F462145

General Info

Members Datasets Scaffolds Average Seq Length
547 195 1094 142

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0316830|Ga0451576_0316830_1030_1527
Length 165
Sequence VLSVSVANLCSRTGISSKSKLNIMAEQSFKNHGRYVFMFHIVTYLAIIAVIIGSIINLVNSSKENLYSASLLVVVSLILASLAWFGRRFALKAQDRAIRAEENFRHFILTGKPLDQRLRMGQIIALRFAPDEEFAVLCQQAIDKHLRGVDIKKAIQNWRADHHRA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
152 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
191 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
192 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
193 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
194 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
195 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 1.28
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0316830 3300045051 Bacteria 1632
2 Ga0055541_1003853 3300003841 Unclassified 2778
3 Ga0065714_10360318 3300005288 Bacteria 626
4 Ga0065704_10219966 3300005289 Bacteria 1078
5 Ga0065707_10106781 3300005295 Bacteria 2582
6 Ga0070676_10153937 3300005328 Bacteria 1474
7 Ga0070676_10285916 3300005328 Bacteria 1113
8 Ga0070676_10508163 3300005328 Bacteria 856
9 Ga0070683_100002704 3300005329 Bacteria 14159
10 Ga0070683_100054658 3300005329 Bacteria 3703
11 Ga0070683_100825574 3300005329 Bacteria 889
12 Ga0070690_100110654 3300005330 Bacteria 1833
13 Ga0070690_100239582 3300005330 Bacteria 1279
14 Ga0070690_100360165 3300005330 Bacteria 1058
15 Ga0070670_100114521 3300005331 Bacteria 2325
16 Ga0070670_100352454 3300005331 Bacteria 1293
17 Ga0070670_101043677 3300005331 Bacteria 744
18 Ga0070670_101623806 3300005331 Bacteria 594
19 Ga0068869_100001801 3300005334 Bacteria 12858
20 Ga0068869_100002404 3300005334 Bacteria 11276
21 Ga0068869_100068090 3300005334 Bacteria 2628
22 Ga0068869_100263277 3300005334 Unclassified 1381
23 Ga0070666_10000343 3300005335 Bacteria 29213
24 Ga0070666_10003094 3300005335 Bacteria 10099
25 Ga0070666_10006710 3300005335 Bacteria 7086
26 Ga0070666_10379210 3300005335 Bacteria 1015
27 Ga0070680_100988829 3300005336 Bacteria 726
28 Ga0070682_100000615 3300005337 Bacteria 21697
29 Ga0070682_101342104 3300005337 Bacteria 609
30 Ga0068868_100001576 3300005338 Bacteria 15548
31 Ga0068868_100005037 3300005338 Bacteria 9278
32 Ga0068868_100024635 3300005338 Bacteria 4569
33 Ga0068868_100587584 3300005338 Bacteria 985
34 Ga0068868_100625132 3300005338 Bacteria 956
35 Ga0070660_100107151 3300005339 Bacteria 2220
36 Ga0070660_100119986 3300005339 Unclassified 2098
37 Ga0070689_100003592 3300005340 Bacteria 10338
38 Ga0070689_100036508 3300005340 Bacteria 3759
39 Ga0070689_100471574 3300005340 Bacteria 1071
40 Ga0070687_100079983 3300005343 Bacteria 1780
41 Ga0070687_100841515 3300005343 Bacteria 653
42 Ga0070661_100002718 3300005344 Bacteria 12129
43 Ga0070661_100026468 3300005344 Bacteria 4172
44 Ga0070668_100031675 3300005347 Bacteria 4023
45 Ga0070668_100055577 3300005347 Bacteria 3056
46 Ga0070668_100161369 3300005347 Bacteria 1819
47 Ga0070668_100317249 3300005347 Bacteria 1311
48 Ga0070668_100621479 3300005347 Bacteria 947
49 Ga0070669_100147252 3300005353 Bacteria 1820
50 Ga0070669_100425025 3300005353 Unclassified 1091
51 Ga0070675_100070658 3300005354 Bacteria 2894
52 Ga0070675_100075244 3300005354 Bacteria 2807
53 Ga0070675_100870053 3300005354 Bacteria 825
54 Ga0070671_100037170 3300005355 Bacteria 4038
55 Ga0070671_100281158 3300005355 Bacteria 1415
56 Ga0070671_100311187 3300005355 Bacteria 1342
57 Ga0070671_100418731 3300005355 Bacteria 1147
58 Ga0070674_100027718 3300005356 Bacteria 3714
59 Ga0070674_100975152 3300005356 Unclassified 742
60 Ga0070673_100057940 3300005364 Unclassified 3062
61 Ga0070673_100086406 3300005364 Bacteria 2555
62 Ga0070673_100151559 3300005364 Bacteria 1964
63 Ga0070673_100254950 3300005364 Unclassified 1530
64 Ga0070673_100584379 3300005364 Bacteria 1017
65 Ga0070673_100620617 3300005364 Bacteria 987
66 Ga0070673_101563292 3300005364 Bacteria 623
67 Ga0070688_100015034 3300005365 Bacteria 4394
68 Ga0070688_100046530 3300005365 Unclassified 2687
69 Ga0070688_100132505 3300005365 Bacteria 1683
70 Ga0070688_100201828 3300005365 Bacteria 1392
71 Ga0070688_100603560 3300005365 Bacteria 840
72 Ga0070688_101193101 3300005365 Bacteria 611
73 Ga0070659_100003017 3300005366 Bacteria 11979
74 Ga0070659_100137032 3300005366 Bacteria 1990
75 Ga0070667_100007191 3300005367 Bacteria 9252
76 Ga0070667_100040313 3300005367 Bacteria 3916
77 Ga0070667_100051508 3300005367 Bacteria 3472
78 Ga0070667_100294260 3300005367 Bacteria 1461
79 Ga0070667_101541984 3300005367 Bacteria 624
80 Ga0070667_101918722 3300005367 Unclassified 558
81 Ga0070663_100022580 3300005455 Bacteria 4209
82 Ga0070663_101558296 3300005455 Bacteria 588
83 Ga0070678_100004882 3300005456 Bacteria 7666
84 Ga0070678_100344285 3300005456 Bacteria 1280
85 Ga0070662_100078148 3300005457 Bacteria 2457
86 Ga0070662_100149262 3300005457 Bacteria 1818
87 Ga0070662_100230070 3300005457 Bacteria 1483
88 Ga0070662_100258767 3300005457 Bacteria 1402
89 Ga0070662_100656594 3300005457 Bacteria 885
90 Ga0068867_100091135 3300005459 Bacteria 2314
91 Ga0068867_100470614 3300005459 Bacteria 1075
92 Ga0068867_100709589 3300005459 Unclassified 888
