F462244

General Info

Members Datasets Scaffolds Average Seq Length
548 206 1096 178

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10181756|Ga0307405_101817563
Length 210
Sequence VAARRADGGAGARPLHHAAHGPPPRDKLGEDILIALIAFYLFATLTIASAVAVIFARNPVHSVLWLILAFFNAAGLMLLVGAEFIAMLFASLRSGFTKNLPFGIIVALVLLAEIIIAVSAWKAGPALSGREVAATTQPNIVALGQLLYSRYLLAFELAGLILLVAMVGAIVLTHRSRGDLRTPKVSRQIRRRPRDSVRKTDPEVGEGVKL

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
195 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
198 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
201 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
202 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.82
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10181756 3300031731 Bacteria 1511
2 JGI24741J21665_1006915 3300001915 Bacteria 2238
3 JGI24740J21852_10011445 3300001979 Bacteria 3376
4 JGI24740J21852_10041372 3300001979 Bacteria 1389
5 JGI24739J22299_10019880 3300001989 Bacteria 2401
6 JGI24739J22299_10064076 3300001989 Bacteria 1156
7 JGI24737J22298_10006340 3300001990 Bacteria 4044
8 JGI24735J21928_10004058 3300002067 Bacteria 4942
9 JGI24735J21928_10036848 3300002067 Bacteria 1435
10 JGI24738J21930_10026611 3300002075 Bacteria 1186
11 Ga0065715_10208645 3300005293 Bacteria 1325
12 Ga0070658_10020103 3300005327 Bacteria 5348
13 Ga0070658_10163632 3300005327 Bacteria 1867
14 Ga0070658_10230110 3300005327 Bacteria 1569
15 Ga0070658_10311786 3300005327 Bacteria 1342
16 Ga0070658_10561936 3300005327 Bacteria 987
17 Ga0070676_10051965 3300005328 Bacteria 2408
18 Ga0070676_10397820 3300005328 Bacteria 958
19 Ga0070676_10433783 3300005328 Bacteria 920
20 Ga0070683_100052250 3300005329 Bacteria 3785
21 Ga0070683_100102736 3300005329 Bacteria 2692
22 Ga0070683_100183151 3300005329 Bacteria 1988
23 Ga0070670_100005021 3300005331 Bacteria 11132
24 Ga0070670_100009978 3300005331 Bacteria 8104
25 Ga0070670_100097246 3300005331 Bacteria 2532
26 Ga0070670_100112519 3300005331 Bacteria 2346
27 Ga0070677_10164130 3300005333 Bacteria 1045
28 Ga0068869_100478414 3300005334 Bacteria 1037
29 Ga0070666_10023343 3300005335 Bacteria 4026
30 Ga0070666_10365510 3300005335 Bacteria 1034
31 Ga0070680_100295406 3300005336 Bacteria 1373
32 Ga0070680_100304985 3300005336 Bacteria 1350
33 Ga0070680_100364355 3300005336 Bacteria 1229
34 Ga0070680_100846193 3300005336 Bacteria 789
35 Ga0068868_100060359 3300005338 Bacteria 3002
36 Ga0070660_100004990 3300005339 Bacteria 9175
37 Ga0070660_100061802 3300005339 Bacteria 2909
38 Ga0070660_100062535 3300005339 Bacteria 2892
39 Ga0070660_100141912 3300005339 Bacteria 1927
40 Ga0070660_100318870 3300005339 Bacteria 1276
41 Ga0070691_10002895 3300005341 Bacteria 7695
42 Ga0070661_100005787 3300005344 Bacteria 8500
43 Ga0070661_100068547 3300005344 Bacteria 2607
44 Ga0070661_100115585 3300005344 Bacteria 2007
45 Ga0070661_100161799 3300005344 Bacteria 1696
46 Ga0070661_100164100 3300005344 Bacteria 1684
47 Ga0070692_10026954 3300005345 Bacteria 2844
48 Ga0070668_100627147 3300005347 Bacteria 943
49 Ga0070669_100094348 3300005353 Bacteria 2248
50 Ga0070675_100004792 3300005354 Bacteria 10317
51 Ga0070675_100957040 3300005354 Bacteria 786
52 Ga0070671_100002220 3300005355 Bacteria 14991
53 Ga0070671_100006497 3300005355 Bacteria 9347
54 Ga0070671_100081960 3300005355 Bacteria 2697
55 Ga0070674_100065435 3300005356 Bacteria 2551
56 Ga0070674_100113242 3300005356 Bacteria 1995
57 Ga0070673_100067292 3300005364 Bacteria 2864
58 Ga0070659_100035223 3300005366 Bacteria 3897
59 Ga0070659_100081257 3300005366 Bacteria 2588
60 Ga0070659_100144126 3300005366 Bacteria 1940
61 Ga0070659_100230841 3300005366 Bacteria 1529
62 Ga0070659_100242399 3300005366 Bacteria 1492
63 Ga0070659_100258053 3300005366 Bacteria 1446
64 Ga0070659_100268635 3300005366 Bacteria 1416
65 Ga0070659_100457318 3300005366 Bacteria 1084
66 Ga0070667_100030105 3300005367 Bacteria 4527
67 Ga0070709_10197828 3300005434 Bacteria 1422
68 Ga0070714_100120154 3300005435 Bacteria 2336
69 Ga0070713_100100355 3300005436 Bacteria 2506
70 Ga0070694_100005108 3300005444 Bacteria 7912
71 Ga0070663_100068119 3300005455 Bacteria 2583
72 Ga0070663_100122399 3300005455 Bacteria 1966
73 Ga0070663_100189607 3300005455 Bacteria 1599
74 Ga0070678_100321459 3300005456 Bacteria 1321
75 Ga0070678_100443253 3300005456 Bacteria 1136
76 Ga0070678_100504506 3300005456 Bacteria 1068
77 Ga0070662_100011636 3300005457 Bacteria 5808
78 Ga0070662_100021352 3300005457 Bacteria 4420
79 Ga0070662_100021942 3300005457 Bacteria 4364
80 Ga0070662_100287300 3300005457 Bacteria 1332
81 Ga0070662_100920457 3300005457 Bacteria 747
82 Ga0070681_10084333 3300005458 Bacteria 3129
83 Ga0070681_10137278 3300005458 Bacteria 2375
84 Ga0070681_10327886 3300005458 Bacteria 1440
85 Ga0068867_100554850 3300005459 Bacteria 996
86 Ga0070679_100126745 3300005530 Bacteria 2535
87 Ga0070679_100158524 3300005530 Bacteria 2237
88 Ga0070684_100338836 3300005535 Bacteria 1382
