F462234

General Info

Members Datasets Scaffolds Average Seq Length
548 295 1096 144

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10718046|Ga0207646_107180462
Length 177
Sequence VGALVRLLASSAGDAAIDLDGPAQLDGTMKVKGRGTSAGQSGPAASALIDKRIDELGDWRGKMLARLRALIHKADPDIVEEWKWMGTPIFSHAGIVCTGETYKAVVKLTFAKGAALKDPAGLFNSSLEGNVRRAIDVHEGEKVNEAALKDLIRAAVALNVEGKTKTGTKTKSARKAK

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 3.65
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10718046 3300025922 Bacteria 893
2 JGI24739J22299_10194032 3300001989 Bacteria 597
3 JGI24743J22301_10008365 3300001991 Bacteria 1814
4 Ga0065712_10076784 3300005290 Bacteria 3603
5 Ga0065712_10132493 3300005290 Bacteria 1533
6 Ga0065715_10107365 3300005293 Bacteria 2761
7 Ga0065715_10268803 3300005293 Bacteria 1091
8 Ga0065715_10291854 3300005293 Bacteria 1061
9 Ga0065715_10869015 3300005293 Bacteria 585
10 Ga0065707_10027610 3300005295 Bacteria 1566
11 Ga0065707_10115429 3300005295 Bacteria 2267
12 Ga0070676_10011237 3300005328 Bacteria 4868
13 Ga0070683_100128551 3300005329 Bacteria 2396
14 Ga0070683_100237802 3300005329 Bacteria 1732
15 Ga0070690_100279245 3300005330 Bacteria 1191
16 Ga0070670_100243971 3300005331 Bacteria 1564
17 Ga0070670_100272122 3300005331 Bacteria 1478
18 Ga0070680_100024536 3300005336 Bacteria 4818
19 Ga0068868_100048308 3300005338 Bacteria 3338
20 Ga0068868_100053829 3300005338 Bacteria 3171
21 Ga0068868_100131338 3300005338 Bacteria 2049
22 Ga0068868_100552163 3300005338 Unclassified 1015
23 Ga0070660_100037692 3300005339 Bacteria 3665
24 Ga0070689_100000001 3300005340 Bacteria 1334580
25 Ga0070689_100000101 3300005340 Bacteria 50092
26 Ga0070661_100161254 3300005344 Bacteria 1698
27 Ga0070675_100042568 3300005354 Bacteria 3710
28 Ga0070671_100314082 3300005355 Bacteria 1335
29 Ga0070674_100678123 3300005356 Bacteria 879
30 Ga0070673_100483734 3300005364 Bacteria 1118
31 Ga0070673_101523971 3300005364 Bacteria 631
32 Ga0070688_100000001 3300005365 Bacteria 106331
33 Ga0070688_100067590 3300005365 Bacteria 2277
34 Ga0070659_100327778 3300005366 Bacteria 1281
35 Ga0070667_100638324 3300005367 Bacteria 983
36 Ga0070709_10134980 3300005434 Bacteria 1689
37 Ga0070710_10126867 3300005437 Bacteria 1551
38 Ga0070710_10385507 3300005437 Unclassified 936
39 Ga0070711_101462076 3300005439 Bacteria 596
40 Ga0070705_100000257 3300005440 Bacteria 31587
41 Ga0070663_100173922 3300005455 Bacteria 1666
42 Ga0070663_100705151 3300005455 Bacteria 858
43 Ga0070678_100065502 3300005456 Bacteria 2698
44 Ga0070678_100317871 3300005456 Bacteria 1329
45 Ga0070678_100834834 3300005456 Bacteria 839
46 Ga0070662_100030034 3300005457 Bacteria 3799
47 Ga0070681_10247445 3300005458 Bacteria 1696
48 Ga0070681_10360312 3300005458 Bacteria 1364
49 Ga0070681_10682973 3300005458 Bacteria 942
50 Ga0070685_10092012 3300005466 Bacteria 1837
51 Ga0070685_10129576 3300005466 Bacteria 1576
52 Ga0070706_100182330 3300005467 Bacteria 1960
53 Ga0070707_100164279 3300005468 Bacteria 2163
54 Ga0070707_100557892 3300005468 Bacteria 1108
55 Ga0070698_100003314 3300005471 Bacteria 17717
56 Ga0070698_100696887 3300005471 Bacteria 958
57 Ga0070698_101052491 3300005471 Bacteria 762
58 Ga0070699_100086457 3300005518 Bacteria 2736
59 Ga0070699_100329802 3300005518 Bacteria 1372
60 Ga0070679_100054622 3300005530 Bacteria 3977
61 Ga0070679_100137445 3300005530 Bacteria 2425
62 Ga0070684_100133335 3300005535 Bacteria 2242
63 Ga0070684_100141544 3300005535 Bacteria 2175
64 Ga0070684_100587576 3300005535 Bacteria 1035
65 Ga0070684_100645644 3300005535 Bacteria 985
66 Ga0068853_100057925 3300005539 Bacteria 3344
67 Ga0068853_100662200 3300005539 Bacteria 994
68 Ga0070686_100743803 3300005544 Bacteria 786
69 Ga0070695_100185335 3300005545 Bacteria 1477
70 Ga0070696_100092279 3300005546 Bacteria 2158
71 Ga0070696_100560238 3300005546 Bacteria 917
72 Ga0070665_100226350 3300005548 Bacteria 1870
73 Ga0070665_100557095 3300005548 Bacteria 1159
74 Ga0068855_100097809 3300005563 Bacteria 3381
75 Ga0068855_100310169 3300005563 Bacteria 1746
76 Ga0068855_100393353 3300005563 Bacteria 1520
77 Ga0070664_100035559 3300005564 Bacteria 4182
78 Ga0070664_100614192 3300005564 Bacteria 1009
79 Ga0068857_100093482 3300005577 Bacteria 2693
80 Ga0068854_100075900 3300005578 Bacteria 2469
81 Ga0068854_100228764 3300005578 Bacteria 1475
82 Ga0068854_100944915 3300005578 Bacteria 760
83 Ga0068856_100017387 3300005614 Bacteria 6969
84 Ga0068856_100251061 3300005614 Bacteria 1784
85 Ga0070702_100522686 3300005615 Bacteria 876
86 Ga0068852_100209420 3300005616 Bacteria 1849
87 Ga0068852_101061197 3300005616 Bacteria 830
88 Ga0068852_102188430 3300005616 Bacteria 575
89 Ga0068859_100034183 3300005617 Bacteria 5103
90 Ga0068859_100977571 3300005617 Bacteria 929
91 Ga0068859_101757604 3300005617 Bacteria 685
92 Ga0068866_10026547 3300005718 Bacteria 2736
93 Ga0068866_10073036 3300005718 Bacteria 1819
94 Ga0068866_10387482 3300005718 Bacteria 898
95 Ga0068861_100189500 3300005719 Bacteria 1718
96 Ga0068861_100555659 3300005719 Bacteria 1047
97 Ga0068861_101965896 3300005719 Bacteria 583