93 Ga0068867_101319684 3300005459 Bacteria 667
94 Ga0070685_10001175 3300005466 Bacteria 14009
95 Ga0070685_10016240 3300005466 Bacteria 3964
96 Ga0070685_10019789 3300005466 Bacteria 3636
97 Ga0070685_10358343 3300005466 Bacteria 999
98 Ga0070685_10450427 3300005466 Bacteria 901
99 Ga0070707_100171349 3300005468 Unclassified 2115
100 Ga0070698_100001454 3300005471 Bacteria 26303
101 Ga0070698_100003684 3300005471 Bacteria 16818
102 Ga0070698_100113620 3300005471 Bacteria 2673
103 Ga0070684_100002308 3300005535 Bacteria 14058
104 Ga0070684_100004905 3300005535 Bacteria 10213
105 Ga0070684_100165894 3300005535 Bacteria 2004
106 Ga0070684_100885651 3300005535 Bacteria 836
107 Ga0070697_100431290 3300005536 Unclassified 1146
108 Ga0068853_100000991 3300005539 Bacteria 19981
109 Ga0068853_100316403 3300005539 Bacteria 1446
110 Ga0068853_100826806 3300005539 Bacteria 888
111 Ga0070672_100112933 3300005543 Unclassified 2217
112 Ga0070672_100217675 3300005543 Bacteria 1601
113 Ga0070672_100879537 3300005543 Unclassified 791
114 Ga0070686_100127911 3300005544 Bacteria 1753
115 Ga0070665_100019061 3300005548 Bacteria 6883
116 Ga0070665_100302031 3300005548 Bacteria 1604
117 Ga0070664_100000487 3300005564 Bacteria 30067
118 Ga0070664_100157024 3300005564 Bacteria 2010
119 Ga0070664_100972817 3300005564 Bacteria 797
120 Ga0068857_100010942 3300005577 Bacteria 7897
121 Ga0068857_100236492 3300005577 Bacteria 1671
122 Ga0068857_100796341 3300005577 Bacteria 902
123 Ga0068857_101077833 3300005577 Bacteria 775
124 Ga0068854_100068525 3300005578 Bacteria 2587
125 Ga0068854_100394632 3300005578 Unclassified 1143
126 Ga0070702_100205186 3300005615 Bacteria 1308
127 Ga0068852_100009551 3300005616 Bacteria 7207
128 Ga0068852_100055294 3300005616 Bacteria 3425
129 Ga0068852_100086994 3300005616 Unclassified 2787
130 Ga0068852_100157367 3300005616 Bacteria 2118
131 Ga0068852_101027477 3300005616 Bacteria 843
132 Ga0068852_101145458 3300005616 Bacteria 798
133 Ga0068852_101456981 3300005616 Bacteria 707
134 Ga0068852_102260078 3300005616 Unclassified 565
135 Ga0068859_100000066 3300005617 Bacteria 100640
136 Ga0068859_100022046 3300005617 Bacteria 6387
137 Ga0068859_100032137 3300005617 Bacteria 5271
138 Ga0068859_100072045 3300005617 Bacteria 3491
139 Ga0068859_100100712 3300005617 Bacteria 2945
140 Ga0068859_100161799 3300005617 Bacteria 2317
141 Ga0068864_100002791 3300005618 Bacteria 14425
142 Ga0068864_100253791 3300005618 Bacteria 1634
143 Ga0068864_100288108 3300005618 Bacteria 1535
144 Ga0068864_100460300 3300005618 Bacteria 1218
145 Ga0068864_101221820 3300005618 Bacteria 750
146 Ga0068866_10017787 3300005718 Bacteria 3203
147 Ga0068861_100015024 3300005719 Bacteria 5447
148 Ga0068861_100016232 3300005719 Bacteria 5264
149 Ga0068861_100344137 3300005719 Bacteria 1306
150 Ga0068851_10055183 3300005834 Bacteria 2024
151 Ga0068851_10210439 3300005834 Bacteria 1089
152 Ga0068870_10017853 3300005840 Bacteria 3415
153 Ga0068870_10110746 3300005840 Bacteria 1567
154 Ga0068870_10234818 3300005840 Bacteria 1129
155 Ga0068863_100057852 3300005841 Bacteria 3669
156 Ga0068863_100100769 3300005841 Bacteria 2745
157 Ga0068863_100234925 3300005841 Bacteria 1769
158 Ga0068863_100286542 3300005841 Bacteria 1596
159 Ga0068863_100796365 3300005841 Bacteria 942
160 Ga0068858_100037050 3300005842 Bacteria 4521
161 Ga0068858_100484420 3300005842 Bacteria 1194
162 Ga0068858_100618280 3300005842 Bacteria 1052
163 Ga0068860_100015000 3300005843 Bacteria 7572
164 Ga0068860_100019019 3300005843 Bacteria 6671
165 Ga0068860_100169266 3300005843 Bacteria 2110
166 Ga0068860_100305079 3300005843 Bacteria 1561
167 Ga0068860_100513965 3300005843 Bacteria 1197
168 Ga0068862_100211569 3300005844 Bacteria 1752
169 Ga0068862_101137631 3300005844 Bacteria 777
170 Ga0075366_10038215 3300006195 Bacteria 2835
171 Ga0097621_100017525 3300006237 Bacteria 5440
172 Ga0097621_100052293 3300006237 Bacteria 3327
173 Ga0097621_100209943 3300006237 Bacteria 1694
174 Ga0097621_100212520 3300006237 Bacteria 1683
175 Ga0097621_101203605 3300006237 Bacteria 713
176 Ga0068871_100017514 3300006358 Bacteria 5424
177 Ga0068871_100017709 3300006358 Bacteria 5397
178 Ga0068871_100026685 3300006358 Bacteria 4510
179 Ga0068871_100117951 3300006358 Bacteria 2239
180 Ga0068871_100137329 3300006358 Bacteria 2077
181 Ga0068871_100182471 3300006358 Bacteria 1804
182 Ga0068871_100827851 3300006358 Bacteria 855
183 Ga0068871_102007550 3300006358 Unclassified 550
184 Ga0075428_100099699 3300006844 Bacteria 3167
185 Ga0075430_100059443 3300006846 Unclassified 3213
186 Ga0075434_100265160 3300006871 Bacteria 1737
187 Ga0075429_100243064 3300006880 Bacteria 1576
188 Ga0075429_100311060 3300006880 Unclassified 1379
189 Ga0068865_100010135 3300006881 Bacteria 5859
190 Ga0068865_100051856 3300006881 Bacteria 2841
191 Ga0068865_100117981 3300006881 Bacteria 1968
192 Ga0097620_100000066 3300006931 Bacteria 100640
193 Ga0097620_100022046 3300006931 Bacteria 6387
194 Ga0097620_100032137 3300006931 Bacteria 5271
195 Ga0097620_100072045 3300006931 Bacteria 3491
196 Ga0097620_100100705 3300006931 Bacteria 2945
197 Ga0097620_100161798 3300006931 Bacteria 2317