89 Ga0068853_100010858 3300005539 Bacteria 7379
90 Ga0068853_100089722 3300005539 Bacteria 2700
91 Ga0070672_100007246 3300005543 Bacteria 7514
92 Ga0070672_100089482 3300005543 Bacteria 2480
93 Ga0070672_100592711 3300005543 Bacteria 965
94 Ga0070693_100007262 3300005547 Bacteria 5410
95 Ga0070693_100070130 3300005547 Bacteria 2062
96 Ga0070665_100144253 3300005548 Bacteria 2384
97 Ga0068855_100292501 3300005563 Bacteria 1805
98 Ga0068855_100478008 3300005563 Bacteria 1357
99 Ga0068855_100653849 3300005563 Bacteria 1129
100 Ga0068855_100938055 3300005563 Bacteria 912
101 Ga0070664_100000441 3300005564 Bacteria 31219
102 Ga0070664_100003103 3300005564 Bacteria 13439
103 Ga0070664_100003398 3300005564 Bacteria 12850
104 Ga0070664_100010299 3300005564 Bacteria 7588
105 Ga0070664_100098245 3300005564 Bacteria 2543
106 Ga0070664_100174227 3300005564 Bacteria 1909
107 Ga0070664_100334516 3300005564 Bacteria 1374
108 Ga0070664_100505915 3300005564 Bacteria 1114
109 Ga0068857_100026577 3300005577 Bacteria 5102
110 Ga0068857_100066192 3300005577 Bacteria 3214
111 Ga0068857_100069055 3300005577 Bacteria 3146
112 Ga0068857_100335658 3300005577 Bacteria 1398
113 Ga0068854_100010766 3300005578 Bacteria 5934
114 Ga0068854_100073727 3300005578 Bacteria 2502
115 Ga0068854_100136592 3300005578 Bacteria 1877
116 Ga0068854_100267136 3300005578 Bacteria 1372
117 Ga0068856_100213031 3300005614 Bacteria 1947
118 Ga0068856_100517298 3300005614 Bacteria 1215
119 Ga0068852_100157619 3300005616 Bacteria 2116
120 Ga0068852_100322141 3300005616 Bacteria 1501
121 Ga0068852_100441479 3300005616 Bacteria 1287
122 Ga0068859_100058156 3300005617 Bacteria 3894
123 Ga0068864_100279875 3300005618 Bacteria 1557
124 Ga0068858_100058529 3300005842 Bacteria 3563
125 Ga0068858_100252127 3300005842 Bacteria 1677
126 Ga0068860_100029730 3300005843 Bacteria 5256
127 Ga0081539_10010799 3300005985 Bacteria 7348
128 Ga0070716_100038260 3300006173 Bacteria 2656
129 Ga0075428_100928338 3300006844 Bacteria 923
130 Ga0075433_10419224 3300006852 Bacteria 1180
131 Ga0075434_101597483 3300006871 Bacteria 661
132 Ga0097620_100058158 3300006931 Bacteria 3894
133 Ga0105240_10075786 3300009093 Bacteria 4149
134 Ga0105245_10038132 3300009098 Bacteria 4275
135 Ga0105245_10591072 3300009098 Bacteria 1135
136 Ga0105241_10243468 3300009174 Bacteria 1521
137 Ga0105242_10107352 3300009176 Bacteria 2374
138 Ga0105248_10011512 3300009177 Bacteria 9749
139 Ga0105248_10105112 3300009177 Bacteria 3183
140 Ga0105237_10008650 3300009545 Bacteria 11000
141 Ga0105237_10150731 3300009545 Bacteria 2322
142 Ga0105237_10362613 3300009545 Bacteria 1453
143 Ga0105238_10066631 3300009551 Bacteria 3602
144 Ga0105239_10035829 3300010375 Bacteria 5448
145 Ga0157373_10080625 3300013100 Bacteria 2295
146 Ga0157373_10136670 3300013100 Bacteria 1723
147 Ga0157373_10144242 3300013100 Bacteria 1675
148 Ga0157373_10172741 3300013100 Bacteria 1521
149 Ga0157373_10338114 3300013100 Bacteria 1073
150 Ga0157373_10621412 3300013100 Bacteria 787
151 Ga0157371_10208682 3300013102 Bacteria 1401
152 Ga0157371_10479771 3300013102 Bacteria 916
153 Ga0157370_10391244 3300013104 Bacteria 1280
154 Ga0157370_11312100 3300013104 Bacteria 652
155 Ga0157369_10126026 3300013105 Bacteria 2715
156 Ga0157369_10174404 3300013105 Bacteria 2264
157 Ga0157369_10723172 3300013105 Bacteria 1025
158 Ga0157369_11094431 3300013105 Bacteria 815
159 Ga0157369_11294917 3300013105 Bacteria 743
160 Ga0157369_11294923 3300013105 Bacteria 743
161 Ga0157374_10468234 3300013296 Bacteria 1262
162 Ga0163162_11859341 3300013306 Bacteria 689
163 Ga0157372_10055282 3300013307 Bacteria 4432
164 Ga0157372_10281307 3300013307 Bacteria 1934
165 Ga0157372_10572047 3300013307 Bacteria 1317
166 Ga0157372_11662224 3300013307 Bacteria 735
167 Ga0157375_10033140 3300013308 Bacteria 4905
168 Ga0163163_10216651 3300014325 Bacteria 1963
169 Ga0157377_10241837 3300014745 Bacteria 1165
170 Ga0213876_10252363 3300021384 Bacteria 937
171 Ga0207656_10108980 3300025321 Bacteria 1278
172 Ga0207682_10043422 3300025893 Bacteria 1840
173 Ga0207682_10064619 3300025893 Bacteria 1538
174 Ga0207688_10048302 3300025901 Bacteria 2378
175 Ga0207680_10033044 3300025903 Bacteria 2947
176 Ga0207680_10156593 3300025903 Bacteria 1524
177 Ga0207647_10000383 3300025904 Bacteria 36032
178 Ga0207699_10429751 3300025906 Bacteria 944
179 Ga0207645_10063591 3300025907 Bacteria 2358
180 Ga0207645_10278548 3300025907 Bacteria 1110
181 Ga0207645_10292449 3300025907 Bacteria 1083
182 Ga0207705_10007304 3300025909 Bacteria 8125
183 Ga0207705_10012125 3300025909 Bacteria 6230
184 Ga0207705_10018253 3300025909 Bacteria 5016
185 Ga0207705_10068266 3300025909 Bacteria 2574
186 Ga0207705_10281457 3300025909 Bacteria 1273
187 Ga0207705_10348074 3300025909 Bacteria 1141
188 Ga0207705_10566286 3300025909 Bacteria 883
189 Ga0207705_10620790 3300025909 Bacteria 841
190 Ga0207707_10072484 3300025912 Bacteria 3002
191 Ga0207707_10263047 3300025912 Bacteria 1497
192 Ga0207707_10846014 3300025912 Bacteria 759