98 Ga0068863_100327412 3300005841 Bacteria 1489
99 Ga0068858_100002668 3300005842 Bacteria 17950
100 Ga0068858_100010011 3300005842 Bacteria 9005
101 Ga0068860_101341727 3300005843 Bacteria 736
102 Ga0068860_101369707 3300005843 Bacteria 729
103 Ga0068862_100329106 3300005844 Bacteria 1412
104 Ga0068862_100951623 3300005844 Bacteria 847
105 Ga0081455_10001198 3300005937 Bacteria 32472
106 Ga0081539_10002066 3300005985 Bacteria 30089
107 Ga0070717_10207889 3300006028 Bacteria 1717
108 Ga0075365_10070994 3300006038 Bacteria 2343
109 Ga0075362_10000363 3300006177 Bacteria 13081
110 Ga0075366_10022348 3300006195 Bacteria 3678
111 Ga0097621_100004225 3300006237 Bacteria 9974
112 Ga0097621_100201189 3300006237 Bacteria 1729
113 Ga0097621_101999760 3300006237 Bacteria 554
114 Ga0068871_100046325 3300006358 Bacteria 3502
115 Ga0068871_100079058 3300006358 Bacteria 2720
116 Ga0068871_100304635 3300006358 Bacteria 1399
117 Ga0068871_100775412 3300006358 Bacteria 882
118 Ga0068871_100808094 3300006358 Bacteria 865
119 Ga0075428_100179306 3300006844 Bacteria 2293
120 Ga0075431_101652549 3300006847 Bacteria 598
121 Ga0075433_10005620 3300006852 Bacteria 9856
122 Ga0075433_10653137 3300006852 Bacteria 922
123 Ga0075434_100034229 3300006871 Bacteria 5016
124 Ga0075434_101321057 3300006871 Bacteria 732
125 Ga0068865_100014987 3300006881 Bacteria 4936
126 Ga0068865_100172987 3300006881 Bacteria 1657
127 Ga0075436_100008890 3300006914 Bacteria 6872
128 Ga0097620_100034180 3300006931 Bacteria 5103
129 Ga0097620_100911930 3300006931 Bacteria 963
130 Ga0097620_100977415 3300006931 Bacteria 929
131 Ga0097620_101757593 3300006931 Bacteria 685
132 Ga0075435_100027708 3300007076 Bacteria 4435
133 Ga0105240_10003190 3300009093 Bacteria 25760
134 Ga0105240_10013677 3300009093 Bacteria 11129
135 Ga0105240_10021753 3300009093 Bacteria 8523
136 Ga0105240_10050819 3300009093 Bacteria 5223
137 Ga0105240_10059121 3300009093 Bacteria 4785
138 Ga0111539_10244451 3300009094 Bacteria 2089
139 Ga0105245_10251248 3300009098 Bacteria 1718
140 Ga0105245_10681560 3300009098 Bacteria 1060
141 Ga0105245_11402222 3300009098 Bacteria 749
142 Ga0105247_10037076 3300009101 Bacteria 2974
143 Ga0105247_10093456 3300009101 Bacteria 1912
144 Ga0105247_10252371 3300009101 Bacteria 1206
145 Ga0114129_10014611 3300009147 Bacteria 11188
146 Ga0114129_10018464 3300009147 Bacteria 9934
147 Ga0114129_10053679 3300009147 Bacteria 5653
148 Ga0114129_10747813 3300009147 Bacteria 1252
149 Ga0114129_10751851 3300009147 Bacteria 1248
150 Ga0114129_11314397 3300009147 Bacteria 896
151 Ga0114129_12754912 3300009147 Bacteria 585
152 Ga0105243_10072216 3300009148 Bacteria 2793
153 Ga0105243_10863941 3300009148 Bacteria 897
154 Ga0105241_10004901 3300009174 Bacteria 9872
155 Ga0105241_10082389 3300009174 Bacteria 2521
156 Ga0105242_10050465 3300009176 Bacteria 3387
157 Ga0105242_10088116 3300009176 Bacteria 2607
158 Ga0105242_10095366 3300009176 Bacteria 2511
159 Ga0105242_12595662 3300009176 Bacteria 556
160 Ga0105248_10016703 3300009177 Bacteria 8080
161 Ga0105248_10105109 3300009177 Bacteria 3183
162 Ga0105248_10131281 3300009177 Bacteria 2826
163 Ga0105248_10219748 3300009177 Bacteria 2139
164 Ga0105248_10994150 3300009177 Bacteria 948
165 Ga0105237_10007563 3300009545 Bacteria 11875
166 Ga0105237_10265903 3300009545 Bacteria 1718
167 Ga0105238_10023968 3300009551 Bacteria 6222
168 Ga0105238_10596671 3300009551 Bacteria 1112
169 Ga0105238_10621610 3300009551 Bacteria 1089
170 Ga0105238_11468180 3300009551 Bacteria 710
171 Ga0105249_10111933 3300009553 Bacteria 2581
172 Ga0105239_10084586 3300010375 Bacteria 3494
173 Ga0105239_10095116 3300010375 Bacteria 3291
174 Ga0105239_10290497 3300010375 Bacteria 1841
175 Ga0105239_10830208 3300010375 Bacteria 1059
176 Ga0105239_10900287 3300010375 Bacteria 1016
177 Ga0105246_10157177 3300011119 Unclassified 1728
178 Ga0105246_10164490 3300011119 Bacteria 1693
179 Ga0105246_10429306 3300011119 Bacteria 1105
180 Ga0157373_10526973 3300013100 Bacteria 855
181 Ga0157371_10255416 3300013102 Bacteria 1263
182 Ga0157370_10169793 3300013104 Bacteria 2028
183 Ga0157370_10172784 3300013104 Bacteria 2008
184 Ga0157370_10984598 3300013104 Bacteria 764
185 Ga0157369_10294707 3300013105 Bacteria 1688
186 Ga0157369_10431371 3300013105 Bacteria 1366
187 Ga0157369_10678418 3300013105 Bacteria 1062
188 Ga0157374_10037668 3300013296 Bacteria 4440
189 Ga0157374_10070419 3300013296 Bacteria 3295
190 Ga0157374_10116705 3300013296 Unclassified 2572
191 Ga0157374_10785018 3300013296 Bacteria 968
192 Ga0157374_11546171 3300013296 Bacteria 687
193 Ga0157378_10005847 3300013297 Bacteria 10781
194 Ga0157378_10017861 3300013297 Bacteria 6226
195 Ga0157378_10284868 3300013297 Bacteria 1594
196 Ga0157378_10923679 3300013297 Bacteria 904
197 Ga0157378_11967509 3300013297 Bacteria 634
198 Ga0163162_10112464 3300013306 Bacteria 2821
199 Ga0163162_10346429 3300013306 Bacteria 1618
200 Ga0163162_11765998 3300013306 Unclassified 707
201 Ga0157372_10130575 3300013307 Bacteria 2890
202 Ga0157372_10200042 3300013307 Bacteria 2314