198 Ga0097620_100886184 3300006931 Bacteria 977
199 Ga0105251_10346200 3300009011 Bacteria 678
200 Ga0105245_10717157 3300009098 Bacteria 1034
201 Ga0105245_11801249 3300009098 Bacteria 665
202 Ga0105247_10006282 3300009101 Bacteria 7369
203 Ga0105247_10347342 3300009101 Bacteria 1042
204 Ga0105247_11598172 3300009101 Bacteria 535
205 Ga0114129_10084135 3300009147 Bacteria 4417
206 Ga0105241_10014747 3300009174 Bacteria 5720
207 Ga0105241_10083612 3300009174 Bacteria 2504
208 Ga0105241_10267168 3300009174 Unclassified 1456
209 Ga0105241_10465928 3300009174 Bacteria 1120
210 Ga0105241_10520047 3300009174 Bacteria 1064
211 Ga0105242_10008426 3300009176 Bacteria 7924
212 Ga0105242_10037382 3300009176 Bacteria 3899
213 Ga0105242_10440225 3300009176 Bacteria 1226
214 Ga0105242_10904860 3300009176 Unclassified 883
215 Ga0105242_12381085 3300009176 Bacteria 577
216 Ga0105248_10194998 3300009177 Bacteria 2282
217 Ga0105248_10375350 3300009177 Bacteria 1601
218 Ga0105248_10430250 3300009177 Bacteria 1486
219 Ga0105248_10485574 3300009177 Unclassified 1392
220 Ga0105237_10006277 3300009545 Bacteria 13220
221 Ga0105249_10003442 3300009553 Bacteria 13704
222 Ga0105249_10006330 3300009553 Bacteria 10290
223 Ga0105249_10031421 3300009553 Bacteria 4803
224 Ga0105249_10135289 3300009553 Unclassified 2357
225 Ga0105249_10138206 3300009553 Bacteria 2334
226 Ga0105249_10145555 3300009553 Bacteria 2276
227 Ga0105249_10320668 3300009553 Unclassified 1561
228 Ga0105249_11193080 3300009553 Unclassified 832
229 Ga0105239_12776571 3300010375 Bacteria 571
230 Ga0105239_13542009 3300010375 Unclassified 507
231 Ga0105246_10091410 3300011119 Bacteria 2194
232 Ga0105246_10147174 3300011119 Bacteria 1779
233 Ga0105246_10231951 3300011119 Bacteria 1454
234 Ga0105246_10473370 3300011119 Bacteria 1058
235 Ga0105246_10636928 3300011119 Bacteria 926
236 Ga0105246_10649985 3300011119 Bacteria 918
237 Ga0105246_10763083 3300011119 Bacteria 854
238 Ga0105246_10861914 3300011119 Bacteria 809
239 Ga0105246_11029890 3300011119 Unclassified 747
240 Ga0157371_10059522 3300013102 Bacteria 2708
241 Ga0157371_10212920 3300013102 Bacteria 1387
242 Ga0157370_10927226 3300013104 Bacteria 790
243 Ga0157370_11641877 3300013104 Bacteria 577
244 Ga0157374_10000558 3300013296 Bacteria 33101
245 Ga0157374_10054271 3300013296 Bacteria 3738
246 Ga0157374_10139346 3300013296 Bacteria 2354
247 Ga0157374_10326098 3300013296 Unclassified 1522
248 Ga0157374_10355348 3300013296 Unclassified 1456
249 Ga0157374_11010098 3300013296 Bacteria 851
250 Ga0157374_11014026 3300013296 Bacteria 849
251 Ga0157374_11314338 3300013296 Unclassified 745
252 Ga0157378_10010511 3300013297 Bacteria 8087
253 Ga0157378_10023722 3300013297 Bacteria 5397
254 Ga0157378_10030068 3300013297 Unclassified 4798
255 Ga0157378_10031145 3300013297 Bacteria 4711
256 Ga0157378_10092897 3300013297 Bacteria 2746
257 Ga0157378_10110736 3300013297 Bacteria 2517
258 Ga0157378_10371214 3300013297 Bacteria 1403
259 Ga0157378_10605059 3300013297 Unclassified 1108
260 Ga0157378_10978524 3300013297 Bacteria 879
261 Ga0157378_11134846 3300013297 Bacteria 819
262 Ga0163162_10001190 3300013306 Bacteria 24282
263 Ga0163162_10003657 3300013306 Bacteria 14752
264 Ga0163162_10132607 3300013306 Bacteria 2601
265 Ga0163162_10186380 3300013306 Bacteria 2202
266 Ga0163162_10883701 3300013306 Unclassified 1008
267 Ga0163162_11274608 3300013306 Bacteria 835
268 Ga0163162_11613224 3300013306 Bacteria 740
269 Ga0163162_12732609 3300013306 Unclassified 568
270 Ga0157372_10067381 3300013307 Bacteria 4022
271 Ga0157372_10236397 3300013307 Bacteria 2119
272 Ga0157372_10252790 3300013307 Bacteria 2046
273 Ga0157372_10408227 3300013307 Bacteria 1583
274 Ga0157372_10965831 3300013307 Bacteria 987
275 Ga0157375_10014469 3300013308 Bacteria 7039
276 Ga0157375_10017032 3300013308 Bacteria 6547
277 Ga0157375_10029728 3300013308 Bacteria 5142
278 Ga0157375_10031175 3300013308 Bacteria 5035
279 Ga0157375_10067754 3300013308 Bacteria 3567
280 Ga0157375_10148153 3300013308 Bacteria 2480
281 Ga0157375_10193384 3300013308 Bacteria 2189
282 Ga0157375_11627712 3300013308 Bacteria 764
283 Ga0157375_11637993 3300013308 Bacteria 761
284 Ga0157375_12453084 3300013308 Bacteria 622
285 Ga0163163_10005738 3300014325 Bacteria 10770
286 Ga0163163_10055754 3300014325 Bacteria 3906
287 Ga0163163_10699868 3300014325 Unclassified 1077
288 Ga0163163_12291301 3300014325 Unclassified 599
289 Ga0157380_10113126 3300014326 Bacteria 2285
290 Ga0157380_10125236 3300014326 Bacteria 2183
291 Ga0157380_12377885 3300014326 Bacteria 595
292 Ga0157379_10034537 3300014968 Bacteria 4509
293 Ga0157379_10095850 3300014968 Bacteria 2662
294 Ga0157379_10171315 3300014968 Bacteria 1960
295 Ga0157379_10220132 3300014968 Unclassified 1720
296 Ga0157379_10240677 3300014968 Bacteria 1641
297 Ga0157379_10271488 3300014968 Bacteria 1542
298 Ga0157379_10354466 3300014968 Bacteria 1344
299 Ga0157379_10832464 3300014968 Bacteria 872
300 Ga0157379_11096702 3300014968 Bacteria 762
301 Ga0157379_11504656 3300014968 Bacteria 655
302 Ga0157376_10002310 3300014969 Bacteria 12878
303 Ga0157376_10007675 3300014969 Bacteria 7726
304 Ga0157376_10065614 3300014969 Bacteria 3066
305 Ga0157376_10208878 3300014969 Bacteria 1801