193 Ga0207695_10014240 3300025913 Bacteria 9433
194 Ga0207671_10046739 3300025914 Bacteria 3203
195 Ga0207671_10415931 3300025914 Bacteria 1070
196 Ga0207671_10663908 3300025914 Bacteria 830
197 Ga0207660_10005696 3300025917 Bacteria 8084
198 Ga0207660_10008412 3300025917 Bacteria 6676
199 Ga0207660_10176360 3300025917 Bacteria 1657
200 Ga0207660_10296874 3300025917 Bacteria 1286
201 Ga0207657_10002827 3300025919 Bacteria 18655
202 Ga0207657_10008828 3300025919 Bacteria 10195
203 Ga0207657_10056292 3300025919 Bacteria 3393
204 Ga0207657_10263573 3300025919 Bacteria 1371
205 Ga0207649_10031705 3300025920 Bacteria 3144
206 Ga0207649_10035789 3300025920 Bacteria 2986
207 Ga0207649_10041683 3300025920 Bacteria 2795
208 Ga0207649_10060405 3300025920 Bacteria 2382
209 Ga0207649_10061927 3300025920 Bacteria 2357
210 Ga0207649_10092659 3300025920 Bacteria 1981
211 Ga0207649_10301499 3300025920 Bacteria 1171
212 Ga0207649_10339207 3300025920 Bacteria 1109
213 Ga0207649_10369740 3300025920 Bacteria 1066
214 Ga0207652_10032665 3300025921 Bacteria 4377
215 Ga0207652_10269657 3300025921 Bacteria 1535
216 Ga0207652_10592704 3300025921 Bacteria 994
217 Ga0207652_10603903 3300025921 Bacteria 984
218 Ga0207652_10671119 3300025921 Bacteria 926
219 Ga0207652_10901944 3300025921 Bacteria 781
220 Ga0207681_10098117 3300025923 Bacteria 2107
221 Ga0207694_10166063 3300025924 Bacteria 1785
222 Ga0207650_10003956 3300025925 Bacteria 10138
223 Ga0207650_10007164 3300025925 Bacteria 7600
224 Ga0207650_10027499 3300025925 Bacteria 4072
225 Ga0207650_10051593 3300025925 Bacteria 3044
226 Ga0207659_10138372 3300025926 Bacteria 1887
227 Ga0207687_10775014 3300025927 Bacteria 817
228 Ga0207700_10111473 3300025928 Bacteria 2202
229 Ga0207644_10001259 3300025931 Bacteria 16288
230 Ga0207644_10003074 3300025931 Bacteria 10749
231 Ga0207644_10132916 3300025931 Bacteria 1907
232 Ga0207690_10016248 3300025932 Bacteria 4524
233 Ga0207690_10021033 3300025932 Bacteria 4041
234 Ga0207690_10025233 3300025932 Bacteria 3729
235 Ga0207690_10071838 3300025932 Bacteria 2388
236 Ga0207690_10205922 3300025932 Bacteria 1497
237 Ga0207690_10269587 3300025932 Bacteria 1322
238 Ga0207690_10353662 3300025932 Bacteria 1162
239 Ga0207706_10009096 3300025933 Bacteria 9133
240 Ga0207706_10019074 3300025933 Bacteria 6170
241 Ga0207706_10031077 3300025933 Bacteria 4759
242 Ga0207706_10043226 3300025933 Bacteria 3994
243 Ga0207706_10624909 3300025933 Bacteria 924
244 Ga0207686_10041959 3300025934 Bacteria 2793
245 Ga0207709_10018615 3300025935 Bacteria 3892
246 Ga0207669_10049446 3300025937 Bacteria 2506
247 Ga0207669_10069963 3300025937 Bacteria 2198
248 Ga0207665_10511454 3300025939 Bacteria 929
249 Ga0207691_10006923 3300025940 Bacteria 10933
250 Ga0207691_10011704 3300025940 Bacteria 8424
251 Ga0207691_10593880 3300025940 Bacteria 937
252 Ga0207711_10004839 3300025941 Bacteria 11447
253 Ga0207689_10039447 3300025942 Bacteria 3909
254 Ga0207661_10013536 3300025944 Bacteria 5957
255 Ga0207661_10515297 3300025944 Bacteria 1093
256 Ga0207679_10005151 3300025945 Bacteria 8185
257 Ga0207679_10012595 3300025945 Bacteria 5518
258 Ga0207679_10013857 3300025945 Bacteria 5287
259 Ga0207679_10032241 3300025945 Bacteria 3675
260 Ga0207679_10125481 3300025945 Bacteria 2050
261 Ga0207679_10213928 3300025945 Bacteria 1618
262 Ga0207679_10264820 3300025945 Bacteria 1468
263 Ga0207679_10552338 3300025945 Bacteria 1033
264 Ga0207667_10008988 3300025949 Bacteria 11821
265 Ga0207667_10049101 3300025949 Bacteria 4459
266 Ga0207667_10078192 3300025949 Bacteria 3429
267 Ga0207667_10089725 3300025949 Bacteria 3177
268 Ga0207667_10330974 3300025949 Bacteria 1555
269 Ga0207667_10702928 3300025949 Bacteria 1013
270 Ga0207651_10047623 3300025960 Bacteria 2892
271 Ga0207712_10002461 3300025961 Bacteria 11942
272 Ga0207640_10026483 3300025981 Bacteria 3521
273 Ga0207640_10112850 3300025981 Bacteria 1931
274 Ga0207640_10121668 3300025981 Bacteria 1871
275 Ga0207640_10909176 3300025981 Bacteria 769
276 Ga0207658_10082901 3300025986 Bacteria 2463
277 Ga0207677_10111625 3300026023 Bacteria 2037
278 Ga0207677_10664827 3300026023 Bacteria 921
279 Ga0207703_10002707 3300026035 Bacteria 15178
280 Ga0207639_10106766 3300026041 Bacteria 2273
281 Ga0207639_10184998 3300026041 Bacteria 1775
282 Ga0207678_10082608 3300026067 Bacteria 2749
283 Ga0207678_10112886 3300026067 Bacteria 2318
284 Ga0207678_10220749 3300026067 Bacteria 1622
285 Ga0207678_10266163 3300026067 Bacteria 1469
286 Ga0207702_10070314 3300026078 Bacteria 3010
287 Ga0207641_10254573 3300026088 Bacteria 1641
288 Ga0207648_10198908 3300026089 Bacteria 1777
289 Ga0207648_10493987 3300026089 Bacteria 1119
290 Ga0207676_10462780 3300026095 Bacteria 1198
291 Ga0207676_10915208 3300026095 Bacteria 861
292 Ga0207674_10003125 3300026116 Bacteria 20421
293 Ga0207674_10016212 3300026116 Bacteria 8161
294 Ga0207674_10074892 3300026116 Bacteria 3396
295 Ga0207674_10107175 3300026116 Bacteria 2771
