Bacteria 2202
192 Ga0163163_10382482 3300014325 Bacteria 1465
193 Ga0163163_10535780 3300014325 Bacteria 1233
194 Ga0157380_10135394 3300014326 Bacteria 2108
195 Ga0157380_10176042 3300014326 Bacteria 1875
196 Ga0157380_10295972 3300014326 Bacteria 1488
197 Ga0157379_10105638 3300014968 Bacteria 2527
198 Ga0157379_10117294 3300014968 Bacteria 2394
199 Ga0157376_10039339 3300014969 Bacteria 3856
200 Ga0157376_10065625 3300014969 Bacteria 3066
201 Ga0157376_10594112 3300014969 Bacteria 1101
202 Ga0163161_10057139 3300017792 Bacteria 2835
203 Ga0163161_10106700 3300017792 Bacteria 2090
204 Ga0163161_10317937 3300017792 Bacteria 1230
205 Ga0163161_10524652 3300017792 Bacteria 968
206 Ga0163161_11005255 3300017792 Bacteria 712
207 Ga0209758_1004160 3300025297 Bacteria 12329
208 Ga0209758_1009620 3300025297 Bacteria 5964
209 Ga0209758_1028372 3300025297 Bacteria 2369
210 Ga0209758_1144812 3300025297 Bacteria 611
211 Ga0207697_10051093 3300025315 Bacteria 1708
212 Ga0207688_10024115 3300025901 Bacteria 3335
213 Ga0207688_10120728 3300025901 Bacteria 1529
214 Ga0207645_10087612 3300025907 Bacteria 2001
215 Ga0207643_10049904 3300025908 Bacteria 2372
216 Ga0207643_10313146 3300025908 Bacteria 979
217 Ga0207643_10610325 3300025908 Bacteria 703
218 Ga0207654_10028015 3300025911 Bacteria 3068
219 Ga0207707_10127603 3300025912 Bacteria 2224
220 Ga0207660_10136004 3300025917 Bacteria 1875
221 Ga0207662_10071326 3300025918 Bacteria 2103
222 Ga0207649_10154563 3300025920 Bacteria 1583
223 Ga0207649_10158672 3300025920 Bacteria 1565
224 Ga0207649_10462239 3300025920 Bacteria 960
225 Ga0207652_10011754 3300025921 Bacteria 7066
226 Ga0207681_10185418 3300025923 Bacteria 1588
227 Ga0207681_10337009 3300025923 Bacteria 1204
228 Ga0207694_10110399 3300025924 Bacteria 2187
229 Ga0207650_10024981 3300025925 Bacteria 4254
230 Ga0207659_10189966 3300025926 Bacteria 1634
231 Ga0207659_10491218 3300025926 Bacteria 1038
232 Ga0207687_10012004 3300025927 Bacteria 5666
233 Ga0207687_10115821 3300025927 Bacteria 1997
234 Ga0207644_10125689 3300025931 Bacteria 1957
235 Ga0207644_10213929 3300025931 Bacteria 1525
236 Ga0207644_10233641 3300025931 Bacteria 1462
237 Ga0207644_11031465 3300025931 Bacteria 691
238 Ga0207690_10178607 3300025932 Bacteria 1596
239 Ga0207706_10043269 3300025933 Bacteria 3992
240 Ga0207706_10077663 3300025933 Bacteria 2920
241 Ga0207706_10187668 3300025933 Bacteria 1815
242 Ga0207706_10777602 3300025933 Bacteria 814
243 Ga0207686_11153209 3300025934 Bacteria 633
244 Ga0207709_10049674 3300025935 Bacteria 2562
245 Ga0207709_10103155 3300025935 Bacteria 1890
246 Ga0207670_10170577 3300025936 Bacteria 1631
247 Ga0207669_10012886 3300025937 Bacteria 4129
248 Ga0207704_10043808 3300025938 Bacteria 2646
249 Ga0207704_10612839 3300025938 Bacteria 892
250 Ga0207691_10069718 3300025940 Bacteria 3176
251 Ga0207691_10282084 3300025940 Bacteria 1429
252 Ga0207691_11054859 3300025940 Bacteria 677
253 Ga0207691_11571976 3300025940 Bacteria 536
254 Ga0207711_10049562 3300025941 Bacteria 3595
255 Ga0207689_10046810 3300025942 Bacteria 3573
256 Ga0207689_10058860 3300025942 Bacteria 3161
257 Ga0207689_10064737 3300025942 Bacteria 3007
258 Ga0207689_10172152 3300025942 Bacteria 1785
259 Ga0207679_10215427 3300025945 Bacteria 1613
260 Ga0207679_10320372 3300025945 Bacteria 1342
261 Ga0207679_10431130 3300025945 Bacteria 1165
262 Ga0207679_12050621 3300025945 Bacteria 520
263 Ga0207667_10076115 3300025949 Bacteria 3483
264 Ga0207667_10160744 3300025949 Bacteria 2310
265 Ga0207667_11575021 3300025949 Bacteria 626
266 Ga0207651_11255835 3300025960 Bacteria 665
267 Ga0207651_11496146 3300025960 Bacteria 608
268 Ga0207712_10013738 3300025961 Bacteria 5193
269 Ga0207712_10180483 3300025961 Bacteria 1658