306 Ga0157376_10240077 3300014969 Bacteria 1688
307 Ga0157376_10286674 3300014969 Bacteria 1553
308 Ga0157376_10741759 3300014969 Bacteria 990
309 Ga0163161_10006779 3300017792 Bacteria 7914
310 Ga0163161_10010666 3300017792 Bacteria 6363
311 Ga0163161_11214102 3300017792 Bacteria 652
312 Ga0213876_10015475 3300021384 Bacteria 4036
313 Ga0213876_10614735 3300021384 Unclassified 578
314 Ga0209566_100159 3300025225 Bacteria 75810
315 Ga0207697_10017606 3300025315 Bacteria 2936
316 Ga0207697_10183914 3300025315 Bacteria 916
317 Ga0207642_10387356 3300025899 Bacteria 833
318 Ga0207710_10190784 3300025900 Bacteria 1009
319 Ga0207688_10014941 3300025901 Bacteria 4212
320 Ga0207680_10014569 3300025903 Unclassified 4075
321 Ga0207680_10032561 3300025903 Bacteria 2964
322 Ga0207680_10372561 3300025903 Bacteria 1005
323 Ga0207647_10008850 3300025904 Bacteria 7184
324 Ga0207685_10026004 3300025905 Bacteria 2029
325 Ga0207645_10001795 3300025907 Bacteria 17324
326 Ga0207645_10005868 3300025907 Bacteria 8845
327 Ga0207645_10275967 3300025907 Bacteria 1115
328 Ga0207643_10008037 3300025908 Bacteria 5659
329 Ga0207654_10377989 3300025911 Bacteria 981
330 Ga0207654_11112451 3300025911 Unclassified 575
331 Ga0207654_11194517 3300025911 Bacteria 554
332 Ga0207671_10064579 3300025914 Unclassified 2722
333 Ga0207662_10084284 3300025918 Unclassified 1944
334 Ga0207662_10507274 3300025918 Bacteria 831
335 Ga0207657_10118499 3300025919 Unclassified 2179
336 Ga0207649_10006386 3300025920 Bacteria 6405
337 Ga0207649_10007488 3300025920 Bacteria 5936
338 Ga0207649_10411741 3300025920 Bacteria 1014
339 Ga0207681_10100713 3300025923 Bacteria 2083
340 Ga0207681_10104273 3300025923 Bacteria 2051
341 Ga0207681_10201694 3300025923 Bacteria 1528
342 Ga0207650_10063941 3300025925 Unclassified 2753
343 Ga0207650_10072638 3300025925 Unclassified 2589
344 Ga0207650_10154500 3300025925 Bacteria 1814
345 Ga0207650_10536143 3300025925 Bacteria 980
346 Ga0207650_10797227 3300025925 Bacteria 800
347 Ga0207650_11368680 3300025925 Bacteria 602
348 Ga0207659_10035139 3300025926 Bacteria 3462
349 Ga0207659_10549554 3300025926 Unclassified 981
350 Ga0207687_11538911 3300025927 Unclassified 571
351 Ga0207644_10249522 3300025931 Bacteria 1416
352 Ga0207644_10577839 3300025931 Bacteria 932
353 Ga0207644_11291189 3300025931 Bacteria 613
354 Ga0207644_11627172 3300025931 Unclassified 541
355 Ga0207690_10005341 3300025932 Bacteria 7570
356 Ga0207690_10520624 3300025932 Bacteria 964
357 Ga0207690_10752531 3300025932 Bacteria 803
358 Ga0207706_10002868 3300025933 Bacteria 16715
359 Ga0207706_10036875 3300025933 Unclassified 4343
360 Ga0207706_10091445 3300025933 Bacteria 2675
361 Ga0207706_10096534 3300025933 Bacteria 2599
362 Ga0207706_10581846 3300025933 Unclassified 962
363 Ga0207686_10001258 3300025934 Bacteria 14622
364 Ga0207686_10062147 3300025934 Bacteria 2371
365 Ga0207686_10278783 3300025934 Bacteria 1233
366 Ga0207686_10361970 3300025934 Bacteria 1095
367 Ga0207686_10961149 3300025934 Unclassified 692
368 Ga0207670_10009342 3300025936 Bacteria 5593
369 Ga0207670_10011312 3300025936 Bacteria 5174
370 Ga0207670_10065964 3300025936 Bacteria 2486
371 Ga0207704_10043380 3300025938 Bacteria 2656
372 Ga0207704_10117048 3300025938 Bacteria 1815
373 Ga0207704_10877480 3300025938 Bacteria 753
374 Ga0207691_10181387 3300025940 Bacteria 1840
375 Ga0207691_10452719 3300025940 Unclassified 1092
376 Ga0207711_10449574 3300025941 Bacteria 1199
377 Ga0207689_10003868 3300025942 Bacteria 13641
378 Ga0207689_10003973 3300025942 Bacteria 13451
379 Ga0207689_10008294 3300025942 Bacteria 9053
380 Ga0207689_10010812 3300025942 Bacteria 7853
381 Ga0207689_10011800 3300025942 Bacteria 7484
382 Ga0207689_10046363 3300025942 Unclassified 3592
383 Ga0207689_10101889 3300025942 Bacteria 2358
384 Ga0207689_10752393 3300025942 Bacteria 822
385 Ga0207661_10006808 3300025944 Bacteria 8097
386 Ga0207661_10055750 3300025944 Bacteria 3171
387 Ga0207661_10073725 3300025944 Bacteria 2797
388 Ga0207661_10402897 3300025944 Bacteria 1241
389 Ga0207679_10000462 3300025945 Bacteria 28637
390 Ga0207679_10062302 3300025945 Bacteria 2779
391 Ga0207679_10080970 3300025945 Bacteria 2481
392 Ga0207651_10266763 3300025960 Unclassified 1408
393 Ga0207651_10379534 3300025960 Bacteria 1197
394 Ga0207712_10003355 3300025961 Bacteria 10136
395 Ga0207712_10011640 3300025961 Bacteria 5607
396 Ga0207712_10035488 3300025961 Bacteria 3388
397 Ga0207712_10062015 3300025961 Bacteria 2656
398 Ga0207712_10209387 3300025961 Bacteria 1552
399 Ga0207712_10841062 3300025961 Unclassified 808
400 Ga0207668_10057691 3300025972 Bacteria 2710
401 Ga0207668_10060668 3300025972 Unclassified 2656
402 Ga0207668_10161217 3300025972 Bacteria 1748
403 Ga0207668_10196152 3300025972 Bacteria 1604
404 Ga0207668_10238335 3300025972 Bacteria 1470
405 Ga0207640_10145220 3300025981 Bacteria 1735
406 Ga0207640_10147640 3300025981 Bacteria 1723
407 Ga0207658_10006094 3300025986 Bacteria 8231
408 Ga0207658_10078216 3300025986 Unclassified 2527
409 Ga0207658_10086718 3300025986 Bacteria 2415
410 Ga0207658_10137668 3300025986 Bacteria 1971
411 Ga0207658_10165603 3300025986 Bacteria 1816
412 Ga0207658_10174104 3300025986 Bacteria 1776