296 Ga0207674_10170635 3300026116 Bacteria 2129
297 Ga0207675_100261101 3300026118 Bacteria 1679
298 Ga0207683_10062473 3300026121 Bacteria 3280
299 Ga0207683_10297776 3300026121 Bacteria 1476
300 Ga0207683_10346019 3300026121 Bacteria 1364
301 Ga0207698_10031844 3300026142 Bacteria 3812
302 Ga0207698_10106743 3300026142 Bacteria 2336
303 Ga0207698_10128512 3300026142 Bacteria 2161
304 Ga0207698_11023451 3300026142 Bacteria 837
305 Ga0209967_1016650 3300027364 Bacteria 1056
306 Ga0209974_10075185 3300027876 Bacteria 1157
307 Ga0268266_10418520 3300028379 Bacteria 1269
308 Ga0268265_10413275 3300028380 Bacteria 1250
309 Ga0268264_10043956 3300028381 Bacteria 3703
310 Ga0307408_100037267 3300031548 Bacteria 3424
311 Ga0307408_100043689 3300031548 Bacteria 3189
312 Ga0307408_100222701 3300031548 Bacteria 1540
313 Ga0307408_100816852 3300031548 Bacteria 847
314 Ga0307405_10002170 3300031731 Bacteria 8571
315 Ga0307405_10015251 3300031731 Bacteria 4156
316 Ga0307405_10051919 3300031731 Bacteria 2547
317 Ga0307405_10082392 3300031731 Bacteria 2105
318 Ga0307405_10512180 3300031731 Bacteria 964
319 Ga0307413_10002997 3300031824 Bacteria 7002
320 Ga0307413_10005864 3300031824 Bacteria 5540
321 Ga0307413_10013177 3300031824 Bacteria 4144
322 Ga0307413_10019204 3300031824 Bacteria 3605
323 Ga0307413_10031181 3300031824 Bacteria 3004
324 Ga0307413_10106153 3300031824 Bacteria 1868
325 Ga0307413_10230827 3300031824 Bacteria 1359
326 Ga0307413_10287239 3300031824 Bacteria 1240
327 Ga0307413_10757033 3300031824 Bacteria 812
328 Ga0307410_10000957 3300031852 Bacteria 12384
329 Ga0307410_10006831 3300031852 Bacteria 6198
330 Ga0307410_10008944 3300031852 Bacteria 5588
331 Ga0307410_10017428 3300031852 Bacteria 4314
332 Ga0307410_10021560 3300031852 Bacteria 3965
333 Ga0307410_10036985 3300031852 Bacteria 3184
334 Ga0307410_10045387 3300031852 Bacteria 2925
335 Ga0307410_10116252 3300031852 Bacteria 1943
336 Ga0307410_10175292 3300031852 Bacteria 1619
337 Ga0307410_10200709 3300031852 Bacteria 1522
338 Ga0307410_10290767 3300031852 Bacteria 1286
339 Ga0307410_10488628 3300031852 Bacteria 1011
340 Ga0307410_11031182 3300031852 Bacteria 710
341 Ga0307406_10014303 3300031901 Bacteria 4563
342 Ga0307406_10021801 3300031901 Bacteria 3794
343 Ga0307406_10112898 3300031901 Bacteria 1874
344 Ga0307406_10113545 3300031901 Bacteria 1869
345 Ga0307407_10003884 3300031903 Bacteria 6231
346 Ga0307407_10070297 3300031903 Bacteria 2080
347 Ga0307407_10079355 3300031903 Bacteria 1980
348 Ga0307407_10096445 3300031903 Bacteria 1825
349 Ga0307407_10117898 3300031903 Bacteria 1677
350 Ga0307407_10118742 3300031903 Bacteria 1672
351 Ga0307407_10674184 3300031903 Bacteria 776
352 Ga0307412_10002848 3300031911 Bacteria 9595
353 Ga0307412_10003913 3300031911 Bacteria 8293
354 Ga0307412_10061999 3300031911 Bacteria 2516
355 Ga0307412_10064635 3300031911 Bacteria 2473
356 Ga0307412_10246663 3300031911 Bacteria 1384
357 Ga0307409_100010136 3300031995 Bacteria 5837
358 Ga0307409_100012846 3300031995 Bacteria 5356
359 Ga0307409_100020987 3300031995 Bacteria 4467
360 Ga0307409_100047576 3300031995 Bacteria 3256
361 Ga0307409_100064344 3300031995 Bacteria 2880
362 Ga0307409_100136996 3300031995 Bacteria 2102
363 Ga0307409_100208479 3300031995 Bacteria 1754
364 Ga0307409_100394072 3300031995 Bacteria 1320
365 Ga0307409_100417911 3300031995 Bacteria 1285
366 Ga0307409_100419935 3300031995 Bacteria 1283
367 Ga0307409_100559447 3300031995 Bacteria 1124
368 Ga0307409_101452845 3300031995 Bacteria 712
369 Ga0307416_100003237 3300032002 Bacteria 9543
370 Ga0307416_100013672 3300032002 Bacteria 5526
371 Ga0307416_100020904 3300032002 Bacteria 4683
372 Ga0307416_100037656 3300032002 Bacteria 3724
373 Ga0307416_100185373 3300032002 Bacteria 1955
374 Ga0307416_100349694 3300032002 Bacteria 1495
375 Ga0307416_100718939 3300032002 Bacteria 1089
376 Ga0307414_10001839 3300032004 Bacteria 10971
377 Ga0307414_10009391 3300032004 Bacteria 5616
378 Ga0307414_10043232 3300032004 Bacteria 3067
379 Ga0307414_10189911 3300032004 Bacteria 1661
380 Ga0307414_10193588 3300032004 Bacteria 1647
381 Ga0307414_10295063 3300032004 Bacteria 1368
382 Ga0307414_10378364 3300032004 Bacteria 1223
383 Ga0307414_10579652 3300032004 Bacteria 1003
384 Ga0307414_10632010 3300032004 Bacteria 963
385 Ga0307414_10676505 3300032004 Bacteria 932
386 Ga0307411_10001513 3300032005 Bacteria 9568
387 Ga0307411_10001530 3300032005 Bacteria 9535
388 Ga0307411_10002693 3300032005 Bacteria 7974
389 Ga0307411_10004215 3300032005 Bacteria 6839
390 Ga0307411_10024098 3300032005 Bacteria 3620
391 Ga0307411_10034964 3300032005 Bacteria 3132
392 Ga0307411_10043090 3300032005 Bacteria 2885
393 Ga0307411_10058005 3300032005 Bacteria 2560
394 Ga0307411_10289719 3300032005 Bacteria 1307
395 Ga0307411_10371947 3300032005 Bacteria 1172
396 Ga0307411_10606268 3300032005 Bacteria 942
397 Ga0307411_11161138 3300032005 Bacteria 698
398 Ga0307415_100005640 3300032126 Bacteria 6664