270 Ga0207668_10083079 3300025972 Bacteria 2329
271 Ga0207668_10098931 3300025972 Bacteria 2162
272 Ga0207668_10128640 3300025972 Bacteria 1930
273 Ga0207668_10143142 3300025972 Bacteria 1841
274 Ga0207668_10181489 3300025972 Bacteria 1660
275 Ga0207668_10319723 3300025972 Bacteria 1287
276 Ga0207668_11460856 3300025972 Bacteria 617
277 Ga0207668_11946614 3300025972 Unclassified 530
278 Ga0207640_10456488 3300025981 Bacteria 1054
279 Ga0207658_10068574 3300025986 Bacteria 2677
280 Ga0207677_10004458 3300026023 Bacteria 7518
281 Ga0207677_12271635 3300026023 Bacteria 505
282 Ga0207703_11269280 3300026035 Bacteria 708
283 Ga0207639_10051605 3300026041 Bacteria 3129
284 Ga0207639_10451950 3300026041 Bacteria 1166
285 Ga0207639_12207654 3300026041 Bacteria 512
286 Ga0207678_10023123 3300026067 Bacteria 5439
287 Ga0207678_10040774 3300026067 Bacteria 4025
288 Ga0207678_10081381 3300026067 Bacteria 2772
289 Ga0207678_10228621 3300026067 Bacteria 1593
290 Ga0207708_10222769 3300026075 Bacteria 1512
291 Ga0207702_10070597 3300026078 Bacteria 3004
292 Ga0207702_10529400 3300026078 Bacteria 1151
293 Ga0207702_10899480 3300026078 Bacteria 877
294 Ga0207648_10059592 3300026089 Bacteria 3329
295 Ga0207676_10130151 3300026095 Bacteria 2138
296 Ga0207676_10660092 3300026095 Bacteria 1010
297 Ga0207676_11646853 3300026095 Bacteria 640
298 Ga0207674_10071001 3300026116 Bacteria 3500
299 Ga0207675_100059701 3300026118 Bacteria 3559
300 Ga0207675_100073854 3300026118 Bacteria 3191
301 Ga0207675_100450372 3300026118 Bacteria 1275
302 Ga0207675_100516126 3300026118 Bacteria 1191
303 Ga0207683_10055566 3300026121 Bacteria 3472
304 Ga0207683_10088775 3300026121 Bacteria 2751
305 Ga0207683_10191767 3300026121 Bacteria 1856
306 Ga0207683_10302145 3300026121 Bacteria 1464
307 Ga0207698_10308407 3300026142 Bacteria 1477
308 Ga0207698_11210457 3300026142 Bacteria 769
309 Ga0209813_10024519 3300027866 Bacteria 1726
310 Ga0268266_10035789 3300028379 Bacteria 4222
311 Ga0268266_10080790 3300028379 Bacteria 2833
312 Ga0268266_10132961 3300028379 Bacteria 2226
313 Ga0268266_10251262 3300028379 Bacteria 1635
314 Ga0268266_10372954 3300028379 Bacteria 1344
315 Ga0268266_10604655 3300028379 Bacteria 1053
316 Ga0268265_10164623 3300028380 Bacteria 1888
317 Ga0268265_10501874 3300028380 Bacteria 1143
318 Ga0268265_10669392 3300028380 Bacteria 999
319 Ga0268264_10173271 3300028381 Bacteria 1953
320 Ga0268264_10927350 3300028381 Bacteria 875
321 Ga0268264_11661285 3300028381 Bacteria 649
322 Ga0265326_10030475 3300028558 Bacteria 1537
323 Ga0307515_10277233 3300028794 Bacteria 1389
324 Ga0307515_10299731 3300028794 Bacteria 1294
325 Ga0307513_10408775 3300031456 Bacteria 1090
326 Ga0307509_10164012 3300031507 Bacteria 2114
327 Ga0307516_10002331 3300031730 Bacteria 25549
328 Ga0307516_10153363 3300031730 Bacteria 2062
329 Ga0307405_10367069 3300031731 Bacteria 1116
330 Ga0307413_10546622 3300031824 Bacteria 939
331 Ga0307412_10176908 3300031911 Bacteria 1601
332 Ga0307409_100111415 3300031995 Bacteria 2296
333 Ga0307416_100316117 3300032002 Bacteria 1561
334 Ga0307416_100713383 3300032002 Bacteria 1093
335 Ga0307416_102391148 3300032002 Bacteria 628
336 Ga0307414_11668979 3300032004 Bacteria 594
337 Ga0307411_10079065 3300032005 Bacteria 2257
338 Ga0307411_10392382 3300032005 Bacteria 1145
339 Ga0307415_100701358 3300032126 Bacteria 913
340 Ga0307510_10076580 3300033180 Bacteria 3289
341 Ga0373926_0080164 3300035083 Bacteria 1207
342 Ga0373936_0323543 3300035113 Bacteria 699
343 Ga0373943_0224277 3300035170 Bacteria 1048
344 Ga0373946_0001244 3300035171 Bacteria 8814
345 Ga0373931_0685744 3300035691 Bacteria 676
346 Ga0373935_1087748 3300035692 Bacteria 595