203 Ga0157372_10293508 3300013307 Bacteria 1891
204 Ga0157372_10350903 3300013307 Bacteria 1719
205 Ga0157375_10006070 3300013308 Bacteria 10538
206 Ga0157375_10049954 3300013308 Bacteria 4101
207 Ga0157375_10271346 3300013308 Bacteria 1859
208 Ga0163163_10309771 3300014325 Bacteria 1632
209 Ga0163163_10361854 3300014325 Bacteria 1507
210 Ga0157380_11170801 3300014326 Bacteria 811
211 Ga0157377_10262497 3300014745 Bacteria 1124
212 Ga0157379_10023299 3300014968 Bacteria 5493
213 Ga0157379_10118300 3300014968 Bacteria 2383
214 Ga0157379_10244968 3300014968 Bacteria 1626
215 Ga0157376_10063664 3300014969 Bacteria 3108
216 Ga0157376_10360946 3300014969 Bacteria 1393
217 Ga0157376_10761883 3300014969 Bacteria 978
218 Ga0157376_11189507 3300014969 Bacteria 790
219 Ga0182005_1042836 3300015265 Bacteria 1230
220 Ga0207666_1010380 3300025271 Bacteria 1273
221 Ga0207697_10000173 3300025315 Bacteria 32981
222 Ga0207697_10195467 3300025315 Bacteria 889
223 Ga0207642_10102160 3300025899 Bacteria 1442
224 Ga0207688_10007915 3300025901 Bacteria 5785
225 Ga0207645_10016805 3300025907 Bacteria 4838
226 Ga0207705_10341692 3300025909 Bacteria 1152
227 Ga0207654_10014094 3300025911 Bacteria 4125
228 Ga0207707_10111879 3300025912 Bacteria 2387
229 Ga0207695_10003747 3300025913 Bacteria 21137
230 Ga0207695_10025050 3300025913 Bacteria 6692
231 Ga0207695_10045629 3300025913 Bacteria 4650
232 Ga0207695_10045878 3300025913 Bacteria 4635
233 Ga0207695_10104126 3300025913 Bacteria 2828
234 Ga0207671_10021522 3300025914 Bacteria 4889
235 Ga0207671_10044095 3300025914 Bacteria 3298
236 Ga0207671_10162139 3300025914 Bacteria 1732
237 Ga0207671_10738935 3300025914 Bacteria 782
238 Ga0207671_10949359 3300025914 Bacteria 679
239 Ga0207662_10369721 3300025918 Bacteria 967
240 Ga0207657_10046799 3300025919 Bacteria 3788
241 Ga0207652_10264124 3300025921 Bacteria 1553
242 Ga0207652_10587638 3300025921 Bacteria 999
243 Ga0207646_10019358 3300025922 Bacteria 6328
244 Ga0207646_10153518 3300025922 Bacteria 2076
245 Ga0207646_10207476 3300025922 Bacteria 1770
246 Ga0207646_10521504 3300025922 Bacteria 1070
247 Ga0207694_10014336 3300025924 Bacteria 5976
248 Ga0207694_10419275 3300025924 Bacteria 1115
249 Ga0207650_10098636 3300025925 Bacteria 2245
250 Ga0207650_10228810 3300025925 Bacteria 1499
251 Ga0207659_10026197 3300025926 Bacteria 3932
252 Ga0207687_10725959 3300025927 Bacteria 844
253 Ga0207644_10134521 3300025931 Bacteria 1897
254 Ga0207644_10227184 3300025931 Bacteria 1482
255 Ga0207644_10518538 3300025931 Bacteria 984
256 Ga0207690_10103710 3300025932 Bacteria 2036
257 Ga0207670_10000002 3300025936 Bacteria 783058
258 Ga0207670_10000012 3300025936 Bacteria 246808
259 Ga0207670_10263964 3300025936 Bacteria 1336
260 Ga0207669_10042111 3300025937 Bacteria 2663
261 Ga0207704_10174511 3300025938 Bacteria 1546
262 Ga0207691_10754003 3300025940 Bacteria 819
263 Ga0207711_10064760 3300025941 Bacteria 3158
264 Ga0207711_10106196 3300025941 Bacteria 2491
265 Ga0207711_10631861 3300025941 Bacteria 999
266 Ga0207689_10626485 3300025942 Bacteria 906
267 Ga0207661_10078568 3300025944 Bacteria 2717
268 Ga0207661_10287051 3300025944 Bacteria 1472
269 Ga0207661_10288691 3300025944 Bacteria 1468
270 Ga0207661_11015252 3300025944 Bacteria 764
271 Ga0207661_11282421 3300025944 Bacteria 673
272 Ga0207679_10030460 3300025945 Bacteria 3768
273 Ga0207679_10034339 3300025945 Bacteria 3577
274 Ga0207679_10363743 3300025945 Bacteria 1264
275 Ga0207679_10457720 3300025945 Bacteria 1132
276 Ga0207679_11993590 3300025945 Bacteria 528
277 Ga0207679_12176906 3300025945 Bacteria 503
278 Ga0207667_10039807 3300025949 Bacteria 5006
279 Ga0207667_10049769 3300025949 Bacteria 4424
280 Ga0207667_10212252 3300025949 Bacteria 1984
281 Ga0207651_10654016 3300025960 Bacteria 923
282 Ga0207651_12005726 3300025960 Bacteria 520
283 Ga0207640_11739770 3300025981 Bacteria 563
284 Ga0207677_10008313 3300026023 Bacteria 5787
285 Ga0207677_10145591 3300026023 Bacteria 1820
286 Ga0207703_10001937 3300026035 Bacteria 18323
287 Ga0207703_10037266 3300026035 Bacteria 3873
288 Ga0207703_10998975 3300026035 Bacteria 803
289 Ga0207639_10036972 3300026041 Bacteria 3623
290 Ga0207639_10483036 3300026041 Bacteria 1129
291 Ga0207678_10189061 3300026067 Bacteria 1759
292 Ga0207702_10020443 3300026078 Bacteria 5484
293 Ga0207702_10041493 3300026078 Bacteria 3859
294 Ga0207702_10087494 3300026078 Bacteria 2720
295 Ga0207648_10374689 3300026089 Bacteria 1286
296 Ga0207674_10016506 3300026116 Bacteria 8081
297 Ga0207675_100217558 3300026118 Bacteria 1840
298 Ga0207683_10086652 3300026121 Bacteria 2784
299 Ga0207428_10602153 3300027907 Bacteria 792
300 Ga0268266_10004587 3300028379 Bacteria 13190
301 Ga0268266_10211401 3300028379 Bacteria 1779
302 Ga0268266_10458147 3300028379 Bacteria 1213
303 Ga0268264_10841290 3300028381 Bacteria 919
304 Ga0268264_10918900 3300028381 Bacteria 879
305 Ga0265336_10025059 3300028666 Bacteria 1880
306 Ga0265338_10047899 3300028800 Bacteria 3896
307 Ga0265338_10169526 3300028800 Bacteria 1676
308 Ga0265332_10071452 3300031238 Bacteria 1478
309 Ga0265332_10140063 3300031238 Bacteria 1014