399 Ga0307415_100010862 3300032126 Bacteria 5176
400 Ga0307415_100023305 3300032126 Bacteria 3840
401 Ga0307415_100063890 3300032126 Bacteria 2559
402 Ga0307415_100090326 3300032126 Bacteria 2215
403 Ga0307415_100114437 3300032126 Bacteria 2008
404 Ga0307415_100191282 3300032126 Bacteria 1615
405 Ga0307415_100296803 3300032126 Bacteria 1337
406 Ga0307415_100342879 3300032126 Bacteria 1254
407 Ga0373948_0081003 3300034817 Bacteria 741
408 Ga0373923_0128328 3300035111 Bacteria 1138
409 Ga0373931_0081219 3300035691 Bacteria 1790
410 Ga0373935_0135257 3300035692 Bacteria 1660
411 Ga0373935_0386598 3300035692 Bacteria 1003
412 Ga0373935_0565193 3300035692 Bacteria 830
413 Ga0373933_0025741 3300035724 Bacteria 3376
414 Ga0373937_0003405 3300036401 Bacteria 13351
415 Ga0395899_0002669 3300037312 Bacteria 14380
416 Ga0395899_0069247 3300037312 Bacteria 2584
417 Ga0395899_0086469 3300037312 Bacteria 2277
418 Ga0395899_0095757 3300037312 Bacteria 2147
419 Ga0395899_0108104 3300037312 Bacteria 2001
420 Ga0395899_0357410 3300037312 Bacteria 975
421 Ga0395899_0423254 3300037312 Bacteria 877
422 Ga0395899_0443538 3300037312 Bacteria 851
423 Ga0395900_0002356 3300037418 Bacteria 20915
424 Ga0395900_0006624 3300037418 Bacteria 12053
425 Ga0395900_0009113 3300037418 Bacteria 10166
426 Ga0395900_0019430 3300037418 Bacteria 6927
427 Ga0395900_0091106 3300037418 Bacteria 3133
428 Ga0395900_0093806 3300037418 Bacteria 3083
429 Ga0395900_0113128 3300037418 Bacteria 2786
430 Ga0395900_0209227 3300037418 Bacteria 1970
431 Ga0395900_0234777 3300037418 Bacteria 1842
432 Ga0395900_0251985 3300037418 Bacteria 1766
433 Ga0395900_0297170 3300037418 Bacteria 1602
434 Ga0395900_0697892 3300037418 Bacteria 948
435 Ga0395900_0889937 3300037418 Bacteria 814
436 Ga0395900_1029056 3300037418 Bacteria 743
437 Ga0395898_0010367 3300037466 Bacteria 9745
438 Ga0395898_0014274 3300037466 Bacteria 8162
439 Ga0395898_0145164 3300037466 Bacteria 2271
440 Ga0395898_0203601 3300037466 Bacteria 1889
441 Ga0395898_0227416 3300037466 Bacteria 1779
442 Ga0395898_0409544 3300037466 Bacteria 1292
443 Ga0395898_0772749 3300037466 Bacteria 901
444 Ga0395898_1118875 3300037466 Bacteria 720
445 Ga0395905_0000458 3300037471 Bacteria 57029
446 Ga0395905_0003104 3300037471 Bacteria 17940
447 Ga0395905_0004878 3300037471 Bacteria 13825
448 Ga0395905_0007150 3300037471 Bacteria 11155
449 Ga0395905_0023697 3300037471 Bacteria 5795
450 Ga0395905_0023763 3300037471 Bacteria 5787
451 Ga0395905_0056457 3300037471 Bacteria 3673
452 Ga0395905_0095081 3300037471 Bacteria 2796
453 Ga0395905_0188997 3300037471 Bacteria 1932
454 Ga0395905_0196297 3300037471 Bacteria 1892
455 Ga0395905_0223852 3300037471 Bacteria 1760
456 Ga0395905_0299066 3300037471 Bacteria 1496
457 Ga0395905_0483416 3300037471 Bacteria 1138
458 Ga0395905_0800454 3300037471 Bacteria 845
459 Ga0395901_0006446 3300038443 Bacteria 11891
460 Ga0395901_0006984 3300038443 Bacteria 11409
461 Ga0395901_0014201 3300038443 Bacteria 8107
462 Ga0395901_0014488 3300038443 Bacteria 8020
463 Ga0395901_0145060 3300038443 Bacteria 2495
464 Ga0395901_0169031 3300038443 Bacteria 2294
465 Ga0395901_0207191 3300038443 Bacteria 2053
466 Ga0395901_0244791 3300038443 Bacteria 1869
467 Ga0395901_0256115 3300038443 Bacteria 1822
468 Ga0395901_0651700 3300038443 Bacteria 1056
469 Ga0395901_0874079 3300038443 Bacteria 882
470 Ga0395901_1031970 3300038443 Bacteria 796
471 Ga0395901_1128319 3300038443 Bacteria 753
472 Ga0436365_0399522 3300039437 Bacteria 5305
473 Ga0436363_1377558 3300039450 Bacteria 1828
474 Ga0439465_0031173 3300041413 Bacteria 1698
475 Ga0439449_0112237 3300042007 Bacteria 1010
476 Ga0466961_0443367 3300044693 Bacteria 786
477 Ga0466963_0019089 3300044694 Bacteria 4293
478 Ga0466963_0035538 3300044694 Bacteria 3247
479 Ga0466963_0137493 3300044694 Bacteria 1691
480 Ga0466963_0499980 3300044694 Bacteria 858
481 Ga0466963_0508616 3300044694 Bacteria 850
482 Ga0466971_0015264 3300044719 Bacteria 3380
483 Ga0466957_0016085 3300044842 Bacteria 4372
484 Ga0466957_0125754 3300044842 Bacteria 1638
485 Ga0466957_0541719 3300044842 Bacteria 810
486 Ga0466960_0251645 3300044901 Bacteria 982
487 Ga0466959_0056455 3300045049 Bacteria 2865
488 Ga0466959_0193998 3300045049 Bacteria 1416
489 Ga0466958_0155072 3300045836 Bacteria 1445
490 Ga0466958_0243293 3300045836 Bacteria 1150
491 Ga0466967_0024924 3300045976 Bacteria 4925
492 Ga0466967_0035640 3300045976 Bacteria 4238
493 Ga0466967_0119854 3300045976 Bacteria 2429
494 Ga0466967_0279584 3300045976 Bacteria 1601
495 Ga0466967_0312088 3300045976 Bacteria 1515
496 Ga0466967_0427050 3300045976 Bacteria 1292
497 Ga0495663_0019953 3300046525 Bacteria 1921
498 Ga0495598_0005578 3300046537 Bacteria 2798
499 Ga0495598_0009915 3300046537 Bacteria 2266
500 Ga0495621_0000483 3300046539 Bacteria 9802
501 Ga0495621_0007245 3300046539 Bacteria 3278
502 Ga0495633_0002648 3300046558 Bacteria 12461
503 Ga0495659_0050197 3300046664 Bacteria 1517
504 Ga0495661_0023215 3300046665 Bacteria 4027