413 Ga0207658_10223287 3300025986 Bacteria 1586
414 Ga0207658_10553992 3300025986 Bacteria 1029
415 Ga0207658_10886869 3300025986 Unclassified 812
416 Ga0207677_10007427 3300026023 Bacteria 6062
417 Ga0207677_10018057 3300026023 Bacteria 4225
418 Ga0207677_10072660 3300026023 Bacteria 2433
419 Ga0207677_10178002 3300026023 Bacteria 1670
420 Ga0207677_10468975 3300026023 Bacteria 1082
421 Ga0207677_10560678 3300026023 Bacteria 997
422 Ga0207703_10006328 3300026035 Bacteria 9465
423 Ga0207703_10045426 3300026035 Bacteria 3533
424 Ga0207703_10286529 3300026035 Bacteria 1498
425 Ga0207703_10399590 3300026035 Bacteria 1275
426 Ga0207703_10669211 3300026035 Unclassified 986
427 Ga0207639_10007429 3300026041 Bacteria 7472
428 Ga0207639_10029960 3300026041 Bacteria 3989
429 Ga0207639_10179459 3300026041 Bacteria 1800
430 Ga0207639_10284731 3300026041 Bacteria 1455
431 Ga0207678_10063001 3300026067 Bacteria 3187
432 Ga0207641_10000053 3300026088 Bacteria 173468
433 Ga0207641_10045842 3300026088 Bacteria 3684
434 Ga0207641_10106295 3300026088 Bacteria 2480
435 Ga0207648_10030420 3300026089 Bacteria 4782
436 Ga0207648_10037579 3300026089 Unclassified 4266
437 Ga0207648_10162272 3300026089 Bacteria 1974
438 Ga0207648_10476598 3300026089 Bacteria 1139
439 Ga0207648_10536468 3300026089 Bacteria 1073
440 Ga0207676_10004933 3300026095 Bacteria 9459
441 Ga0207676_10065846 3300026095 Bacteria 2887
442 Ga0207676_10067080 3300026095 Bacteria 2865
443 Ga0207676_10067423 3300026095 Unclassified 2858
444 Ga0207676_10116038 3300026095 Unclassified 2249
445 Ga0207676_10116393 3300026095 Bacteria 2246
446 Ga0207676_10339562 3300026095 Bacteria 1385
447 Ga0207676_10516088 3300026095 Unclassified 1137
448 Ga0207674_10003929 3300026116 Bacteria 18098
449 Ga0207674_10021448 3300026116 Bacteria 6954
450 Ga0207674_11113557 3300026116 Bacteria 759
451 Ga0207674_11282705 3300026116 Unclassified 702
452 Ga0207675_100023106 3300026118 Bacteria 5782
453 Ga0207675_100046189 3300026118 Bacteria 4068
454 Ga0207675_100202612 3300026118 Bacteria 1906
455 Ga0207675_100408749 3300026118 Bacteria 1339
456 Ga0207675_101670986 3300026118 Bacteria 657
457 Ga0207683_10002179 3300026121 Bacteria 17204
458 Ga0207683_10288745 3300026121 Bacteria 1500
459 Ga0207698_10016419 3300026142 Bacteria 4989
460 Ga0207698_10087760 3300026142 Unclassified 2534
461 Ga0207698_10143194 3300026142 Bacteria 2063
462 Ga0207698_10314495 3300026142 Unclassified 1464
463 Ga0207698_11359874 3300026142 Bacteria 725
464 Ga0268266_10105622 3300028379 Bacteria 2488
465 Ga0268266_10271499 3300028379 Bacteria 1574
466 Ga0268265_10082253 3300028380 Bacteria 2546
467 Ga0268265_10145120 3300028380 Bacteria 1993
468 Ga0268265_10633598 3300028380 Bacteria 1026
469 Ga0268265_11530407 3300028380 Bacteria 671
470 Ga0268264_10007006 3300028381 Bacteria 9459
471 Ga0268264_10030351 3300028381 Bacteria 4430
472 Ga0268264_10032991 3300028381 Bacteria 4250
473 Ga0268264_10167252 3300028381 Bacteria 1986
474 Ga0268264_10202966 3300028381 Bacteria 1815
475 Ga0268264_10487564 3300028381 Bacteria 1200
476 Ga0268264_10644951 3300028381 Bacteria 1047
477 Ga0265318_10014648 3300028577 Bacteria 3287
478 Ga0307515_10000251 3300028794 Bacteria 132970
479 Ga0265338_10246535 3300028800 Bacteria 1320
480 Ga0265338_10733230 3300028800 Bacteria 680
481 Ga0265316_10273025 3300031344 Unclassified 1237
482 Ga0307509_10271066 3300031507 Bacteria 1465
483 Ga0307509_10281223 3300031507 Bacteria 1425
484 Ga0307410_10010079 3300031852 Bacteria 5336
485 Ga0307414_10107984 3300032004 Unclassified 2110
486 Ga0307414_10597700 3300032004 Unclassified 989
487 Ga0373944_0023425 3300035089 Bacteria 1801
488 Ga0373944_0214523 3300035089 Bacteria 701
489 Ga0373946_0290898 3300035171 Bacteria 806
490 Ga0373947_0874022 3300035725 Bacteria 614
491 Ga0436365_1107423 3300039437 Bacteria 15965
492 Ga0436365_1435713 3300039437 Bacteria 3455
493 Ga0436365_1715184 3300039437 Bacteria 1561
494 Ga0451804_0271882 3300041463 Bacteria 1614
495 Ga0451807_0355965 3300041486 Bacteria 1202
496 Ga0439431_0043716 3300041997 Bacteria 1147
497 Ga0439441_121530 3300042001 Unclassified 599
498 Ga0439432_178436 3300042006 Bacteria 619
499 Ga0439434_0135944 3300042435 Unclassified 808
500 Ga0451577_0311453 3300042876 Bacteria 1427
501 Ga0451577_0637547 3300042876 Bacteria 966
502 Ga0451577_0924920 3300042876 Bacteria 785
503 Ga0451577_1279911 3300042876 Unclassified 653
504 Ga0453684_0141572 3300044712 Bacteria 2871
505 Ga0451576_2344092 3300045051 Unclassified 547
506 Ga0495650_0025891 3300046471 Bacteria 2739
507 Ga0495580_0497852 3300046472 Unclassified 814
508 Ga0495630_0020734 3300046517 Bacteria 4849
509 Ga0495621_0075356 3300046539 Bacteria 1250
510 Ga0495667_0368332 3300046559 Bacteria 907
511 Ga0495658_0570229 3300046683 Bacteria 725
512 Ga0495604_0319531 3300047317 Unclassified 1038
513 Ga0495676_0127134 3300047321 Bacteria 1846
514 Ga0495686_0012581 3300047472 Bacteria 5915
515 Ga0495686_0021279 3300047472 Bacteria 4310
516 Ga0496104_0713125 3300048907 Bacteria 911
517 Ga0496108_1158536 3300048911 Bacteria 655
518 Ga0496110_0058667 3300048913 Bacteria 3390
519 Ga0496111_0613501 3300048914 Bacteria 796
520 Ga0496112_0905371 3300048915 Bacteria 804