310 Ga0265320_10025873 3300031240 Bacteria 3079
311 Ga0265325_10069848 3300031241 Bacteria 1765
312 Ga0265340_10001919 3300031247 Bacteria 11878
313 Ga0265339_10005596 3300031249 Bacteria 8345
314 Ga0265327_10334412 3300031251 Bacteria 663
315 Ga0265316_10187562 3300031344 Bacteria 1538
316 Ga0265314_10203779 3300031711 Bacteria 1167
317 Ga0265342_10002056 3300031712 Bacteria 17870
318 Ga0307405_10264235 3300031731 Bacteria 1287
319 Ga0307413_10292404 3300031824 Bacteria 1231
320 Ga0307406_10335624 3300031901 Bacteria 1175
321 Ga0307407_10117357 3300031903 Bacteria 1681
322 Ga0307409_100350603 3300031995 Bacteria 1393
323 Ga0307409_100436971 3300031995 Bacteria 1260
324 Ga0307416_100138336 3300032002 Bacteria 2208
325 Ga0373930_0000190 3300034816 Bacteria 7423
326 Ga0373958_0001725 3300034819 Bacteria 2969
327 Ga0373959_0002213 3300034820 Bacteria 3100
328 Ga0373928_0016570 3300035084 Bacteria 1509
329 Ga0373929_0002028 3300035085 Bacteria 3770
330 Ga0373940_0002904 3300035088 Bacteria 3415
331 Ga0373949_0003873 3300035090 Bacteria 3477
332 Ga0373951_0000928 3300035091 Bacteria 7886
333 Ga0373952_0000354 3300035092 Bacteria 7749
334 Ga0373923_0515455 3300035111 Bacteria 584
335 Ga0373932_0000157 3300035112 Bacteria 19830
336 Ga0373939_0000138 3300035114 Bacteria 20969
337 Ga0373941_0006216 3300035115 Bacteria 2865
338 Ga0373953_0115664 3300035117 Bacteria 1137
339 Ga0373954_0030358 3300035118 Bacteria 2492
340 Ga0373960_0001327 3300035121 Bacteria 5444
341 Ga0373943_0008200 3300035170 Bacteria 4689
342 Ga0373942_0001220 3300035207 Bacteria 6767
343 Ga0373961_0031744 3300035241 Bacteria 1477
344 Ga0373962_0000383 3300035242 Bacteria 9648
345 Ga0373931_0003364 3300035691 Bacteria 7168
346 Ga0373935_0374018 3300035692 Unclassified 1019
347 Ga0373933_0005592 3300035724 Bacteria 6848
348 Ga0373933_0106380 3300035724 Bacteria 1746
349 Ga0373937_0020221 3300036401 Bacteria 5967
350 Ga0373937_0488243 3300036401 Bacteria 1170
351 Ga0373937_0584231 3300036401 Bacteria 1061
352 Ga0373937_0666696 3300036401 Unclassified 986
353 Ga0373937_0903175 3300036401 Bacteria 832
354 Ga0373937_0950083 3300036401 Bacteria 808
355 Ga0373937_0983606 3300036401 Bacteria 792
356 Ga0373925_0240363 3300037068 Bacteria 1450
357 Ga0373925_1768906 3300037068 Bacteria 504
358 Ga0395899_0000019 3300037312 Bacteria 411777
359 Ga0436364_1460136 3300037853 Bacteria 559
360 Ga0395901_0783806 3300038443 Bacteria 944
361 Ga0450893_0123964 3300042532 Bacteria 541
362 Ga0466966_0031693 3300044684 Bacteria 3428
363 Ga0466970_0332934 3300044765 Bacteria 860
364 Ga0466959_0005273 3300045049 Bacteria 8831
365 Ga0451576_0009094 3300045051 Bacteria 11560
366 Ga0451576_0062809 3300045051 Bacteria 3871
367 Ga0495592_0010328 3300046454 Bacteria 7038
368 Ga0495592_0012697 3300046454 Bacteria 6402
369 Ga0495592_0222510 3300046454 Bacteria 1261
370 Ga0495629_0625001 3300046459 Bacteria 719
371 Ga0495651_0019400 3300046462 Bacteria 5270
372 Ga0495651_0305973 3300046462 Bacteria 1065
373 Ga0495653_0023865 3300046463 Bacteria 4937
374 Ga0495653_0232733 3300046463 Bacteria 1232
375 Ga0495580_0116131 3300046472 Bacteria 1859
376 Ga0495582_0100246 3300046473 Bacteria 1621
377 Ga0495662_0089186 3300046476 Bacteria 1502
378 Ga0495662_0234314 3300046476 Unclassified 905
379 Ga0495664_0009481 3300046477 Bacteria 5448
380 Ga0495594_0043164 3300046499 Bacteria 2471
381 Ga0495608_0100893 3300046511 Bacteria 1861
382 Ga0495608_0336005 3300046511 Bacteria 931
383 Ga0495618_0320603 3300046514 Bacteria 960
384 Ga0495628_0031632 3300046516 Bacteria 4279
385 Ga0495628_0031961 3300046516 Bacteria 4253
386 Ga0495628_0383723 3300046516 Bacteria 1028
387 Ga0495630_0001715 3300046517 Bacteria 15275
388 Ga0495630_0098503 3300046517 Bacteria 2211
389 Ga0495630_0118473 3300046517 Bacteria 2008
390 Ga0495630_0433423 3300046517 Bacteria 1007
391 Ga0495642_0037283 3300046528 Bacteria 1967
392 Ga0495642_0496577 3300046528 Bacteria 540
393 Ga0495652_0005289 3300046529 Bacteria 12170
394 Ga0495652_0013888 3300046529 Bacteria 7244
395 Ga0495665_0131718 3300046531 Bacteria 1309
396 Ga0495665_0273764 3300046531 Bacteria 867
397 Ga0495640_0058582 3300046533 Bacteria 2626
398 Ga0495640_0259525 3300046533 Bacteria 1086
399 Ga0495586_0050873 3300046535 Bacteria 2242
400 Ga0495586_0062284 3300046535 Bacteria 2030
401 Ga0495586_0228772 3300046535 Bacteria 1058
402 Ga0495587_0318792 3300046536 Bacteria 868
403 Ga0495645_0004376 3300046543 Bacteria 9646
404 Ga0495645_0012448 3300046543 Bacteria 5995
405 Ga0495645_0045675 3300046543 Bacteria 3196
406 Ga0495645_0093075 3300046543 Bacteria 2152
407 Ga0495645_0559087 3300046543 Bacteria 708
408 Ga0495622_0131859 3300046557 Bacteria 1138
409 Ga0495667_0072161 3300046559 Bacteria 2251
410 Ga0495667_0288240 3300046559 Bacteria 1041
411 Ga0495634_0079517 3300046642 Bacteria 2147
412 Ga0495634_0373011 3300046642 Bacteria 851
413 Ga0495634_0623057 3300046642 Bacteria 625
414 Ga0495635_0125875 3300046663 Bacteria 1747
415 Ga0495635_0134835 3300046663 Bacteria 1683
416 Ga0495659_0005932 3300046664 Bacteria 3863