505 Ga0495669_0002314 3300046684 Bacteria 7804
506 Ga0495669_0006506 3300046684 Bacteria 4882
507 Ga0495669_0007426 3300046684 Bacteria 4597
508 Ga0495669_0058842 3300046684 Bacteria 1734
509 Ga0495669_0225081 3300046684 Bacteria 899
510 Ga0495670_0007874 3300046691 Bacteria 5241
511 Ga0495670_0086399 3300046691 Bacteria 1601
512 Ga0495602_0043252 3300048088 Bacteria 4098
513 Ga0496106_0181801 3300048909 Bacteria 1669
514 Ga0496107_0200370 3300048910 Bacteria 1484
515 Ga0496108_0084020 3300048911 Bacteria 2701
516 Ga0496108_0370646 3300048911 Bacteria 1250
517 Ga0496109_0027549 3300048912 Bacteria 5075
518 Ga0496109_0148905 3300048912 Bacteria 2191
519 Ga0496110_0001980 3300048913 Bacteria 15237
520 Ga0496111_0007139 3300048914 Bacteria 7298
521 Ga0496112_0019000 3300048915 Bacteria 6477
522 Ga0496112_0287557 3300048915 Bacteria 1590
523 Ga0496119_0063195 3300048922 Bacteria 2203
524 Ga0496120_0158003 3300048923 Bacteria 1133
525 Ga0496124_0039373 3300048927 Bacteria 4098
526 Ga0496124_0083178 3300048927 Bacteria 2626
527 Ga0501033_0231893 3300049570 Bacteria 1311
528 Ga0501067_0099178 3300049583 Bacteria 1618
529 Ga0501067_0271385 3300049583 Bacteria 945
530 Ga0501217_021164 3300049661 Bacteria 1534
531 Ga0501224_008445 3300049664 Bacteria 1502
532 Ga0501230_014013 3300049667 Bacteria 1309
533 Ga0501230_038691 3300049667 Bacteria 917
534 Ga0501235_015451 3300049669 Bacteria 1683
535 Ga0501247_014225 3300049677 Bacteria 985
536 Ga0501249_002168 3300049679 Bacteria 3998
537 Ga0501249_012580 3300049679 Bacteria 1790
538 Ga0501225_0019339 3300049705 Bacteria 1885
539 Ga0501262_008904 3300049759 Bacteria 1234
540 Ga0501263_007395 3300049760 Bacteria 1290
541 Ga0501268_001110 3300049765 Bacteria 3244
542 Ga0501270_019494 3300049767 Bacteria 1017
543 Ga0501272_007175 3300049769 Bacteria 1203
544 Ga0501273_017706 3300049770 Bacteria 943
545 Ga0501044_0543969 3300049823 Bacteria 1059
546 Ga0501212_004325 3300049851 Bacteria 1828
547 nmdc:mga00v17_350165_c1 3300050491 Bacteria 960
548 Ga0466962_0036937 3300061719 Bacteria 2338
549 Ga0307405_10181756
550 JGI24741J21665_1006915
551 JGI24740J21852_10011445
552 JGI24740J21852_10041372
553 JGI24739J22299_10019880
554 JGI24739J22299_10064076
555 JGI24737J22298_10006340
556 JGI24735J21928_10004058
557 JGI24735J21928_10036848
558 JGI24738J21930_10026611
559 Ga0065715_10208645
560 Ga0070658_10020103
561 Ga0070658_10163632
562 Ga0070658_10230110
563 Ga0070658_10311786
564 Ga0070658_10561936
565 Ga0070676_10051965
566 Ga0070676_10397820
567 Ga0070676_10433783
568 Ga0070683_100052250
569 Ga0070683_100102736
570 Ga0070683_100183151
571 Ga0070670_100005021
572 Ga0070670_100009978
573 Ga0070670_100097246
574 Ga0070670_100112519
575 Ga0070677_10164130
576 Ga0068869_100478414
577 Ga0070666_10023343
578 Ga0070666_10365510
579 Ga0070680_100295406
580 Ga0070680_100304985
581 Ga0070680_100364355
582 Ga0070680_100846193
583 Ga0068868_100060359
584 Ga0070660_100004990
585 Ga0070660_100061802
586 Ga0070660_100062535
587 Ga0070660_100141912
588 Ga0070660_100318870
589 Ga0070691_10002895
590 Ga0070661_100005787
591 Ga0070661_100068547
592 Ga0070661_100115585
593 Ga0070661_100161799
594 Ga0070661_100164100
595 Ga0070692_10026954
596 Ga0070668_100627147
597 Ga0070669_100094348
598 Ga0070675_100004792
599 Ga0070675_100957040
600 Ga0070671_100002220
601 Ga0070671_100006497
602 Ga0070671_100081960
603 Ga0070674_100065435
604 Ga0070674_100113242
605 Ga0070673_100067292
606 Ga0070659_100035223
607 Ga0070659_100081257
608 Ga0070659_100144126
609 Ga0070659_100230841
610 Ga0070659_100242399
611 Ga0070659_100258053
612 Ga0070659_100268635
613 Ga0070659_100457318
614 Ga0070667_100030105
615 Ga0070709_10197828
616 Ga0070714_100120154
617 Ga0070713_100100355
618 Ga0070694_100005108
619 Ga0070663_100068119
620 Ga0070663_100122399
621 Ga0070663_100189607
622 Ga0070678_100321459
623 Ga0070678_100443253
624 Ga0070678_100504506
625 Ga0070662_100011636
626 Ga0070662_100021352
627 Ga0070662_100021942
628 Ga0070662_100287300
629 Ga0070662_100920457
630 Ga0070681_10084333
631 Ga0070681_10137278
632 Ga0070681_10327886
633 Ga0068867_100554850
634 Ga0070679_100126745
635 Ga0070679_100158524
636 Ga0070684_100338836
637 Ga0068853_100010858
638 Ga0068853_100089722
639 Ga0070672_100007246
640 Ga0070672_100089482
641 Ga0070672_100592711
642 Ga0070693_100007262
643 Ga0070693_100070130
644 Ga0070665_100144253
645 Ga0068855_100292501
646 Ga0068855_100478008
647 Ga0068855_100653849
648 Ga0068855_100938055
649 Ga0070664_100000441
650 Ga0070664_100003103
651 Ga0070664_100003398
652 Ga0070664_100010299
653 Ga0070664_100098245
654 Ga0070664_100174227
655 Ga0070664_100334516
656 Ga0070664_100505915
657 Ga0068857_100026577
658 Ga0068857_100066192
659 Ga0068857_100069055
660 Ga0068857_100335658
661 Ga0068854_100010766
662 Ga0068854_100073727
663 Ga0068854_100136592
664 Ga0068854_100267136
665 Ga0068856_100213031
666 Ga0068856_100517298
667 Ga0068852_100157619
668 Ga0068852_100322141
669 Ga0068852_100441479
