F462110

General Info

Members Datasets Scaffolds Average Seq Length
547 238 1094 148

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10016795|Ga0163163_100167952
Length 181
Sequence MAGMPKMQEQFSAMAGYSKLSVPRQDRLDASEANVEITFTKGSGKYDRMRVVRAGAVEEIDCPKQRIIPHDMVHYAVEYTLQKRGFLGRVRDGESANFQMHPEPLSDGVERLVEVFQGDAWSGGNATPEDMLDLYRVTCAARKCPMLPITPEDIVLVRSKIMELDSQWQSLAIGDSISLSL

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
238 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.28
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 4.02
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 9.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10016795 3300014325 Bacteria 6813
2 JGI24741J21665_1001048 3300001915 Bacteria 8290
3 JGI24740J21852_10002069 3300001979 Bacteria 9169
4 JGI24740J21852_10005078 3300001979 Bacteria 5588
5 JGI24740J21852_10012345 3300001979 Bacteria 3222
6 JGI24740J21852_10021387 3300001979 Bacteria 2243
7 JGI24739J22299_10002462 3300001989 Bacteria 7141
8 JGI24737J22298_10000821 3300001990 Bacteria 11047
9 JGI24737J22298_10033948 3300001990 Bacteria 1583
10 JGI24735J21928_10007641 3300002067 Bacteria 3523
11 JGI24738J21930_10001458 3300002075 Bacteria 6573
12 rootL2_10173465 3300003322 Unclassified 1446
13 Ga0065712_10327745 3300005290 Bacteria 818
14 Ga0070658_10053956 3300005327 Bacteria 3263
15 Ga0070658_10064067 3300005327 Bacteria 2998
16 Ga0070658_10236251 3300005327 Bacteria 1548
17 Ga0070658_10515811 3300005327 Unclassified 1033
18 Ga0070676_10052834 3300005328 Bacteria 2391
19 Ga0070676_10064783 3300005328 Bacteria 2180
20 Ga0070676_10087522 3300005328 Bacteria 1902
21 Ga0070676_10144351 3300005328 Bacteria 1518
22 Ga0070676_10936938 3300005328 Bacteria 647
23 Ga0070683_100039423 3300005329 Bacteria 4337
24 Ga0070683_100883007 3300005329 Bacteria 857
25 Ga0070690_100012126 3300005330 Bacteria 5066
26 Ga0070690_100227705 3300005330 Bacteria 1309
27 Ga0070670_100043376 3300005331 Bacteria 3866
28 Ga0070670_100068679 3300005331 Bacteria 3042
29 Ga0070670_100104511 3300005331 Bacteria 2440
30 Ga0070670_100807251 3300005331 Bacteria 847
31 Ga0070677_10105068 3300005333 Bacteria 1252
32 Ga0070677_10170165 3300005333 Bacteria 1029
33 Ga0068869_100037770 3300005334 Bacteria 3435
34 Ga0068869_100238258 3300005334 Bacteria 1449
35 Ga0068869_100251127 3300005334 Bacteria 1412
36 Ga0070666_10547997 3300005335 Bacteria 841
37 Ga0070666_10701964 3300005335 Unclassified 742
38 Ga0070666_11112729 3300005335 Bacteria 587
39 Ga0070680_100093489 3300005336 Bacteria 2491
40 Ga0070680_100306634 3300005336 Bacteria 1346
41 Ga0070680_101311480 3300005336 Bacteria 626
42 Ga0070682_100040576 3300005337 Bacteria 2864
43 Ga0068868_100001904 3300005338 Bacteria 14330
44 Ga0068868_100173978 3300005338 Bacteria 1783
45 Ga0068868_100580776 3300005338 Unclassified 991
46 Ga0068868_102073064 3300005338 Bacteria 541
47 Ga0070660_100000118 3300005339 Bacteria 49576
48 Ga0070660_100014905 3300005339 Bacteria 5610