347 Ga0373927_0003220 3300035695 Bacteria 11755
348 Ga0373927_0078170 3300035695 Bacteria 2143
349 Ga0373947_0063437 3300035725 Bacteria 2251
350 Ga0373947_0282650 3300035725 Bacteria 1103
351 Ga0439466_0199428 3300041411 Bacteria 609
352 Ga0451791_1397224 3300041451 Bacteria 566
353 Ga0451797_0167410 3300041453 Bacteria 1502
354 Ga0451795_0980569 3300041456 Bacteria 911
355 Ga0451800_0209017 3300041459 Bacteria 940
356 Ga0451802_1811305 3300041460 Bacteria 1339
357 Ga0451807_1762801 3300041486 Unclassified 626
358 Ga0439431_0038385 3300041997 Bacteria 1212
359 Ga0466972_0079839 3300044658 Bacteria 1558
360 Ga0466966_0019429 3300044684 Bacteria 4469
361 Ga0453684_2370038 3300044712 Bacteria 526
362 Ga0495603_0015072 3300046455 Bacteria 4674
363 Ga0495603_0073511 3300046455 Bacteria 2008
364 Ga0495629_0622018 3300046459 Bacteria 721
365 Ga0495638_0158740 3300046460 Bacteria 1306
366 Ga0495638_0202264 3300046460 Bacteria 1120
367 Ga0495638_0233231 3300046460 Bacteria 1023
368 Ga0495580_0111376 3300046472 Bacteria 1901
369 Ga0495639_0464319 3300046475 Bacteria 644
370 Ga0495664_0758066 3300046477 Bacteria 572
371 Ga0495584_0076027 3300046491 Bacteria 1689
372 Ga0495584_0385843 3300046491 Bacteria 712
373 Ga0495585_0100466 3300046492 Bacteria 1547
374 Ga0495585_0104380 3300046492 Bacteria 1513
375 Ga0495585_0216517 3300046492 Bacteria 968
376 Ga0495585_0222688 3300046492 Bacteria 951
377 Ga0495585_0534477 3300046492 Bacteria 555
378 Ga0495594_0279954 3300046499 Bacteria 950
379 Ga0495596_0219701 3300046500 Bacteria 738
380 Ga0495596_0257959 3300046500 Bacteria 676
381 Ga0495606_0256467 3300046507 Bacteria 967
382 Ga0495608_0467478 3300046511 Unclassified 766
383 Ga0495610_0045060 3300046512 Bacteria 2184
384 Ga0495616_0086038 3300046513 Bacteria 1496
385 Ga0495620_0169976 3300046515 Bacteria 845
386 Ga0495630_0115657 3300046517 Bacteria 2033
387 Ga0495631_0231003 3300046518 Bacteria 789
388 Ga0495632_0068586 3300046519 Bacteria 1708
389 Ga0495637_0141622 3300046520 Bacteria 912
390 Ga0495643_0090137 3300046522 Bacteria 1583
391 Ga0495644_0080853 3300046523 Bacteria 1225
392 Ga0495644_0083750 3300046523 Bacteria 1202
393 Ga0495666_0148254 3300046526 Bacteria 1092
394 Ga0495642_0193221 3300046528 Bacteria 887
395 Ga0495598_0017096 3300046537 Bacteria 1864
396 Ga0495609_0148202 3300046538 Bacteria 999
397 Ga0495633_0323484 3300046558 Bacteria 700
398 Ga0495656_0011449 3300046615 Bacteria 3256
399 Ga0495656_0084044 3300046615 Bacteria 1443
400 Ga0495611_0011896 3300046648 Bacteria 3694
401 Ga0495611_0089033 3300046648 Bacteria 1425
402 Ga0495611_0372211 3300046648 Bacteria 654
403 Ga0495625_0109161 3300046660 Bacteria 1893
404 Ga0495635_0696184 3300046663 Bacteria 659
405 Ga0495659_0024921 3300046664 Bacteria 2044
406 Ga0495661_0086046 3300046665 Bacteria 1800
407 Ga0495588_0011486 3300046674 Bacteria 4158
408 Ga0495647_0021785 3300046681 Bacteria 2311
409 Ga0495669_0003692 3300046684 Bacteria 6299
410 Ga0495669_0033457 3300046684 Bacteria 2262
411 Ga0495669_0372161 3300046684 Bacteria 691
412 Ga0495669_0488675 3300046684 Bacteria 598
413 Ga0495613_0341873 3300046689 Bacteria 1029
414 Ga0495670_0027253 3300046691 Bacteria 2830
415 Ga0495671_0227340 3300046692 Bacteria 903
416 Ga0495671_0272340 3300046692 Bacteria 816
417 Ga0495671_0280318 3300046692 Bacteria 803
418 Ga0495649_0055695 3300046694 Bacteria 2136
419 Ga0495589_0134656 3300046794 Bacteria 1185
420 Ga0495589_0158940 3300046794 Bacteria 1077
421 Ga0495600_0201984 3300046809 Bacteria 1276
422 Ga0495581_0243131 3300047315 Bacteria 1052
423 Ga0495604_0272601 3300047317 Bacteria 1146
424 Ga0495674_0419857 3300047319 Bacteria 1078
425 Ga0495676_0053509 3300047321 Bacteria 3216
426 Ga0495683_0103300 3300047323 Bacteria 1368