670 Ga0068859_100058156
671 Ga0068864_100279875
672 Ga0068858_100058529
673 Ga0068858_100252127
674 Ga0068860_100029730
675 Ga0081539_10010799
676 Ga0070716_100038260
677 Ga0075428_100928338
678 Ga0075433_10419224
679 Ga0075434_101597483
680 Ga0097620_100058158
681 Ga0105240_10075786
682 Ga0105245_10038132
683 Ga0105245_10591072
684 Ga0105241_10243468
685 Ga0105242_10107352
686 Ga0105248_10011512
687 Ga0105248_10105112
688 Ga0105237_10008650
689 Ga0105237_10150731
690 Ga0105237_10362613
691 Ga0105238_10066631
692 Ga0105239_10035829
693 Ga0157373_10080625
694 Ga0157373_10136670
695 Ga0157373_10144242
696 Ga0157373_10172741
697 Ga0157373_10338114
698 Ga0157373_10621412
699 Ga0157371_10208682
700 Ga0157371_10479771
701 Ga0157370_10391244
702 Ga0157370_11312100
703 Ga0157369_10126026
704 Ga0157369_10174404
705 Ga0157369_10723172
706 Ga0157369_11094431
707 Ga0157369_11294917
708 Ga0157369_11294923
709 Ga0157374_10468234
710 Ga0163162_11859341
711 Ga0157372_10055282
712 Ga0157372_10281307
713 Ga0157372_10572047
714 Ga0157372_11662224
715 Ga0157375_10033140
716 Ga0163163_10216651
717 Ga0157377_10241837
718 Ga0213876_10252363
719 Ga0207656_10108980
720 Ga0207682_10043422
721 Ga0207682_10064619
722 Ga0207688_10048302
723 Ga0207680_10033044
724 Ga0207680_10156593
725 Ga0207647_10000383
726 Ga0207699_10429751
727 Ga0207645_10063591
728 Ga0207645_10278548
729 Ga0207645_10292449
730 Ga0207705_10007304
731 Ga0207705_10012125
732 Ga0207705_10018253
733 Ga0207705_10068266
734 Ga0207705_10281457
735 Ga0207705_10348074
736 Ga0207705_10566286
737 Ga0207705_10620790
738 Ga0207707_10072484
739 Ga0207707_10263047
740 Ga0207707_10846014
741 Ga0207695_10014240
742 Ga0207671_10046739
743 Ga0207671_10415931
744 Ga0207671_10663908
745 Ga0207660_10005696
746 Ga0207660_10008412
747 Ga0207660_10176360
748 Ga0207660_10296874
749 Ga0207657_10002827
750 Ga0207657_10008828
751 Ga0207657_10056292
752 Ga0207657_10263573
753 Ga0207649_10031705
754 Ga0207649_10035789
755 Ga0207649_10041683
756 Ga0207649_10060405
757 Ga0207649_10061927
758 Ga0207649_10092659
759 Ga0207649_10301499
760 Ga0207649_10339207
761 Ga0207649_10369740
762 Ga0207652_10032665
763 Ga0207652_10269657
764 Ga0207652_10592704
765 Ga0207652_10603903
766 Ga0207652_10671119
767 Ga0207652_10901944
768 Ga0207681_10098117
769 Ga0207694_10166063
770 Ga0207650_10003956
771 Ga0207650_10007164
772 Ga0207650_10027499
773 Ga0207650_10051593
774 Ga0207659_10138372
775 Ga0207687_10775014
776 Ga0207700_10111473
777 Ga0207644_10001259
778 Ga0207644_10003074
779 Ga0207644_10132916
780 Ga0207690_10016248
781 Ga0207690_10021033
782 Ga0207690_10025233
783 Ga0207690_10071838
784 Ga0207690_10205922
785 Ga0207690_10269587
786 Ga0207690_10353662
787 Ga0207706_10009096
788 Ga0207706_10019074
789 Ga0207706_10031077
790 Ga0207706_10043226
791 Ga0207706_10624909
792 Ga0207686_10041959
793 Ga0207709_10018615
794 Ga0207669_10049446
795 Ga0207669_10069963
796 Ga0207665_10511454
797 Ga0207691_10006923
798 Ga0207691_10011704
799 Ga0207691_10593880
800 Ga0207711_10004839
801 Ga0207689_10039447
802 Ga0207661_10013536
803 Ga0207661_10515297
804 Ga0207679_10005151
805 Ga0207679_10012595
806 Ga0207679_10013857
807 Ga0207679_10032241
808 Ga0207679_10125481
809 Ga0207679_10213928
810 Ga0207679_10264820
811 Ga0207679_10552338
812 Ga0207667_10008988
813 Ga0207667_10049101
814 Ga0207667_10078192
815 Ga0207667_10089725
816 Ga0207667_10330974
817 Ga0207667_10702928
818 Ga0207651_10047623
819 Ga0207712_10002461
820 Ga0207640_10026483
821 Ga0207640_10112850
822 Ga0207640_10121668
823 Ga0207640_10909176
824 Ga0207658_10082901
825 Ga0207677_10111625
826 Ga0207677_10664827
827 Ga0207703_10002707
828 Ga0207639_10106766
829 Ga0207639_10184998
830 Ga0207678_10082608
831 Ga0207678_10112886
832 Ga0207678_10220749
833 Ga0207678_10266163
834 Ga0207702_10070314
835 Ga0207641_10254573
836 Ga0207648_10198908
837 Ga0207648_10493987
838 Ga0207676_10462780
839 Ga0207676_10915208
840 Ga0207674_10003125
841 Ga0207674_10016212
842 Ga0207674_10074892
843 Ga0207674_10107175
844 Ga0207674_10170635
845 Ga0207675_100261101
846 Ga0207683_10062473
847 Ga0207683_10297776
848 Ga0207683_10346019
849 Ga0207698_10031844
850 Ga0207698_10106743
851 Ga0207698_10128512
852 Ga0207698_11023451
853 Ga0209967_1016650
854 Ga0209974_10075185
855 Ga0268266_10418520
856 Ga0268265_10413275
857 Ga0268264_10043956
858 Ga0307408_100037267
859 Ga0307408_100043689
860 Ga0307408_100222701
861 Ga0307408_100816852
862 Ga0307405_10002170
863 Ga0307405_10015251
864 Ga0307405_10051919
865 Ga0307405_10082392
866 Ga0307405_10512180
867 Ga0307413_10002997
868 Ga0307413_10005864
869 Ga0307413_10013177
870 Ga0307413_10019204
871 Ga0307413_10031181
872 Ga0307413_10106153
873 Ga0307413_10230827
874 Ga0307413_10287239
875 Ga0307413_10757033
876 Ga0307410_10000957
877 Ga0307410_10006831
878 Ga0307410_10008944
879 Ga0307410_10017428
880 Ga0307410_10021560
881 Ga0307410_10036985
882 Ga0307410_10045387
883 Ga0307410_10116252
884 Ga0307410_10175292
885 Ga0307410_10200709