49 Ga0070660_100262778 3300005339 Bacteria 1410
50 Ga0070660_100280674 3300005339 Bacteria 1363
51 Ga0070660_100382807 3300005339 Bacteria 1161
52 Ga0070689_100042808 3300005340 Bacteria 3478
53 Ga0070689_101436128 3300005340 Bacteria 624
54 Ga0070691_10000023 3300005341 Bacteria 43309
55 Ga0070691_10092052 3300005341 Bacteria 1496
56 Ga0070691_10140700 3300005341 Bacteria 1229
57 Ga0070691_10154641 3300005341 Bacteria 1178
58 Ga0070661_100108493 3300005344 Bacteria 2071
59 Ga0070661_100364245 3300005344 Bacteria 1137
60 Ga0070661_100611176 3300005344 Bacteria 882
61 Ga0070692_10000318 3300005345 Bacteria 13838
62 Ga0070692_10020391 3300005345 Bacteria 3214
63 Ga0070692_10234833 3300005345 Bacteria 1090
64 Ga0070692_10316793 3300005345 Unclassified 958
65 Ga0070668_100001033 3300005347 Bacteria 19546
66 Ga0070668_100004982 3300005347 Bacteria 9834
67 Ga0070668_100069233 3300005347 Bacteria 2745
68 Ga0070668_101579075 3300005347 Bacteria 601
69 Ga0070669_100001401 3300005353 Bacteria 17397
70 Ga0070669_100038557 3300005353 Bacteria 3469
71 Ga0070669_100201140 3300005353 Bacteria 1567
72 Ga0070669_100210669 3300005353 Bacteria 1533
73 Ga0070669_100544548 3300005353 Unclassified 967
74 Ga0070669_100545892 3300005353 Bacteria 966
75 Ga0070675_100012535 3300005354 Bacteria 6646
76 Ga0070671_100011341 3300005355 Bacteria 7163
77 Ga0070671_100039184 3300005355 Bacteria 3933
78 Ga0070671_100628628 3300005355 Bacteria 929
79 Ga0070674_100003561 3300005356 Bacteria 8751
80 Ga0070674_100078005 3300005356 Bacteria 2360
81 Ga0070673_100001138 3300005364 Bacteria 15291
82 Ga0070673_100104640 3300005364 Bacteria 2337
83 Ga0070673_100393530 3300005364 Bacteria 1238
84 Ga0070673_100745857 3300005364 Bacteria 901
85 Ga0070673_101202239 3300005364 Bacteria 710
86 Ga0070659_100007254 3300005366 Bacteria 8045
87 Ga0070659_100044177 3300005366 Bacteria 3487
88 Ga0070659_100443980 3300005366 Unclassified 1100
89 Ga0070667_100005201 3300005367 Bacteria 10876
90 Ga0070667_100043557 3300005367 Bacteria 3767
91 Ga0070667_100371001 3300005367 Bacteria 1298
92 Ga0070667_100538864 3300005367 Bacteria 1072
93 Ga0070700_100040812 3300005441 Bacteria 2843
94 Ga0070700_100778255 3300005441 Bacteria 768
95 Ga0070663_100127601 3300005455 Bacteria 1928
96 Ga0070663_100183658 3300005455 Bacteria 1624
97 Ga0070663_100230786 3300005455 Bacteria 1457
98 Ga0070663_101317110 3300005455 Bacteria 638
99 Ga0070678_100101195 3300005456 Bacteria 2233
100 Ga0070678_100118382 3300005456 Bacteria 2084
101 Ga0070662_100000441 3300005457 Bacteria 24553
102 Ga0070662_100327973 3300005457 Bacteria 1250
103 Ga0070662_101047972 3300005457 Bacteria 699
104 Ga0070681_10691195 3300005458 Bacteria 936
105 Ga0068867_100089543 3300005459 Bacteria 2334
106 Ga0068867_100111192 3300005459 Bacteria 2105
107 Ga0068867_100239514 3300005459 Bacteria 1471
108 Ga0070685_10061667 3300005466 Bacteria 2197
109 Ga0070679_100325955 3300005530 Bacteria 1485
110 Ga0070679_101165598 3300005530 Bacteria 716