521 Ga0496116_0066318 3300048919 Bacteria 2311
522 Ga0501031_0014173 3300049568 Bacteria 5187
523 Ga0501031_0246180 3300049568 Unclassified 1162
524 Ga0501038_0113404 3300049574 Bacteria 2243
525 Ga0501039_0017977 3300049575 Bacteria 5422
526 Ga0501041_0386163 3300049577 Unclassified 886
527 Ga0501042_0753392 3300049578 Unclassified 708
528 Ga0501046_0059718 3300049580 Bacteria 2986
529 Ga0501048_0453741 3300049582 Unclassified 918
530 Ga0501075_0662800 3300049591 Unclassified 795
531 Ga0501076_0283682 3300049592 Unclassified 1357
532 Ga0501045_0112348 3300049824 Unclassified 2020
533 nmdc:mga0k408_42716_c1 3300050493 Bacteria 2611
534 nmdc:mga05p37_382697_c1 3300050507 Bacteria 1648
535 nmdc:mga09592_124537_c1 3300050508 Bacteria 2215
536 nmdc:mga09592_134435_c1 3300050508 Bacteria 2130
537 nmdc:mga0qj67_156296_c1 3300050509 Unclassified 1851
538 nmdc:mga06r32_1570238_c1 3300050510 Bacteria 597
539 nmdc:mga08y16_130270_c1 3300050511 Bacteria 2616
540 Ga0500641_0004879 3300053096 Bacteria 4747
541 Ga0500568_0000344 3300053139 Bacteria 36332
542 2889300322 2889295896 Bacteria 4704906
543 2981289310 2981284811 Bacteria 4641497
544 2981294089 2981289755 Bacteria 4641509
545 2981984913 2981980479 Bacteria 4641628
546 2981989843 2981985349 Bacteria 4641497
547 3006828244 3006826541 Bacteria 4678913
548 Ga0451576_0316830
549 Ga0055541_1003853
550 Ga0065714_10360318
551 Ga0065704_10219966
552 Ga0065707_10106781
553 Ga0070676_10153937
554 Ga0070676_10285916
555 Ga0070676_10508163
556 Ga0070683_100002704
557 Ga0070683_100054658
558 Ga0070683_100825574
559 Ga0070690_100110654
560 Ga0070690_100239582
561 Ga0070690_100360165
562 Ga0070670_100114521
563 Ga0070670_100352454
564 Ga0070670_101043677
565 Ga0070670_101623806
566 Ga0068869_100001801
567 Ga0068869_100002404
568 Ga0068869_100068090
569 Ga0068869_100263277
570 Ga0070666_10000343
571 Ga0070666_10003094
572 Ga0070666_10006710
573 Ga0070666_10379210
574 Ga0070680_100988829
575 Ga0070682_100000615
576 Ga0070682_101342104
577 Ga0068868_100001576
578 Ga0068868_100005037
579 Ga0068868_100024635
580 Ga0068868_100587584
581 Ga0068868_100625132
582 Ga0070660_100107151
583 Ga0070660_100119986
584 Ga0070689_100003592
585 Ga0070689_100036508
586 Ga0070689_100471574
587 Ga0070687_100079983
588 Ga0070687_100841515
589 Ga0070661_100002718
590 Ga0070661_100026468
591 Ga0070668_100031675
592 Ga0070668_100055577
593 Ga0070668_100161369
594 Ga0070668_100317249
595 Ga0070668_100621479
596 Ga0070669_100147252
597 Ga0070669_100425025
598 Ga0070675_100070658
599 Ga0070675_100075244
600 Ga0070675_100870053
601 Ga0070671_100037170
602 Ga0070671_100281158
603 Ga0070671_100311187
604 Ga0070671_100418731
605 Ga0070674_100027718
606 Ga0070674_100975152
607 Ga0070673_100057940
608 Ga0070673_100086406
609 Ga0070673_100151559
610 Ga0070673_100254950
611 Ga0070673_100584379
612 Ga0070673_100620617
613 Ga0070673_101563292
614 Ga0070688_100015034
615 Ga0070688_100046530
616 Ga0070688_100132505
617 Ga0070688_100201828
618 Ga0070688_100603560
619 Ga0070688_101193101
620 Ga0070659_100003017
621 Ga0070659_100137032
622 Ga0070667_100007191
623 Ga0070667_100040313
624 Ga0070667_100051508
625 Ga0070667_100294260
626 Ga0070667_101541984
627 Ga0070667_101918722
628 Ga0070663_100022580
629 Ga0070663_101558296
630 Ga0070678_100004882
631 Ga0070678_100344285
632 Ga0070662_100078148
633 Ga0070662_100149262
634 Ga0070662_100230070
635 Ga0070662_100258767
636 Ga0070662_100656594
637 Ga0068867_100091135
638 Ga0068867_100470614
639 Ga0068867_100709589
640 Ga0068867_101319684
641 Ga0070685_10001175
642 Ga0070685_10016240
643 Ga0070685_10019789
644 Ga0070685_10358343
645 Ga0070685_10450427
646 Ga0070707_100171349
647 Ga0070698_100001454
648 Ga0070698_100003684
649 Ga0070698_100113620
650 Ga0070684_100002308
651 Ga0070684_100004905
652 Ga0070684_100165894
653 Ga0070684_100885651
654 Ga0070697_100431290
655 Ga0068853_100000991
656 Ga0068853_100316403
657 Ga0068853_100826806
658 Ga0070672_100112933
659 Ga0070672_100217675
660 Ga0070672_100879537
661 Ga0070686_100127911
662 Ga0070665_100019061
663 Ga0070665_100302031
664 Ga0070664_100000487
665 Ga0070664_100157024
666 Ga0070664_100972817
667 Ga0068857_100010942
668 Ga0068857_100236492
669 Ga0068857_100796341
670 Ga0068857_101077833
671 Ga0068854_100068525
672 Ga0068854_100394632
673 Ga0070702_100205186
674 Ga0068852_100009551
675 Ga0068852_100055294
676 Ga0068852_100086994
677 Ga0068852_100157367
678 Ga0068852_101027477
679 Ga0068852_101145458
680 Ga0068852_101456981
681 Ga0068852_102260078
682 Ga0068859_100000066
683 Ga0068859_100022046
684 Ga0068859_100032137
685 Ga0068859_100072045
686 Ga0068859_100100712
687 Ga0068859_100161799
688 Ga0068864_100002791
689 Ga0068864_100253791
690 Ga0068864_100288108
691 Ga0068864_100460300
692 Ga0068864_101221820
693 Ga0068866_10017787
694 Ga0068861_100015024
695 Ga0068861_100016232
696 Ga0068861_100344137
697 Ga0068851_10055183
698 Ga0068851_10210439
699 Ga0068870_10017853
700 Ga0068870_10110746
701 Ga0068870_10234818
702 Ga0068863_100057852
703 Ga0068863_100100769
704 Ga0068863_100234925
705 Ga0068863_100286542
706 Ga0068863_100796365
707 Ga0068858_100037050
708 Ga0068858_100484420
709 Ga0068858_100618280
710 Ga0068860_100015000