427 Ga0495677_0027970 3300047445 Bacteria 2046
428 Ga0495677_0095919 3300047445 Bacteria 1120
429 Ga0495679_047596 3300047446 Bacteria 1301
430 Ga0495685_094719 3300047447 Bacteria 988
431 Ga0495673_0158206 3300047469 Bacteria 871
432 Ga0495686_0074175 3300047472 Bacteria 2088
433 Ga0495615_0031917 3300048090 Bacteria 1267
434 Ga0496100_0066677 3300048903 Bacteria 2388
435 Ga0496100_0230818 3300048903 Bacteria 1362
436 Ga0496101_0008079 3300048904 Bacteria 6862
437 Ga0496101_0117344 3300048904 Bacteria 2009
438 Ga0496101_0186085 3300048904 Bacteria 1601
439 Ga0496101_0378813 3300048904 Bacteria 1113
440 Ga0496102_0011342 3300048905 Bacteria 7677
441 Ga0496102_0034653 3300048905 Bacteria 4541
442 Ga0496102_0216806 3300048905 Bacteria 1804
443 Ga0496103_0012871 3300048906 Bacteria 4962
444 Ga0496103_0076129 3300048906 Bacteria 2105
445 Ga0496103_0383465 3300048906 Bacteria 903
446 Ga0496104_0003387 3300048907 Bacteria 13766
447 Ga0496104_0079559 3300048907 Bacteria 3124
448 Ga0496104_1771553 3300048907 Bacteria 520
449 Ga0496105_0036365 3300048908 Bacteria 4057
450 Ga0496105_0161003 3300048908 Bacteria 1842
451 Ga0496106_0021224 3300048909 Bacteria 4822
452 Ga0496106_0024649 3300048909 Bacteria 4473
453 Ga0496106_0120637 3300048909 Bacteria 2049
454 Ga0496106_0131134 3300048909 Bacteria 1966
455 Ga0496107_0005112 3300048910 Bacteria 8947
456 Ga0496108_0000388 3300048911 Bacteria 36580
457 Ga0496108_0038507 3300048911 Bacteria 3983
458 Ga0496108_0080510 3300048911 Bacteria 2759
459 Ga0496108_0322978 3300048911 Bacteria 1346
460 Ga0496109_0000417 3300048912 Bacteria 37586
461 Ga0496109_0093107 3300048912 Bacteria 2788
462 Ga0496109_0377328 3300048912 Bacteria 1339
463 Ga0496110_0004416 3300048913 Bacteria 10892
464 Ga0496110_0113083 3300048913 Bacteria 2441
465 Ga0496110_0410533 3300048913 Bacteria 1234
466 Ga0496111_0001940 3300048914 Bacteria 12250
467 Ga0496111_0050387 3300048914 Bacteria 3004
468 Ga0496112_0000388 3300048915 Bacteria 28833
469 Ga0496112_0219691 3300048915 Bacteria 1856
470 Ga0496113_0001003 3300048916 Bacteria 15137
471 Ga0496113_0154014 3300048916 Bacteria 1814
472 Ga0496114_0018421 3300048917 Bacteria 5645
473 Ga0496115_0813804 3300048918 Bacteria 726
474 Ga0496118_0110184 3300048921 Bacteria 1830
475 Ga0496119_0136341 3300048922 Bacteria 1331
476 Ga0496121_0063071 3300048924 Bacteria 3031
477 Ga0496121_0072549 3300048924 Bacteria 2763
478 Ga0496121_0205181 3300048924 Bacteria 1401
479 Ga0496121_0245037 3300048924 Bacteria 1246
480 Ga0496121_0542097 3300048924 Bacteria 729
481 Ga0496124_0160265 3300048927 Bacteria 1754
482 Ga0496124_0545913 3300048927 Bacteria 766
483 Ga0496125_0000207 3300048928 Bacteria 122897
484 Ga0496125_0124897 3300048928 Bacteria 1826
485 Ga0496126_0004519 3300048929 Bacteria 16558
486 Ga0496126_0367648 3300048929 Bacteria 1173
487 Ga0496126_0929666 3300048929 Bacteria 657
488 Ga0495682_0022820 3300049460 Bacteria 2339
489 Ga0501032_0176106 3300049569 Bacteria 1401
490 Ga0501033_0045402 3300049570 Bacteria 3270
491 Ga0501037_0250265 3300049573 Bacteria 1240
492 Ga0501038_0169231 3300049574 Bacteria 1770
493 Ga0501038_0815061 3300049574 Bacteria 693
494 Ga0501042_0118863 3300049578 Bacteria 1903
495 Ga0501042_0271465 3300049578 Bacteria 1225
496 Ga0501043_0029010 3300049579 Bacteria 4344
497 Ga0501046_0084217 3300049580 Bacteria 2453
498 Ga0501048_0061689 3300049582 Bacteria 2655
499 Ga0501067_0043325 3300049583 Unclassified 2499
500 Ga0501071_0290736 3300049587 Bacteria 1238
501 Ga0501072_0788967 3300049588 Bacteria 744
502 Ga0501076_0190300 3300049592 Bacteria 1674
503 Ga0501080_0194225 3300049742 Bacteria 1865
504 Ga0501035_0313522 3300049822 Bacteria 1319
505 Ga0501035_0839445 3300049822 Bacteria 731