417 Ga0495657_0298040 3300046675 Bacteria 962
418 Ga0495599_0009115 3300046678 Bacteria 6050
419 Ga0495623_0008411 3300046679 Bacteria 6706
420 Ga0495623_0023472 3300046679 Bacteria 3981
421 Ga0495646_0031461 3300046680 Bacteria 3306
422 Ga0495647_0047070 3300046681 Bacteria 1663
423 Ga0495647_0048000 3300046681 Bacteria 1649
424 Ga0495647_0117742 3300046681 Bacteria 1115
425 Ga0495658_0007509 3300046683 Bacteria 5400
426 Ga0495658_0034712 3300046683 Bacteria 2769
427 Ga0495669_0040346 3300046684 Bacteria 2070
428 Ga0495613_0000501 3300046689 Bacteria 33165
429 Ga0495613_0315689 3300046689 Bacteria 1079
430 Ga0495613_0392185 3300046689 Bacteria 948
431 Ga0495600_0024267 3300046809 Bacteria 3903
432 Ga0495600_0286281 3300046809 Bacteria 1042
433 Ga0495600_0519598 3300046809 Unclassified 730
434 Ga0495604_0043490 3300047317 Bacteria 3516
435 Ga0495604_0054215 3300047317 Bacteria 3095
436 Ga0495604_0163604 3300047317 Bacteria 1570
437 Ga0495674_0026206 3300047319 Bacteria 5336
438 Ga0495674_0060670 3300047319 Bacteria 3299
439 Ga0495674_0776331 3300047319 Bacteria 747
440 Ga0495674_1006766 3300047319 Bacteria 638
441 Ga0495676_0408297 3300047321 Bacteria 900
442 Ga0495680_0029148 3300047322 Bacteria 4522
443 Ga0495680_0042118 3300047322 Bacteria 3626
444 Ga0495680_0216762 3300047322 Bacteria 1368
445 Ga0495680_0221233 3300047322 Bacteria 1351
446 Ga0495680_0368071 3300047322 Unclassified 998
447 Ga0495675_0030348 3300047444 Bacteria 3449
448 Ga0495675_0092974 3300047444 Bacteria 1892
449 Ga0495685_144491 3300047447 Bacteria 774
450 Ga0495684_0000965 3300047471 Bacteria 23436
451 Ga0495684_0000985 3300047471 Bacteria 23151
452 Ga0495686_0477423 3300047472 Bacteria 659
453 Ga0495593_0443683 3300047673 Bacteria 649
454 Ga0495602_0052199 3300048088 Bacteria 3634
455 Ga0495602_0060547 3300048088 Bacteria 3298
456 Ga0495614_0397125 3300048089 Bacteria 647
457 Ga0496100_0056589 3300048903 Bacteria 2566
458 Ga0496100_0361963 3300048903 Bacteria 1098
459 Ga0496101_0017382 3300048904 Bacteria 4879
460 Ga0496102_0041163 3300048905 Bacteria 4183
461 Ga0496102_1783886 3300048905 Bacteria 533
462 Ga0496104_0004247 3300048907 Bacteria 12444
463 Ga0496104_0036250 3300048907 Bacteria 4611
464 Ga0496105_0317164 3300048908 Bacteria 1250
465 Ga0496107_0021957 3300048910 Bacteria 4509
466 Ga0496107_0523554 3300048910 Bacteria 879
467 Ga0496108_0607706 3300048911 Bacteria 953
468 Ga0496108_1581274 3300048911 Bacteria 543
469 Ga0496109_0105997 3300048912 Bacteria 2611
470 Ga0496109_0290550 3300048912 Bacteria 1541
471 Ga0496110_0142980 3300048913 Bacteria 2163
472 Ga0496113_0835433 3300048916 Bacteria 731
473 Ga0496114_0002088 3300048917 Bacteria 15192
474 Ga0496114_0022030 3300048917 Bacteria 5188
475 Ga0496115_0047999 3300048918 Bacteria 3415
476 Ga0496115_0218513 3300048918 Bacteria 1573
477 Ga0496122_0044838 3300048925 Bacteria 3446
478 Ga0496123_0025405 3300048926 Bacteria 4467
479 Ga0496125_0061258 3300048928 Bacteria 3019
480 Ga0496126_0556773 3300048929 Bacteria 909
481 Ga0495678_187849 3300049459 Bacteria 644
482 Ga0501031_0023510 3300049568 Bacteria 4017
483 Ga0501032_0006619 3300049569 Bacteria 8506
484 Ga0501033_0033473 3300049570 Bacteria 3857
485 Ga0501034_0631203 3300049571 Bacteria 974
486 Ga0501036_0009240 3300049572 Bacteria 8105
487 Ga0501037_0001053 3300049573 Bacteria 20410
488 Ga0501038_0001986 3300049574 Bacteria 18917
489 Ga0501039_0009525 3300049575 Bacteria 7403
490 Ga0501043_0001018 3300049579 Bacteria 24636
491 Ga0501046_0000258 3300049580 Bacteria 53994
492 Ga0501046_0396966 3300049580 Bacteria 997
493 Ga0501047_0000977 3300049581 Bacteria 28782
494 Ga0501068_0105988 3300049584 Bacteria 1745
495 Ga0501069_0109389 3300049585 Bacteria 1573
496 Ga0501073_0016701 3300049589 Bacteria 5318
497 Ga0501073_1081196 3300049589 Bacteria 551
498 Ga0501074_0164907 3300049590 Bacteria 1582
499 Ga0501074_0874693 3300049590 Bacteria 633
500 Ga0501075_0293412 3300049591 Bacteria 1239
501 Ga0501076_0912039 3300049592 Bacteria 724
502 Ga0501080_0014125 3300049742 Bacteria 7350
503 Ga0501035_0080665 3300049822 Bacteria 2872
504 Ga0501044_0020441 3300049823 Bacteria 7069
505 Ga0501044_0428637 3300049823 Bacteria 1232
506 Ga0501045_0538802 3300049824 Bacteria 866
507 nmdc:mga03683_207867_c1 3300050489 Bacteria 900
508 nmdc:mga03683_419311_c1 3300050489 Bacteria 641
509 nmdc:mga00v17_721694_c1 3300050491 Bacteria 638
510 nmdc:mga0k408_659704_c1 3300050493 Bacteria 615
511 nmdc:mga05p37_110882_c2 3300050507 Bacteria 2898
512 nmdc:mga05p37_1163168_c1 3300050507 Bacteria 801
513 nmdc:mga05p37_118491_c1 3300050507 Bacteria 3253
514 nmdc:mga05p37_19171_c1 3300050507 Bacteria 8274
515 nmdc:mga05p37_3539_c1 3300050507 Bacteria 18225
516 nmdc:mga05p37_366953_c1 3300050507 Bacteria 1691
517 nmdc:mga09592_622283_c1 3300050508 Bacteria 924
518 nmdc:mga0qj67_172671_c1 3300050509 Bacteria 1755
519 nmdc:mga06r32_240521_c1 3300050510 Bacteria 1798
520 nmdc:mga06r32_48184_c1 3300050510 Bacteria 4073
521 nmdc:mga08y16_102464_c1 3300050511 Bacteria 2980
522 nmdc:mga08y16_433823_c1 3300050511 Bacteria 1342
523 nmdc:mga0n895_10417_c1 3300050512 Bacteria 8210