711 Ga0068860_100019019
712 Ga0068860_100169266
713 Ga0068860_100305079
714 Ga0068860_100513965
715 Ga0068862_100211569
716 Ga0068862_101137631
717 Ga0075366_10038215
718 Ga0097621_100017525
719 Ga0097621_100052293
720 Ga0097621_100209943
721 Ga0097621_100212520
722 Ga0097621_101203605
723 Ga0068871_100017514
724 Ga0068871_100017709
725 Ga0068871_100026685
726 Ga0068871_100117951
727 Ga0068871_100137329
728 Ga0068871_100182471
729 Ga0068871_100827851
730 Ga0068871_102007550
731 Ga0075428_100099699
732 Ga0075430_100059443
733 Ga0075434_100265160
734 Ga0075429_100243064
735 Ga0075429_100311060
736 Ga0068865_100010135
737 Ga0068865_100051856
738 Ga0068865_100117981
739 Ga0097620_100000066
740 Ga0097620_100022046
741 Ga0097620_100032137
742 Ga0097620_100072045
743 Ga0097620_100100705
744 Ga0097620_100161798
745 Ga0097620_100886184
746 Ga0105251_10346200
747 Ga0105245_10717157
748 Ga0105245_11801249
749 Ga0105247_10006282
750 Ga0105247_10347342
751 Ga0105247_11598172
752 Ga0114129_10084135
753 Ga0105241_10014747
754 Ga0105241_10083612
755 Ga0105241_10267168
756 Ga0105241_10465928
757 Ga0105241_10520047
758 Ga0105242_10008426
759 Ga0105242_10037382
760 Ga0105242_10440225
761 Ga0105242_10904860
762 Ga0105242_12381085
763 Ga0105248_10194998
764 Ga0105248_10375350
765 Ga0105248_10430250
766 Ga0105248_10485574
767 Ga0105237_10006277
768 Ga0105249_10003442
769 Ga0105249_10006330
770 Ga0105249_10031421
771 Ga0105249_10135289
772 Ga0105249_10138206
773 Ga0105249_10145555
774 Ga0105249_10320668
775 Ga0105249_11193080
776 Ga0105239_12776571
777 Ga0105239_13542009
778 Ga0105246_10091410
779 Ga0105246_10147174
780 Ga0105246_10231951
781 Ga0105246_10473370
782 Ga0105246_10636928
783 Ga0105246_10649985
784 Ga0105246_10763083
785 Ga0105246_10861914
786 Ga0105246_11029890
787 Ga0157371_10059522
788 Ga0157371_10212920
789 Ga0157370_10927226
790 Ga0157370_11641877
791 Ga0157374_10000558
792 Ga0157374_10054271
793 Ga0157374_10139346
794 Ga0157374_10326098
795 Ga0157374_10355348
796 Ga0157374_11010098
797 Ga0157374_11014026
798 Ga0157374_11314338
799 Ga0157378_10010511
800 Ga0157378_10023722
801 Ga0157378_10030068
802 Ga0157378_10031145
803 Ga0157378_10092897
804 Ga0157378_10110736
805 Ga0157378_10371214
806 Ga0157378_10605059
807 Ga0157378_10978524
808 Ga0157378_11134846
809 Ga0163162_10001190
810 Ga0163162_10003657
811 Ga0163162_10132607
812 Ga0163162_10186380
813 Ga0163162_10883701
814 Ga0163162_11274608
815 Ga0163162_11613224
816 Ga0163162_12732609
817 Ga0157372_10067381
818 Ga0157372_10236397
819 Ga0157372_10252790
820 Ga0157372_10408227
821 Ga0157372_10965831
822 Ga0157375_10014469
823 Ga0157375_10017032
824 Ga0157375_10029728
825 Ga0157375_10031175
826 Ga0157375_10067754
827 Ga0157375_10148153
828 Ga0157375_10193384
829 Ga0157375_11627712
830 Ga0157375_11637993
831 Ga0157375_12453084
832 Ga0163163_10005738
833 Ga0163163_10055754
834 Ga0163163_10699868
835 Ga0163163_12291301
836 Ga0157380_10113126
837 Ga0157380_10125236
838 Ga0157380_12377885
839 Ga0157379_10034537
840 Ga0157379_10095850
841 Ga0157379_10171315
842 Ga0157379_10220132
843 Ga0157379_10240677
844 Ga0157379_10271488
845 Ga0157379_10354466
846 Ga0157379_10832464
847 Ga0157379_11096702
848 Ga0157379_11504656
849 Ga0157376_10002310
850 Ga0157376_10007675
851 Ga0157376_10065614
852 Ga0157376_10208878
853 Ga0157376_10240077
854 Ga0157376_10286674
855 Ga0157376_10741759
856 Ga0163161_10006779
857 Ga0163161_10010666
858 Ga0163161_11214102
859 Ga0213876_10015475
860 Ga0213876_10614735
861 Ga0209566_100159
862 Ga0207697_10017606
863 Ga0207697_10183914
864 Ga0207642_10387356
865 Ga0207710_10190784
866 Ga0207688_10014941
867 Ga0207680_10014569
868 Ga0207680_10032561
869 Ga0207680_10372561
870 Ga0207647_10008850
871 Ga0207685_10026004
872 Ga0207645_10001795
873 Ga0207645_10005868
874 Ga0207645_10275967
875 Ga0207643_10008037
876 Ga0207654_10377989
877 Ga0207654_11112451
878 Ga0207654_11194517
879 Ga0207671_10064579
880 Ga0207662_10084284
881 Ga0207662_10507274
882 Ga0207657_10118499
883 Ga0207649_10006386
884 Ga0207649_10007488
885 Ga0207649_10411741
886 Ga0207681_10100713
887 Ga0207681_10104273
888 Ga0207681_10201694
889 Ga0207650_10063941
890 Ga0207650_10072638
891 Ga0207650_10154500
892 Ga0207650_10536143
893 Ga0207650_10797227
894 Ga0207650_11368680
895 Ga0207659_10035139
896 Ga0207659_10549554
897 Ga0207687_11538911
898 Ga0207644_10249522
899 Ga0207644_10577839
900 Ga0207644_11291189
901 Ga0207644_11627172
902 Ga0207690_10005341
903 Ga0207690_10520624
904 Ga0207690_10752531
905 Ga0207706_10002868
906 Ga0207706_10036875
907 Ga0207706_10091445
908 Ga0207706_10096534
909 Ga0207706_10581846
910 Ga0207686_10001258
911 Ga0207686_10062147
912 Ga0207686_10278783
913 Ga0207686_10361970
914 Ga0207686_10961149
915 Ga0207670_10009342
916 Ga0207670_10011312
917 Ga0207670_10065964
918 Ga0207704_10043380
919 Ga0207704_10117048
920 Ga0207704_10877480
921 Ga0207691_10181387
922 Ga0207691_10452719
923 Ga0207711_10449574
924 Ga0207689_10003868
925 Ga0207689_10003973
926 Ga0207689_10008294
927 Ga0207689_10010812
928 Ga0207689_10011800
929 Ga0207689_10046363
930 Ga0207689_10101889
931 Ga0207689_10752393
932 Ga0207661_10006808
933 Ga0207661_10055750
934 Ga0207661_10073725
935 Ga0207661_10402897