111 Ga0070684_100202891 3300005535 Bacteria 1806
112 Ga0068853_100002367 3300005539 Bacteria 14098
113 Ga0068853_100116810 3300005539 Bacteria 2376
114 Ga0068853_100902816 3300005539 Bacteria 848
115 Ga0070672_100000140 3300005543 Bacteria 38747
116 Ga0070672_100074222 3300005543 Bacteria 2713
117 Ga0070672_100964656 3300005543 Bacteria 755
118 Ga0070696_100010618 3300005546 Bacteria 6168
119 Ga0070696_100764493 3300005546 Bacteria 793
120 Ga0070693_100089378 3300005547 Bacteria 1854
121 Ga0070693_100340489 3300005547 Bacteria 1023
122 Ga0070665_100005596 3300005548 Bacteria 12918
123 Ga0070665_100080514 3300005548 Bacteria 3262
124 Ga0070665_100097546 3300005548 Bacteria 2944
125 Ga0070665_100144496 3300005548 Bacteria 2382
126 Ga0070665_101170933 3300005548 Bacteria 780
127 Ga0070704_100740973 3300005549 Unclassified 874
128 Ga0068855_100006734 3300005563 Bacteria 13940
129 Ga0068855_100008925 3300005563 Bacteria 12117
130 Ga0070664_100037506 3300005564 Bacteria 4076
131 Ga0070664_100109920 3300005564 Bacteria 2405
132 Ga0070664_100703227 3300005564 Bacteria 942
133 Ga0070664_101046009 3300005564 Bacteria 768
134 Ga0068857_100000090 3300005577 Bacteria 52424
135 Ga0068857_100062838 3300005577 Bacteria 3301
136 Ga0068857_100327654 3300005577 Bacteria 1415
137 Ga0068854_100003349 3300005578 Bacteria 9988
138 Ga0068854_100742418 3300005578 Unclassified 851
139 Ga0068856_100360829 3300005614 Bacteria 1472
140 Ga0068856_100469215 3300005614 Unclassified 1279
141 Ga0068852_100080917 3300005616 Bacteria 2882
142 Ga0068852_101761487 3300005616 Unclassified 642
143 Ga0068859_100001249 3300005617 Bacteria 25972
144 Ga0068859_100234512 3300005617 Bacteria 1923
145 Ga0068859_101344754 3300005617 Bacteria 787
146 Ga0068864_100000842 3300005618 Bacteria 25877
147 Ga0068864_100416235 3300005618 Bacteria 1280
148 Ga0068864_100639686 3300005618 Unclassified 1035
149 Ga0068866_10101840 3300005718 Bacteria 1586
150 Ga0068861_100068736 3300005719 Bacteria 2738
151 Ga0068861_100335646 3300005719 Bacteria 1321
152 Ga0068861_100875021 3300005719 Bacteria 849
153 Ga0068851_10029461 3300005834 Bacteria 2718
154 Ga0068851_10032823 3300005834 Bacteria 2584
155 Ga0068870_10400368 3300005840 Bacteria 893
156 Ga0068870_10813594 3300005840 Bacteria 654
157 Ga0068863_100001768 3300005841 Bacteria 21423
158 Ga0068863_100023998 3300005841 Bacteria 5821
159 Ga0068863_100085543 3300005841 Bacteria 2988
160 Ga0068863_100378927 3300005841 Unclassified 1381
161 Ga0068863_100679335 3300005841 Bacteria 1022
162 Ga0068858_100003441 3300005842 Bacteria 15717
163 Ga0068860_100005039 3300005843 Bacteria 13445
164 Ga0068860_100019638 3300005843 Bacteria 6553
165 Ga0068860_100025832 3300005843 Bacteria 5665
166 Ga0068860_100289744 3300005843 Bacteria 1602
167 Ga0068862_100052615 3300005844 Bacteria 3484
168 Ga0068862_100324839 3300005844 Bacteria 1421
169 Ga0068862_101011763 3300005844 Bacteria 822
170 Ga0075366_11031379 3300006195 Bacteria 513