506 nmdc:mga03683_140779_c1 3300050489 Bacteria 1084
507 nmdc:mga03n38_942580_c1 3300050490 Bacteria 509
508 nmdc:mga00v17_65810_c1 3300050491 Bacteria 2237
509 nmdc:mga0yw44_42647_c1 3300050492 Bacteria 2706
510 nmdc:mga0k408_276655_c1 3300050493 Bacteria 1002
511 nmdc:mga0k408_391095_c1 3300050493 Bacteria 828
512 nmdc:mga0k408_495954_c1 3300050493 Bacteria 724
513 nmdc:mga06z11_439176_c1 3300050494 Bacteria 788
514 nmdc:mga06z11_87247_c1 3300050494 Bacteria 1687
515 nmdc:mga07m45_253987_c1 3300050496 Bacteria 1023
516 nmdc:mga05p37_1413454_c1 3300050507 Bacteria 700
517 nmdc:mga05p37_3658_c1 3300050507 Bacteria 17973
518 nmdc:mga05p37_410608_c1 3300050507 Bacteria 599
519 nmdc:mga0qj67_41272_c1 3300050509 Bacteria 3629
520 nmdc:mga06r32_171146_c1 3300050510 Bacteria 2156
521 nmdc:mga08y16_449486_c1 3300050511 Bacteria 1314
522 nmdc:mga08y16_864081_c1 3300050511 Bacteria 893
523 nmdc:mga0n895_273166_c1 3300050512 Bacteria 1714
524 nmdc:mga0sz30_417906_c1 3300050516 Bacteria 601
525 Ga0495655_0034225 3300053083 Bacteria 1256
526 Ga0495655_0200509 3300053083 Unclassified 652
527 Ga0500644_0029499 3300053088 Bacteria 1726
528 Ga0500583_0123729 3300053092 Bacteria 1280
529 Ga0500566_0052374 3300053094 Bacteria 2332
530 Ga0500641_0022627 3300053096 Bacteria 2409
531 Ga0500554_003991 3300053102 Bacteria 3079
532 Ga0500595_000726 3300053119 Bacteria 19589
533 Ga0500642_0288334 3300053130 Bacteria 744
534 Ga0500655_056935 3300053133 Bacteria 784
535 Ga0500658_0205908 3300053134 Bacteria 900
536 Ga0500559_0205332 3300053136 Bacteria 929
537 Ga0500577_0038068 3300053142 Bacteria 1734
538 Ga0500577_0056802 3300053142 Bacteria 1491
539 Ga0500588_0159374 3300053146 Bacteria 821
540 Ga0500603_053915 3300053150 Bacteria 1108
541 Ga0500634_0069919 3300053161 Bacteria 1839
542 Ga0500638_001215 3300053162 Bacteria 7810
543 Ga0500637_0001154 3300053178 Bacteria 10952
544 Ga0500645_003603 3300053730 Bacteria 6215
545 Ga0500645_028134 3300053730 Bacteria 1703
546 Ga0500661_004124 3300055283 Bacteria 2716
547 Ga0501082_0069762 3300060353 Bacteria 3027
548 Ga0530510_0194959 3300061734 Bacteria 1504
549 Ga0466972_0330777
550 rootH1_10099415
551 rootH1_10025378
552 rootH1_10056711
553 Ga0070670_100040762
554 Ga0070670_100911144
555 Ga0068869_100135361
556 Ga0068869_100641811
557 Ga0068869_101361056
558 Ga0070682_100111349
559 Ga0070682_100387671
560 Ga0068868_100010593
561 Ga0070660_100119570
562 Ga0070660_100167213
563 Ga0070689_100140261
564 Ga0070687_100136042
565 Ga0070661_100219561
566 Ga0070661_100366095
567 Ga0070661_100581243
568 Ga0070661_101559127
569 Ga0070692_10072456
570 Ga0070668_100024387
571 Ga0070668_100099966
572 Ga0070668_100155298
573 Ga0070668_100669729
574 Ga0070668_101503318
575 Ga0070669_100701268
576 Ga0070671_100044096
577 Ga0070671_100074720
578 Ga0070671_100160904
579 Ga0070674_100104667
580 Ga0070688_100223141
581 Ga0070713_101644312
582 Ga0070701_10019913
583 Ga0070705_100262031
584 Ga0070700_100129407
585 Ga0070700_101234491
586 Ga0070694_100330996
587 Ga0070663_100016682
588 Ga0070663_100042577
589 Ga0070663_100083402
590 Ga0070678_100031295
591 Ga0070678_100187600
592 Ga0070678_100722661
593 Ga0070662_100333401
594 Ga0070662_100458712
595 Ga0070681_10037621
596 Ga0068867_101331855
597 Ga0070685_10442464
598 Ga0070706_101497683
599 Ga0070698_100388830
600 Ga0070679_100756513
601 Ga0070684_100532104
602 Ga0068853_100121470
603 Ga0068853_100216639
604 Ga0068853_100399708
605 Ga0068853_100575096
606 Ga0068853_101230157
607 Ga0070672_100085525
608 Ga0070672_100939166
609 Ga0070686_100091680
610 Ga0070693_100022656
611 Ga0070693_100202946
612 Ga0070665_100010436
613 Ga0070665_100016851
614 Ga0070665_100097577
615 Ga0070665_100200977
616 Ga0070665_100358754