886 Ga0307410_10290767
887 Ga0307410_10488628
888 Ga0307410_11031182
889 Ga0307406_10014303
890 Ga0307406_10021801
891 Ga0307406_10112898
892 Ga0307406_10113545
893 Ga0307407_10003884
894 Ga0307407_10070297
895 Ga0307407_10079355
896 Ga0307407_10096445
897 Ga0307407_10117898
898 Ga0307407_10118742
899 Ga0307407_10674184
900 Ga0307412_10002848
901 Ga0307412_10003913
902 Ga0307412_10061999
903 Ga0307412_10064635
904 Ga0307412_10246663
905 Ga0307409_100010136
906 Ga0307409_100012846
907 Ga0307409_100020987
908 Ga0307409_100047576
909 Ga0307409_100064344
910 Ga0307409_100136996
911 Ga0307409_100208479
912 Ga0307409_100394072
913 Ga0307409_100417911
914 Ga0307409_100419935
915 Ga0307409_100559447
916 Ga0307409_101452845
917 Ga0307416_100003237
918 Ga0307416_100013672
919 Ga0307416_100020904
920 Ga0307416_100037656
921 Ga0307416_100185373
922 Ga0307416_100349694
923 Ga0307416_100718939
924 Ga0307414_10001839
925 Ga0307414_10009391
926 Ga0307414_10043232
927 Ga0307414_10189911
928 Ga0307414_10193588
929 Ga0307414_10295063
930 Ga0307414_10378364
931 Ga0307414_10579652
932 Ga0307414_10632010
933 Ga0307414_10676505
934 Ga0307411_10001513
935 Ga0307411_10001530
936 Ga0307411_10002693
937 Ga0307411_10004215
938 Ga0307411_10024098
939 Ga0307411_10034964
940 Ga0307411_10043090
941 Ga0307411_10058005
942 Ga0307411_10289719
943 Ga0307411_10371947
944 Ga0307411_10606268
945 Ga0307411_11161138
946 Ga0307415_100005640
947 Ga0307415_100010862
948 Ga0307415_100023305
949 Ga0307415_100063890
950 Ga0307415_100090326
951 Ga0307415_100114437
952 Ga0307415_100191282
953 Ga0307415_100296803
954 Ga0307415_100342879
955 Ga0373948_0081003
956 Ga0373923_0128328
957 Ga0373931_0081219
958 Ga0373935_0135257
959 Ga0373935_0386598
960 Ga0373935_0565193
961 Ga0373933_0025741
962 Ga0373937_0003405
963 Ga0395899_0002669
964 Ga0395899_0069247
965 Ga0395899_0086469
966 Ga0395899_0095757
967 Ga0395899_0108104
968 Ga0395899_0357410
969 Ga0395899_0423254
970 Ga0395899_0443538
971 Ga0395900_0002356
972 Ga0395900_0006624
973 Ga0395900_0009113
974 Ga0395900_0019430
975 Ga0395900_0091106
976 Ga0395900_0093806
977 Ga0395900_0113128
978 Ga0395900_0209227
979 Ga0395900_0234777
980 Ga0395900_0251985
981 Ga0395900_0297170
982 Ga0395900_0697892
983 Ga0395900_0889937
984 Ga0395900_1029056
985 Ga0395898_0010367
986 Ga0395898_0014274
987 Ga0395898_0145164
988 Ga0395898_0203601
989 Ga0395898_0227416
990 Ga0395898_0409544
991 Ga0395898_0772749
992 Ga0395898_1118875
993 Ga0395905_0000458
994 Ga0395905_0003104
995 Ga0395905_0004878
996 Ga0395905_0007150
997 Ga0395905_0023697
998 Ga0395905_0023763
999 Ga0395905_0056457
1000 Ga0395905_0095081
1001 Ga0395905_0188997
1002 Ga0395905_0196297
1003 Ga0395905_0223852
1004 Ga0395905_0299066
1005 Ga0395905_0483416
1006 Ga0395905_0800454
1007 Ga0395901_0006446
1008 Ga0395901_0006984
1009 Ga0395901_0014201
1010 Ga0395901_0014488
1011 Ga0395901_0145060
1012 Ga0395901_0169031
1013 Ga0395901_0207191
1014 Ga0395901_0244791
1015 Ga0395901_0256115
1016 Ga0395901_0651700
1017 Ga0395901_0874079
1018 Ga0395901_1031970
1019 Ga0395901_1128319
1020 Ga0436365_0399522
1021 Ga0436363_1377558
1022 Ga0439465_0031173
1023 Ga0439449_0112237
1024 Ga0466961_0443367
1025 Ga0466963_0019089
1026 Ga0466963_0035538
1027 Ga0466963_0137493
1028 Ga0466963_0499980
1029 Ga0466963_0508616
1030 Ga0466971_0015264
1031 Ga0466957_0016085
1032 Ga0466957_0125754
1033 Ga0466957_0541719
1034 Ga0466960_0251645
1035 Ga0466959_0056455
1036 Ga0466959_0193998
1037 Ga0466958_0155072
1038 Ga0466958_0243293
1039 Ga0466967_0024924
1040 Ga0466967_0035640
1041 Ga0466967_0119854
1042 Ga0466967_0279584
1043 Ga0466967_0312088
1044 Ga0466967_0427050
1045 Ga0495663_0019953
1046 Ga0495598_0005578
1047 Ga0495598_0009915
1048 Ga0495621_0000483
1049 Ga0495621_0007245
1050 Ga0495633_0002648
1051 Ga0495659_0050197
1052 Ga0495661_0023215
1053 Ga0495669_0002314
1054 Ga0495669_0006506
1055 Ga0495669_0007426
1056 Ga0495669_0058842
1057 Ga0495669_0225081
1058 Ga0495670_0007874
1059 Ga0495670_0086399
1060 Ga0495602_0043252
1061 Ga0496106_0181801
1062 Ga0496107_0200370
1063 Ga0496108_0084020
1064 Ga0496108_0370646
1065 Ga0496109_0027549
1066 Ga0496109_0148905
1067 Ga0496110_0001980
1068 Ga0496111_0007139
1069 Ga0496112_0019000
1070 Ga0496112_0287557
1071 Ga0496119_0063195
1072 Ga0496120_0158003
1073 Ga0496124_0039373
1074 Ga0496124_0083178
1075 Ga0501033_0231893
1076 Ga0501067_0099178
1077 Ga0501067_0271385
1078 Ga0501217_021164
1079 Ga0501224_008445
1080 Ga0501230_014013
1081 Ga0501230_038691
1082 Ga0501235_015451
1083 Ga0501247_014225
1084 Ga0501249_002168
1085 Ga0501249_012580
1086 Ga0501225_0019339
1087 Ga0501262_008904
1088 Ga0501263_007395
1089 Ga0501268_001110
1090 Ga0501270_019494
1091 Ga0501272_007175
1092 Ga0501273_017706
1093 Ga0501044_0543969
1094 Ga0501212_004325
1095 nmdc:mga00v17_350165_c1
1096 Ga0466962_0036937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

49

92

0.96

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

90

172

0.82

Map