524 nmdc:mga0n895_104199_c1 3300050512 Bacteria 2849
525 nmdc:mga0rr50_15448_c1 3300050513 Bacteria 5042
526 nmdc:mga0rr50_46356_c1 3300050513 Bacteria 3200
527 nmdc:mga0rr50_67727_c1 3300050513 Bacteria 2713
528 nmdc:mga08x19_1124062_c1 3300050514 Bacteria 557
529 nmdc:mga08x19_490821_c1 3300050514 Bacteria 866
530 nmdc:mga08x19_6557_c1 3300050514 Bacteria 6896
531 nmdc:mga0a205_1046866_c1 3300050515 Bacteria 663
532 nmdc:mga0a205_41606_c1 3300050515 Bacteria 4426
533 nmdc:mga0a205_595710_c1 3300050515 Bacteria 959
534 Ga0495601_0051819 3300053077 Bacteria 2591
535 Ga0495601_0074277 3300053077 Bacteria 2175
536 Ga0495601_0265388 3300053077 Bacteria 1120
537 Ga0495601_0382164 3300053077 Bacteria 914
538 Ga0495595_0064272 3300053084 Bacteria 1724
539 Ga0495595_0215182 3300053084 Bacteria 958
540 Ga0495595_0521376 3300053084 Bacteria 606
541 Ga0495619_0004782 3300053085 Bacteria 8613
542 Ga0495619_0006716 3300053085 Bacteria 7279
543 Ga0495619_0006938 3300053085 Bacteria 7163
544 Ga0495619_0138076 3300053085 Bacteria 1677
545 Ga0500583_0433699 3300053092 Bacteria 626
546 Ga0587076_018069 3300059645 Bacteria 1132
547 Ga0587079_159391 3300059647 Bacteria 589
548 Ga0530510_0395037 3300061734 Bacteria 1042
549 Ga0207646_10718046
550 JGI24739J22299_10194032
551 JGI24743J22301_10008365
552 Ga0065712_10076784
553 Ga0065712_10132493
554 Ga0065715_10107365
555 Ga0065715_10268803
556 Ga0065715_10291854
557 Ga0065715_10869015
558 Ga0065707_10027610
559 Ga0065707_10115429
560 Ga0070676_10011237
561 Ga0070683_100128551
562 Ga0070683_100237802
563 Ga0070690_100279245
564 Ga0070670_100243971
565 Ga0070670_100272122
566 Ga0070680_100024536
567 Ga0068868_100048308
568 Ga0068868_100053829
569 Ga0068868_100131338
570 Ga0068868_100552163
571 Ga0070660_100037692
572 Ga0070689_100000001
573 Ga0070689_100000101
574 Ga0070661_100161254
575 Ga0070675_100042568
576 Ga0070671_100314082
577 Ga0070674_100678123
578 Ga0070673_100483734
579 Ga0070673_101523971
580 Ga0070688_100000001
581 Ga0070688_100067590
582 Ga0070659_100327778
583 Ga0070667_100638324
584 Ga0070709_10134980
585 Ga0070710_10126867
586 Ga0070710_10385507
587 Ga0070711_101462076
588 Ga0070705_100000257
589 Ga0070663_100173922
590 Ga0070663_100705151
591 Ga0070678_100065502
592 Ga0070678_100317871
593 Ga0070678_100834834
594 Ga0070662_100030034
595 Ga0070681_10247445
596 Ga0070681_10360312
597 Ga0070681_10682973
598 Ga0070685_10092012
599 Ga0070685_10129576
600 Ga0070706_100182330
601 Ga0070707_100164279
602 Ga0070707_100557892
603 Ga0070698_100003314
604 Ga0070698_100696887
605 Ga0070698_101052491
606 Ga0070699_100086457
607 Ga0070699_100329802
608 Ga0070679_100054622
609 Ga0070679_100137445
610 Ga0070684_100133335
611 Ga0070684_100141544
612 Ga0070684_100587576
613 Ga0070684_100645644
614 Ga0068853_100057925
615 Ga0068853_100662200
616 Ga0070686_100743803
617 Ga0070695_100185335
618 Ga0070696_100092279
619 Ga0070696_100560238
620 Ga0070665_100226350
621 Ga0070665_100557095
622 Ga0068855_100097809
623 Ga0068855_100310169
624 Ga0068855_100393353
625 Ga0070664_100035559
626 Ga0070664_100614192
627 Ga0068857_100093482
628 Ga0068854_100075900
629 Ga0068854_100228764
630 Ga0068854_100944915
631 Ga0068856_100017387
632 Ga0068856_100251061
633 Ga0070702_100522686
634 Ga0068852_100209420
635 Ga0068852_101061197
636 Ga0068852_102188430
637 Ga0068859_100034183
638 Ga0068859_100977571
639 Ga0068859_101757604
640 Ga0068866_10026547
641 Ga0068866_10073036
642 Ga0068866_10387482
643 Ga0068861_100189500
644 Ga0068861_100555659
645 Ga0068861_101965896
646 Ga0068863_100327412
647 Ga0068858_100002668
648 Ga0068858_100010011
649 Ga0068860_101341727
650 Ga0068860_101369707
651 Ga0068862_100329106
652 Ga0068862_100951623
653 Ga0081455_10001198
654 Ga0081539_10002066
655 Ga0070717_10207889
656 Ga0075365_10070994
657 Ga0075362_10000363
658 Ga0075366_10022348
659 Ga0097621_100004225
660 Ga0097621_100201189
661 Ga0097621_101999760
662 Ga0068871_100046325
663 Ga0068871_100079058
664 Ga0068871_100304635
665 Ga0068871_100775412
666 Ga0068871_100808094
667 Ga0075428_100179306
668 Ga0075431_101652549
669 Ga0075433_10005620
670 Ga0075433_10653137
671 Ga0075434_100034229
672 Ga0075434_101321057
673 Ga0068865_100014987
674 Ga0068865_100172987
675 Ga0075436_100008890
676 Ga0097620_100034180
677 Ga0097620_100911930
678 Ga0097620_100977415
679 Ga0097620_101757593
680 Ga0075435_100027708
681 Ga0105240_10003190
682 Ga0105240_10013677
683 Ga0105240_10021753
684 Ga0105240_10050819
685 Ga0105240_10059121
686 Ga0111539_10244451
687 Ga0105245_10251248
688 Ga0105245_10681560
689 Ga0105245_11402222
690 Ga0105247_10037076
691 Ga0105247_10093456
692 Ga0105247_10252371
693 Ga0114129_10014611
694 Ga0114129_10018464
695 Ga0114129_10053679
696 Ga0114129_10747813
697 Ga0114129_10751851
698 Ga0114129_11314397
699 Ga0114129_12754912
700 Ga0105243_10072216
701 Ga0105243_10863941
702 Ga0105241_10004901
703 Ga0105241_10082389
704 Ga0105242_10050465
705 Ga0105242_10088116
706 Ga0105242_10095366
707 Ga0105242_12595662
708 Ga0105248_10016703
709 Ga0105248_10105109
710 Ga0105248_10131281