617 Ga0070665_100527249
618 Ga0070665_100700839
619 Ga0070704_100208883
620 Ga0068855_100009486
621 Ga0070664_100060691
622 Ga0070664_100244127
623 Ga0070664_100263651
624 Ga0070664_100374398
625 Ga0068857_101825723
626 Ga0068856_100094872
627 Ga0068856_100521733
628 Ga0068856_101044223
629 Ga0070702_100099838
630 Ga0070702_100549720
631 Ga0070702_100894485
632 Ga0068852_100449299
633 Ga0068852_100925707
634 Ga0068859_100458608
635 Ga0068859_102261960
636 Ga0068864_100041216
637 Ga0068864_100584581
638 Ga0068864_101514113
639 Ga0068866_10472129
640 Ga0068861_100167847
641 Ga0068861_100185325
642 Ga0068861_100285293
643 Ga0068861_100522772
644 Ga0068861_100713219
645 Ga0068870_10051822
646 Ga0068870_10143139
647 Ga0068863_100240149
648 Ga0068863_100460307
649 Ga0068858_100210817
650 Ga0068858_100314870
651 Ga0068858_100620306
652 Ga0068860_100120295
653 Ga0068860_100131485
654 Ga0068860_101080212
655 Ga0068862_100115408
656 Ga0068862_100171549
657 Ga0068862_100244254
658 Ga0068862_100612742
659 Ga0068862_100736856
660 Ga0068862_101709982
661 Ga0081455_10029937
662 Ga0081538_10095347
663 Ga0081540_1001402
664 Ga0081540_1006969
665 Ga0081540_1008266
666 Ga0081540_1117663
667 Ga0081540_1149535
668 Ga0081540_1237171
669 Ga0081539_10035009
670 Ga0070717_10176183
671 Ga0075368_10011295
672 Ga0075368_10055936
673 Ga0075363_100244314
674 Ga0075363_100376843
675 Ga0070715_10297317
676 Ga0075367_10536807
677 Ga0075367_11115511
678 Ga0075369_10187713
679 Ga0075369_10287241
680 Ga0075366_10205784
681 Ga0075366_10638221
682 Ga0097621_100205166
683 Ga0075370_10119832
684 Ga0068871_100292039
685 Ga0068871_101830115
686 Ga0075430_100586806
687 Ga0075431_100120794
688 Ga0075429_100163829
689 Ga0068865_100121003
690 Ga0068865_100181743
691 Ga0097620_100458604
692 Ga0097620_102261740
693 Ga0105250_10070775
694 Ga0111539_10097050
695 Ga0111539_10235282
696 Ga0105245_10057496
697 Ga0105245_10272781
698 Ga0105247_11658676
699 Ga0114129_10003546
700 Ga0114129_10340286
701 Ga0105243_10131437
702 Ga0105243_10716015
703 Ga0105243_11354805
704 Ga0105241_10360508
705 Ga0105241_12388473
706 Ga0105242_10257229
707 Ga0105242_10393193
708 Ga0105242_11638758
709 Ga0105242_12244006
710 Ga0105248_10061755
711 Ga0105237_10063824
712 Ga0105237_10935545
713 Ga0105237_11458098
714 Ga0105237_12513094
715 Ga0105238_10138539
716 Ga0105238_10446963
717 Ga0105249_10307716
718 Ga0105239_10166312
719 Ga0105239_10195271
720 Ga0105239_10246392
721 Ga0105239_10886486
722 Ga0105246_10009073
723 Ga0105246_10137796
724 Ga0105246_10162845
725 Ga0105246_10299505
726 Ga0157370_10330259
727 Ga0157374_10095933
728 Ga0157374_10161071
729 Ga0157378_10424443
730 Ga0157378_10797719
731 Ga0163162_10117727
732 Ga0163162_10279304
733 Ga0163162_10873260
734 Ga0157375_10165213
735 Ga0157375_10177677
736 Ga0157375_11064282
737 Ga0163163_10040294
738 Ga0163163_10101290
739 Ga0163163_10173543
740 Ga0163163_10382482
741 Ga0163163_10535780
742 Ga0157380_10135394
743 Ga0157380_10176042
744 Ga0157380_10295972
745 Ga0157379_10105638
746 Ga0157379_10117294
747 Ga0157376_10039339
748 Ga0157376_10065625
749 Ga0157376_10594112
750 Ga0163161_10057139
751 Ga0163161_10106700
752 Ga0163161_10317937
753 Ga0163161_10524652
754 Ga0163161_11005255
755 Ga0209758_1004160
756 Ga0209758_1009620
757 Ga0209758_1028372
758 Ga0209758_1144812
759 Ga0207697_10051093
760 Ga0207688_10024115
761 Ga0207688_10120728
762 Ga0207645_10087612
763 Ga0207643_10049904
764 Ga0207643_10313146
765 Ga0207643_10610325
766 Ga0207654_10028015
767 Ga0207707_10127603
768 Ga0207660_10136004
769 Ga0207662_10071326
770 Ga0207649_10154563
771 Ga0207649_10158672
772 Ga0207649_10462239
773 Ga0207652_10011754
774 Ga0207681_10185418
775 Ga0207681_10337009