936 Ga0207679_10000462
937 Ga0207679_10062302
938 Ga0207679_10080970
939 Ga0207651_10266763
940 Ga0207651_10379534
941 Ga0207712_10003355
942 Ga0207712_10011640
943 Ga0207712_10035488
944 Ga0207712_10062015
945 Ga0207712_10209387
946 Ga0207712_10841062
947 Ga0207668_10057691
948 Ga0207668_10060668
949 Ga0207668_10161217
950 Ga0207668_10196152
951 Ga0207668_10238335
952 Ga0207640_10145220
953 Ga0207640_10147640
954 Ga0207658_10006094
955 Ga0207658_10078216
956 Ga0207658_10086718
957 Ga0207658_10137668
958 Ga0207658_10165603
959 Ga0207658_10174104
960 Ga0207658_10223287
961 Ga0207658_10553992
962 Ga0207658_10886869
963 Ga0207677_10007427
964 Ga0207677_10018057
965 Ga0207677_10072660
966 Ga0207677_10178002
967 Ga0207677_10468975
968 Ga0207677_10560678
969 Ga0207703_10006328
970 Ga0207703_10045426
971 Ga0207703_10286529
972 Ga0207703_10399590
973 Ga0207703_10669211
974 Ga0207639_10007429
975 Ga0207639_10029960
976 Ga0207639_10179459
977 Ga0207639_10284731
978 Ga0207678_10063001
979 Ga0207641_10000053
980 Ga0207641_10045842
981 Ga0207641_10106295
982 Ga0207648_10030420
983 Ga0207648_10037579
984 Ga0207648_10162272
985 Ga0207648_10476598
986 Ga0207648_10536468
987 Ga0207676_10004933
988 Ga0207676_10065846
989 Ga0207676_10067080
990 Ga0207676_10067423
991 Ga0207676_10116038
992 Ga0207676_10116393
993 Ga0207676_10339562
994 Ga0207676_10516088
995 Ga0207674_10003929
996 Ga0207674_10021448
997 Ga0207674_11113557
998 Ga0207674_11282705
999 Ga0207675_100023106
1000 Ga0207675_100046189
1001 Ga0207675_100202612
1002 Ga0207675_100408749
1003 Ga0207675_101670986
1004 Ga0207683_10002179
1005 Ga0207683_10288745
1006 Ga0207698_10016419
1007 Ga0207698_10087760
1008 Ga0207698_10143194
1009 Ga0207698_10314495
1010 Ga0207698_11359874
1011 Ga0268266_10105622
1012 Ga0268266_10271499
1013 Ga0268265_10082253
1014 Ga0268265_10145120
1015 Ga0268265_10633598
1016 Ga0268265_11530407
1017 Ga0268264_10007006
1018 Ga0268264_10030351
1019 Ga0268264_10032991
1020 Ga0268264_10167252
1021 Ga0268264_10202966
1022 Ga0268264_10487564
1023 Ga0268264_10644951
1024 Ga0265318_10014648
1025 Ga0307515_10000251
1026 Ga0265338_10246535
1027 Ga0265338_10733230
1028 Ga0265316_10273025
1029 Ga0307509_10271066
1030 Ga0307509_10281223
1031 Ga0307410_10010079
1032 Ga0307414_10107984
1033 Ga0307414_10597700
1034 Ga0373944_0023425
1035 Ga0373944_0214523
1036 Ga0373946_0290898
1037 Ga0373947_0874022
1038 Ga0436365_1107423
1039 Ga0436365_1435713
1040 Ga0436365_1715184
1041 Ga0451804_0271882
1042 Ga0451807_0355965
1043 Ga0439431_0043716
1044 Ga0439441_121530
1045 Ga0439432_178436
1046 Ga0439434_0135944
1047 Ga0451577_0311453
1048 Ga0451577_0637547
1049 Ga0451577_0924920
1050 Ga0451577_1279911
1051 Ga0453684_0141572
1052 Ga0451576_2344092
1053 Ga0495650_0025891
1054 Ga0495580_0497852
1055 Ga0495630_0020734
1056 Ga0495621_0075356
1057 Ga0495667_0368332
1058 Ga0495658_0570229
1059 Ga0495604_0319531
1060 Ga0495676_0127134
1061 Ga0495686_0012581
1062 Ga0495686_0021279
1063 Ga0496104_0713125
1064 Ga0496108_1158536
1065 Ga0496110_0058667
1066 Ga0496111_0613501
1067 Ga0496112_0905371
1068 Ga0496116_0066318
1069 Ga0501031_0014173
1070 Ga0501031_0246180
1071 Ga0501038_0113404
1072 Ga0501039_0017977
1073 Ga0501041_0386163
1074 Ga0501042_0753392
1075 Ga0501046_0059718
1076 Ga0501048_0453741
1077 Ga0501075_0662800
1078 Ga0501076_0283682
1079 Ga0501045_0112348
1080 nmdc:mga0k408_42716_c1
1081 nmdc:mga05p37_382697_c1
1082 nmdc:mga09592_124537_c1
1083 nmdc:mga09592_134435_c1
1084 nmdc:mga0qj67_156296_c1
1085 nmdc:mga06r32_1570238_c1
1086 nmdc:mga08y16_130270_c1
1087 Ga0500641_0004879
1088 Ga0500568_0000344
1089 2889300322
1090 2981289310
1091 2981294089
1092 2981984913
1093 2981989843
1094 3006828244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20136

DUF6526

Family of unknown function (DUF6526)

24

165

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkm-assembly1.cif.gz_G-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7598 66 129
6kkm-assembly1.cif.gz_H-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7298 66 129
6kkm-assembly1.cif.gz_F-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7233 66 129
6kkm-assembly1.cif.gz_E-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.72 66 129
6kkn-assembly1.cif.gz_A-2 crystal structure of rubisco accumulation factor raf1 from anabaena sp. pcc 7120 0.7116 66 129
ID Description Score Start End Superfamily
2qz4A02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.4573 71 120 1.10.8.60
af_Q5A0W7_370_458_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.4508 71 121 1.10.8.60
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4482 20 127 1.10.10.2830
3uk6I02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.4218 71 129 1.10.8.60
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.4056 20 127 1.10.10.2830
ID Description Score Start End GO Terms
AF-A0A1S2RCK0-F1-model_v4 ABC transporter permease 0.9703 2 141 GO:0016020
AF-A0A1S2RCK0-F1-model_v4 ABC transporter permease 0.9635 2 141 GO:0016020
AF-A0A519ZA03-F1-model_v4 Uncharacterized protein 0.9628 2 141 GO:0016020
AF-A0A1R1A7M4-F1-model_v4 ABC transporter permease 0.9608 1 141 GO:0016020
AF-A0A537KB90-F1-model_v4 Uncharacterized protein 0.9592 2 141 GO:0016020

Map