711 Ga0105248_10219748
712 Ga0105248_10994150
713 Ga0105237_10007563
714 Ga0105237_10265903
715 Ga0105238_10023968
716 Ga0105238_10596671
717 Ga0105238_10621610
718 Ga0105238_11468180
719 Ga0105249_10111933
720 Ga0105239_10084586
721 Ga0105239_10095116
722 Ga0105239_10290497
723 Ga0105239_10830208
724 Ga0105239_10900287
725 Ga0105246_10157177
726 Ga0105246_10164490
727 Ga0105246_10429306
728 Ga0157373_10526973
729 Ga0157371_10255416
730 Ga0157370_10169793
731 Ga0157370_10172784
732 Ga0157370_10984598
733 Ga0157369_10294707
734 Ga0157369_10431371
735 Ga0157369_10678418
736 Ga0157374_10037668
737 Ga0157374_10070419
738 Ga0157374_10116705
739 Ga0157374_10785018
740 Ga0157374_11546171
741 Ga0157378_10005847
742 Ga0157378_10017861
743 Ga0157378_10284868
744 Ga0157378_10923679
745 Ga0157378_11967509
746 Ga0163162_10112464
747 Ga0163162_10346429
748 Ga0163162_11765998
749 Ga0157372_10130575
750 Ga0157372_10200042
751 Ga0157372_10293508
752 Ga0157372_10350903
753 Ga0157375_10006070
754 Ga0157375_10049954
755 Ga0157375_10271346
756 Ga0163163_10309771
757 Ga0163163_10361854
758 Ga0157380_11170801
759 Ga0157377_10262497
760 Ga0157379_10023299
761 Ga0157379_10118300
762 Ga0157379_10244968
763 Ga0157376_10063664
764 Ga0157376_10360946
765 Ga0157376_10761883
766 Ga0157376_11189507
767 Ga0182005_1042836
768 Ga0207666_1010380
769 Ga0207697_10000173
770 Ga0207697_10195467
771 Ga0207642_10102160
772 Ga0207688_10007915
773 Ga0207645_10016805
774 Ga0207705_10341692
775 Ga0207654_10014094
776 Ga0207707_10111879
777 Ga0207695_10003747
778 Ga0207695_10025050
779 Ga0207695_10045629
780 Ga0207695_10045878
781 Ga0207695_10104126
782 Ga0207671_10021522
783 Ga0207671_10044095
784 Ga0207671_10162139
785 Ga0207671_10738935
786 Ga0207671_10949359
787 Ga0207662_10369721
788 Ga0207657_10046799
789 Ga0207652_10264124
790 Ga0207652_10587638
791 Ga0207646_10019358
792 Ga0207646_10153518
793 Ga0207646_10207476
794 Ga0207646_10521504
795 Ga0207694_10014336
796 Ga0207694_10419275
797 Ga0207650_10098636
798 Ga0207650_10228810
799 Ga0207659_10026197
800 Ga0207687_10725959
801 Ga0207644_10134521
802 Ga0207644_10227184
803 Ga0207644_10518538
804 Ga0207690_10103710
805 Ga0207670_10000002
806 Ga0207670_10000012
807 Ga0207670_10263964
808 Ga0207669_10042111
809 Ga0207704_10174511
810 Ga0207691_10754003
811 Ga0207711_10064760
812 Ga0207711_10106196
813 Ga0207711_10631861
814 Ga0207689_10626485
815 Ga0207661_10078568
816 Ga0207661_10287051
817 Ga0207661_10288691
818 Ga0207661_11015252
819 Ga0207661_11282421
820 Ga0207679_10030460
821 Ga0207679_10034339
822 Ga0207679_10363743
823 Ga0207679_10457720
824 Ga0207679_11993590
825 Ga0207679_12176906
826 Ga0207667_10039807
827 Ga0207667_10049769
828 Ga0207667_10212252
829 Ga0207651_10654016
830 Ga0207651_12005726
831 Ga0207640_11739770
832 Ga0207677_10008313
833 Ga0207677_10145591
834 Ga0207703_10001937
835 Ga0207703_10037266
836 Ga0207703_10998975
837 Ga0207639_10036972
838 Ga0207639_10483036
839 Ga0207678_10189061
840 Ga0207702_10020443
841 Ga0207702_10041493
842 Ga0207702_10087494
843 Ga0207648_10374689
844 Ga0207674_10016506
845 Ga0207675_100217558
846 Ga0207683_10086652
847 Ga0207428_10602153
848 Ga0268266_10004587
849 Ga0268266_10211401
850 Ga0268266_10458147
851 Ga0268264_10841290
852 Ga0268264_10918900
853 Ga0265336_10025059
854 Ga0265338_10047899
855 Ga0265338_10169526
856 Ga0265332_10071452
857 Ga0265332_10140063
858 Ga0265320_10025873
859 Ga0265325_10069848
860 Ga0265340_10001919
861 Ga0265339_10005596
862 Ga0265327_10334412
863 Ga0265316_10187562
864 Ga0265314_10203779
865 Ga0265342_10002056
866 Ga0307405_10264235
867 Ga0307413_10292404
868 Ga0307406_10335624
869 Ga0307407_10117357
870 Ga0307409_100350603
871 Ga0307409_100436971
872 Ga0307416_100138336
873 Ga0373930_0000190
874 Ga0373958_0001725
875 Ga0373959_0002213
876 Ga0373928_0016570
877 Ga0373929_0002028
878 Ga0373940_0002904
879 Ga0373949_0003873
880 Ga0373951_0000928
881 Ga0373952_0000354
882 Ga0373923_0515455
883 Ga0373932_0000157
884 Ga0373939_0000138
885 Ga0373941_0006216
886 Ga0373953_0115664
887 Ga0373954_0030358
888 Ga0373960_0001327
889 Ga0373943_0008200
890 Ga0373942_0001220
891 Ga0373961_0031744
892 Ga0373962_0000383
893 Ga0373931_0003364
894 Ga0373935_0374018
895 Ga0373933_0005592
896 Ga0373933_0106380
897 Ga0373937_0020221
898 Ga0373937_0488243
899 Ga0373937_0584231
900 Ga0373937_0666696
901 Ga0373937_0903175
902 Ga0373937_0950083
903 Ga0373937_0983606
904 Ga0373925_0240363
905 Ga0373925_1768906
906 Ga0395899_0000019
907 Ga0436364_1460136
908 Ga0395901_0783806
909 Ga0450893_0123964
910 Ga0466966_0031693
911 Ga0466970_0332934
912 Ga0466959_0005273
913 Ga0451576_0009094
914 Ga0451576_0062809
915 Ga0495592_0010328
916 Ga0495592_0012697
917 Ga0495592_0222510
918 Ga0495629_0625001
919 Ga0495651_0019400
920 Ga0495651_0305973
921 Ga0495653_0023865
922 Ga0495653_0232733
923 Ga0495580_0116131
924 Ga0495582_0100246
925 Ga0495662_0089186
926 Ga0495662_0234314
927 Ga0495664_0009481
928 Ga0495594_0043164
929 Ga0495608_0100893
930 Ga0495608_0336005
931 Ga0495618_0320603
932 Ga0495628_0031632
933 Ga0495628_0031961
934 Ga0495628_0383723