776 Ga0207694_10110399
777 Ga0207650_10024981
778 Ga0207659_10189966
779 Ga0207659_10491218
780 Ga0207687_10012004
781 Ga0207687_10115821
782 Ga0207644_10125689
783 Ga0207644_10213929
784 Ga0207644_10233641
785 Ga0207644_11031465
786 Ga0207690_10178607
787 Ga0207706_10043269
788 Ga0207706_10077663
789 Ga0207706_10187668
790 Ga0207706_10777602
791 Ga0207686_11153209
792 Ga0207709_10049674
793 Ga0207709_10103155
794 Ga0207670_10170577
795 Ga0207669_10012886
796 Ga0207704_10043808
797 Ga0207704_10612839
798 Ga0207691_10069718
799 Ga0207691_10282084
800 Ga0207691_11054859
801 Ga0207691_11571976
802 Ga0207711_10049562
803 Ga0207689_10046810
804 Ga0207689_10058860
805 Ga0207689_10064737
806 Ga0207689_10172152
807 Ga0207679_10215427
808 Ga0207679_10320372
809 Ga0207679_10431130
810 Ga0207679_12050621
811 Ga0207667_10076115
812 Ga0207667_10160744
813 Ga0207667_11575021
814 Ga0207651_11255835
815 Ga0207651_11496146
816 Ga0207712_10013738
817 Ga0207712_10180483
818 Ga0207668_10083079
819 Ga0207668_10098931
820 Ga0207668_10128640
821 Ga0207668_10143142
822 Ga0207668_10181489
823 Ga0207668_10319723
824 Ga0207668_11460856
825 Ga0207668_11946614
826 Ga0207640_10456488
827 Ga0207658_10068574
828 Ga0207677_10004458
829 Ga0207677_12271635
830 Ga0207703_11269280
831 Ga0207639_10051605
832 Ga0207639_10451950
833 Ga0207639_12207654
834 Ga0207678_10023123
835 Ga0207678_10040774
836 Ga0207678_10081381
837 Ga0207678_10228621
838 Ga0207708_10222769
839 Ga0207702_10070597
840 Ga0207702_10529400
841 Ga0207702_10899480
842 Ga0207648_10059592
843 Ga0207676_10130151
844 Ga0207676_10660092
845 Ga0207676_11646853
846 Ga0207674_10071001
847 Ga0207675_100059701
848 Ga0207675_100073854
849 Ga0207675_100450372
850 Ga0207675_100516126
851 Ga0207683_10055566
852 Ga0207683_10088775
853 Ga0207683_10191767
854 Ga0207683_10302145
855 Ga0207698_10308407
856 Ga0207698_11210457
857 Ga0209813_10024519
858 Ga0268266_10035789
859 Ga0268266_10080790
860 Ga0268266_10132961
861 Ga0268266_10251262
862 Ga0268266_10372954
863 Ga0268266_10604655
864 Ga0268265_10164623
865 Ga0268265_10501874
866 Ga0268265_10669392
867 Ga0268264_10173271
868 Ga0268264_10927350
869 Ga0268264_11661285
870 Ga0265326_10030475
871 Ga0307515_10277233
872 Ga0307515_10299731
873 Ga0307513_10408775
874 Ga0307509_10164012
875 Ga0307516_10002331
876 Ga0307516_10153363
877 Ga0307405_10367069
878 Ga0307413_10546622
879 Ga0307412_10176908
880 Ga0307409_100111415
881 Ga0307416_100316117
882 Ga0307416_100713383
883 Ga0307416_102391148
884 Ga0307414_11668979
885 Ga0307411_10079065
886 Ga0307411_10392382
887 Ga0307415_100701358
888 Ga0307510_10076580
889 Ga0373926_0080164
890 Ga0373936_0323543
891 Ga0373943_0224277
892 Ga0373946_0001244
893 Ga0373931_0685744
894 Ga0373935_1087748
895 Ga0373927_0003220
896 Ga0373927_0078170
897 Ga0373947_0063437
898 Ga0373947_0282650
899 Ga0439466_0199428
900 Ga0451791_1397224
901 Ga0451797_0167410
902 Ga0451795_0980569
903 Ga0451800_0209017
904 Ga0451802_1811305
905 Ga0451807_1762801
906 Ga0439431_0038385
907 Ga0466972_0079839
908 Ga0466966_0019429
909 Ga0453684_2370038
910 Ga0495603_0015072
911 Ga0495603_0073511
912 Ga0495629_0622018
913 Ga0495638_0158740
914 Ga0495638_0202264
915 Ga0495638_0233231
916 Ga0495580_0111376
917 Ga0495639_0464319
918 Ga0495664_0758066
919 Ga0495584_0076027
920 Ga0495584_0385843
921 Ga0495585_0100466
922 Ga0495585_0104380
923 Ga0495585_0216517
924 Ga0495585_0222688
925 Ga0495585_0534477
926 Ga0495594_0279954
927 Ga0495596_0219701
928 Ga0495596_0257959
929 Ga0495606_0256467
930 Ga0495608_0467478
931 Ga0495610_0045060
932 Ga0495616_0086038
933 Ga0495620_0169976
934 Ga0495630_0115657
935 Ga0495631_0231003
936 Ga0495632_0068586
937 Ga0495637_0141622
938 Ga0495643_0090137
939 Ga0495644_0080853
940 Ga0495644_0083750
941 Ga0495666_0148254
942 Ga0495642_0193221
943 Ga0495598_0017096
944 Ga0495609_0148202
945 Ga0495633_0323484
946 Ga0495656_0011449
947 Ga0495656_0084044
948 Ga0495611_0011896
949 Ga0495611_0089033
950 Ga0495611_0372211
951 Ga0495625_0109161
952 Ga0495635_0696184
953 Ga0495659_0024921
954 Ga0495661_0086046
955 Ga0495588_0011486
956 Ga0495647_0021785
957 Ga0495669_0003692
958 Ga0495669_0033457
959 Ga0495669_0372161
960 Ga0495669_0488675
961 Ga0495613_0341873
962 Ga0495670_0027253
963 Ga0495671_0227340
964 Ga0495671_0272340
965 Ga0495671_0280318
966 Ga0495649_0055695
967 Ga0495589_0134656
968 Ga0495589_0158940
969 Ga0495600_0201984
970 Ga0495581_0243131
971 Ga0495604_0272601
972 Ga0495674_0419857
973 Ga0495676_0053509
974 Ga0495683_0103300
975 Ga0495677_0027970
976 Ga0495677_0095919
977 Ga0495679_047596
978 Ga0495685_094719
979 Ga0495673_0158206
980 Ga0495686_0074175
981 Ga0495615_0031917
982 Ga0496100_0066677
983 Ga0496100_0230818
984 Ga0496101_0008079
985 Ga0496101_0117344
986 Ga0496101_0186085
987 Ga0496101_0378813
988 Ga0496102_0011342
989 Ga0496102_0034653
990 Ga0496102_0216806
991 Ga0496103_0012871
992 Ga0496103_0076129
993 Ga0496103_0383465
994 Ga0496104_0003387
995 Ga0496104_0079559
996 Ga0496104_1771553
997 Ga0496105_0036365
998 Ga0496105_0161003
999 Ga0496106_0021224
1000 Ga0496106_0024649
1001 Ga0496106_0120637
1002 Ga0496106_0131134
1003 Ga0496107_0005112
1004 Ga0496108_0000388
1005 Ga0496108_0038507
1006 Ga0496108_0080510
1007 Ga0496108_0322978
1008 Ga0496109_0000417
1009 Ga0496109_0093107
1010 Ga0496109_0377328
1011 Ga0496110_0004416
1012 Ga0496110_0113083
1013 Ga0496110_0410533
1014 Ga0496111_0001940
1015 Ga0496111_0050387
1016 Ga0496112_0000388
1017 Ga0496112_0219691
1018 Ga0496113_0001003
1019 Ga0496113_0154014
1020 Ga0496114_0018421
1021 Ga0496115_0813804
1022 Ga0496118_0110184
1023 Ga0496119_0136341
1024 Ga0496121_0063071
1025 Ga0496121_0072549
1026 Ga0496121_0205181
1027 Ga0496121_0245037
1028 Ga0496121_0542097
1029 Ga0496124_0160265
1030 Ga0496124_0545913
1031 Ga0496125_0000207
1032 Ga0496125_0124897
1033 Ga0496126_0004519
1034 Ga0496126_0367648
1035 Ga0496126_0929666
1036 Ga0495682_0022820
1037 Ga0501032_0176106
1038 Ga0501033_0045402
1039 Ga0501037_0250265
1040 Ga0501038_0169231
1041 Ga0501038_0815061
1042 Ga0501042_0118863
1043 Ga0501042_0271465
1044 Ga0501043_0029010
1045 Ga0501046_0084217
1046 Ga0501048_0061689
1047 Ga0501067_0043325
1048 Ga0501071_0290736
1049 Ga0501072_0788967
1050 Ga0501076_0190300
1051 Ga0501080_0194225
1052 Ga0501035_0313522
1053 Ga0501035_0839445
1054 nmdc:mga03683_140779_c1
1055 nmdc:mga03n38_942580_c1
1056 nmdc:mga00v17_65810_c1
1057 nmdc:mga0yw44_42647_c1
1058 nmdc:mga0k408_276655_c1
1059 nmdc:mga0k408_391095_c1
1060 nmdc:mga0k408_495954_c1
1061 nmdc:mga06z11_439176_c1
1062 nmdc:mga06z11_87247_c1
1063 nmdc:mga07m45_253987_c1
1064 nmdc:mga05p37_1413454_c1
1065 nmdc:mga05p37_3658_c1
1066 nmdc:mga05p37_410608_c1
1067 nmdc:mga0qj67_41272_c1
1068 nmdc:mga06r32_171146_c1
1069 nmdc:mga08y16_449486_c1
1070 nmdc:mga08y16_864081_c1
1071 nmdc:mga0n895_273166_c1
1072 nmdc:mga0sz30_417906_c1
1073 Ga0495655_0034225
1074 Ga0495655_0200509
1075 Ga0500644_0029499
1076 Ga0500583_0123729
1077 Ga0500566_0052374
1078 Ga0500641_0022627
1079 Ga0500554_003991
1080 Ga0500595_000726
1081 Ga0500642_0288334
1082 Ga0500655_056935
1083 Ga0500658_0205908
1084 Ga0500559_0205332
1085 Ga0500577_0038068
1086 Ga0500577_0056802
1087 Ga0500588_0159374
1088 Ga0500603_053915
1089 Ga0500634_0069919
1090 Ga0500638_001215
1091 Ga0500637_0001154
1092 Ga0500645_003603
1093 Ga0500645_028134
1094 Ga0500661_004124
1095 Ga0501082_0069762
1096 Ga0530510_0194959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

142

0.98

Map