935 Ga0495630_0001715
936 Ga0495630_0098503
937 Ga0495630_0118473
938 Ga0495630_0433423
939 Ga0495642_0037283
940 Ga0495642_0496577
941 Ga0495652_0005289
942 Ga0495652_0013888
943 Ga0495665_0131718
944 Ga0495665_0273764
945 Ga0495640_0058582
946 Ga0495640_0259525
947 Ga0495586_0050873
948 Ga0495586_0062284
949 Ga0495586_0228772
950 Ga0495587_0318792
951 Ga0495645_0004376
952 Ga0495645_0012448
953 Ga0495645_0045675
954 Ga0495645_0093075
955 Ga0495645_0559087
956 Ga0495622_0131859
957 Ga0495667_0072161
958 Ga0495667_0288240
959 Ga0495634_0079517
960 Ga0495634_0373011
961 Ga0495634_0623057
962 Ga0495635_0125875
963 Ga0495635_0134835
964 Ga0495659_0005932
965 Ga0495657_0298040
966 Ga0495599_0009115
967 Ga0495623_0008411
968 Ga0495623_0023472
969 Ga0495646_0031461
970 Ga0495647_0047070
971 Ga0495647_0048000
972 Ga0495647_0117742
973 Ga0495658_0007509
974 Ga0495658_0034712
975 Ga0495669_0040346
976 Ga0495613_0000501
977 Ga0495613_0315689
978 Ga0495613_0392185
979 Ga0495600_0024267
980 Ga0495600_0286281
981 Ga0495600_0519598
982 Ga0495604_0043490
983 Ga0495604_0054215
984 Ga0495604_0163604
985 Ga0495674_0026206
986 Ga0495674_0060670
987 Ga0495674_0776331
988 Ga0495674_1006766
989 Ga0495676_0408297
990 Ga0495680_0029148
991 Ga0495680_0042118
992 Ga0495680_0216762
993 Ga0495680_0221233
994 Ga0495680_0368071
995 Ga0495675_0030348
996 Ga0495675_0092974
997 Ga0495685_144491
998 Ga0495684_0000965
999 Ga0495684_0000985
1000 Ga0495686_0477423
1001 Ga0495593_0443683
1002 Ga0495602_0052199
1003 Ga0495602_0060547
1004 Ga0495614_0397125
1005 Ga0496100_0056589
1006 Ga0496100_0361963
1007 Ga0496101_0017382
1008 Ga0496102_0041163
1009 Ga0496102_1783886
1010 Ga0496104_0004247
1011 Ga0496104_0036250
1012 Ga0496105_0317164
1013 Ga0496107_0021957
1014 Ga0496107_0523554
1015 Ga0496108_0607706
1016 Ga0496108_1581274
1017 Ga0496109_0105997
1018 Ga0496109_0290550
1019 Ga0496110_0142980
1020 Ga0496113_0835433
1021 Ga0496114_0002088
1022 Ga0496114_0022030
1023 Ga0496115_0047999
1024 Ga0496115_0218513
1025 Ga0496122_0044838
1026 Ga0496123_0025405
1027 Ga0496125_0061258
1028 Ga0496126_0556773
1029 Ga0495678_187849
1030 Ga0501031_0023510
1031 Ga0501032_0006619
1032 Ga0501033_0033473
1033 Ga0501034_0631203
1034 Ga0501036_0009240
1035 Ga0501037_0001053
1036 Ga0501038_0001986
1037 Ga0501039_0009525
1038 Ga0501043_0001018
1039 Ga0501046_0000258
1040 Ga0501046_0396966
1041 Ga0501047_0000977
1042 Ga0501068_0105988
1043 Ga0501069_0109389
1044 Ga0501073_0016701
1045 Ga0501073_1081196
1046 Ga0501074_0164907
1047 Ga0501074_0874693
1048 Ga0501075_0293412
1049 Ga0501076_0912039
1050 Ga0501080_0014125
1051 Ga0501035_0080665
1052 Ga0501044_0020441
1053 Ga0501044_0428637
1054 Ga0501045_0538802
1055 nmdc:mga03683_207867_c1
1056 nmdc:mga03683_419311_c1
1057 nmdc:mga00v17_721694_c1
1058 nmdc:mga0k408_659704_c1
1059 nmdc:mga05p37_110882_c2
1060 nmdc:mga05p37_1163168_c1
1061 nmdc:mga05p37_118491_c1
1062 nmdc:mga05p37_19171_c1
1063 nmdc:mga05p37_3539_c1
1064 nmdc:mga05p37_366953_c1
1065 nmdc:mga09592_622283_c1
1066 nmdc:mga0qj67_172671_c1
1067 nmdc:mga06r32_240521_c1
1068 nmdc:mga06r32_48184_c1
1069 nmdc:mga08y16_102464_c1
1070 nmdc:mga08y16_433823_c1
1071 nmdc:mga0n895_10417_c1
1072 nmdc:mga0n895_104199_c1
1073 nmdc:mga0rr50_15448_c1
1074 nmdc:mga0rr50_46356_c1
1075 nmdc:mga0rr50_67727_c1
1076 nmdc:mga08x19_1124062_c1
1077 nmdc:mga08x19_490821_c1
1078 nmdc:mga08x19_6557_c1
1079 nmdc:mga0a205_1046866_c1
1080 nmdc:mga0a205_41606_c1
1081 nmdc:mga0a205_595710_c1
1082 Ga0495601_0051819
1083 Ga0495601_0074277
1084 Ga0495601_0265388
1085 Ga0495601_0382164
1086 Ga0495595_0064272
1087 Ga0495595_0215182
1088 Ga0495595_0521376
1089 Ga0495619_0004782
1090 Ga0495619_0006716
1091 Ga0495619_0006938
1092 Ga0495619_0138076
1093 Ga0500583_0433699
1094 Ga0587076_018069
1095 Ga0587079_159391
1096 Ga0530510_0395037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

60

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7506 14 132
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6925 14 132
3nk4-assembly1.cif.gz_A crystal structure of full-length sperm receptor zp3 at 2.0 a resolution 0.6021 68 113
3fdd-assembly1.cif.gz_A the crystal structure of the pseudomonas dacunhae aspartate-beta-decarboxylase reveals a novel oligomeric assembly for a pyridoxal-5-phosphate dependent enzyme 0.5756 83 140
6xi8-assembly1.cif.gz_A yeast tfiik (kin28/ccl1/tfb3) complex 0.5413 63 110
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7405 14 132 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7193 14 132 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7049 14 135 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6893 14 135 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6329 32 133 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A2V7X7N0-F1-model_v4 YdhG-like domain-containing protein 0.9942 12 85
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.9902 12 138
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.99 7 139
AF-A0A1Q3J442-F1-model_v4 deleted 0.9896 11 138
AF-A0A427CGT7-F1-model_v4 DUF1801 domain-containing protein 0.988 15 132

Map