171 Ga0097621_100068494 3300006237 Bacteria 2928
172 Ga0097621_100266727 3300006237 Bacteria 1503
173 Ga0068871_100093089 3300006358 Bacteria 2514
174 Ga0068871_100487831 3300006358 Bacteria 1109
175 Ga0068865_100000519 3300006881 Bacteria 21564
176 Ga0068865_100063002 3300006881 Unclassified 2605
177 Ga0068865_100293472 3300006881 Bacteria 1299
178 Ga0068865_100482259 3300006881 Bacteria 1031
179 Ga0097620_100001249 3300006931 Bacteria 25972
180 Ga0097620_100234525 3300006931 Bacteria 1923
181 Ga0097620_101344740 3300006931 Bacteria 787
182 Ga0075435_100128428 3300007076 Bacteria 2120
183 Ga0105240_10035951 3300009093 Bacteria 6377
184 Ga0105240_11112970 3300009093 Bacteria 840
185 Ga0111539_10333404 3300009094 Unclassified 1766
186 Ga0105245_10000958 3300009098 Bacteria 26239
187 Ga0105245_10268402 3300009098 Bacteria 1663
188 Ga0105245_10302297 3300009098 Bacteria 1570
189 Ga0105245_10484578 3300009098 Unclassified 1251
190 Ga0105243_10269904 3300009148 Bacteria 1527
191 Ga0105241_10390017 3300009174 Bacteria 1219
192 Ga0105241_10893560 3300009174 Unclassified 824
193 Ga0105248_10001159 3300009177 Bacteria 29428
194 Ga0105248_10003559 3300009177 Bacteria 17262
195 Ga0105248_10007594 3300009177 Bacteria 11910
196 Ga0105248_10058882 3300009177 Bacteria 4314
197 Ga0105248_10970737 3300009177 Bacteria 960
198 Ga0105237_10313875 3300009545 Bacteria 1571
199 Ga0105237_10906475 3300009545 Bacteria 888
200 Ga0105238_10027548 3300009551 Bacteria 5792
201 Ga0105238_10109904 3300009551 Bacteria 2738
202 Ga0105238_10283952 3300009551 Bacteria 1637
203 Ga0105238_10528666 3300009551 Bacteria 1182
204 Ga0105249_10044832 3300009553 Bacteria 4021
205 Ga0105239_10013044 3300010375 Bacteria 9236
206 Ga0105239_10068307 3300010375 Bacteria 3906
207 Ga0105239_10083274 3300010375 Bacteria 3522
208 Ga0105239_10130657 3300010375 Bacteria 2793
209 Ga0105239_12233185 3300010375 Bacteria 636
210 Ga0105246_10008877 3300011119 Bacteria 6186
211 Ga0105246_10033746 3300011119 Bacteria 3404
212 Ga0105246_10034328 3300011119 Bacteria 3379
213 Ga0105246_11226580 3300011119 Unclassified 691
214 Ga0157373_10028521 3300013100 Bacteria 4027
215 Ga0157373_10242026 3300013100 Unclassified 1275
216 Ga0157373_10339218 3300013100 Bacteria 1071
217 Ga0157371_10002258 3300013102 Bacteria 18601
218 Ga0157371_10122305 3300013102 Bacteria 1851
219 Ga0157370_10024835 3300013104 Bacteria 5934
220 Ga0157370_10045567 3300013104 Bacteria 4207
221 Ga0157370_10058130 3300013104 Bacteria 3675
222 Ga0157370_10089014 3300013104 Unclassified 2900
223 Ga0157369_10012729 3300013105 Bacteria 9539
224 Ga0157369_10133121 3300013105 Bacteria 2634
225 Ga0157369_10458793 3300013105 Unclassified 1319
226 Ga0157374_10282177 3300013296 Bacteria 1640
227 Ga0157378_10076816 3300013297 Bacteria 3010
228 Ga0163162_10019532 3300013306 Bacteria 6651
229 Ga0163162_10058463 3300013306 Unclassified 3885
230 Ga0163162_10206304 3300013306 Bacteria 2095
231 Ga0163162_10407495 3300013306 Unclassified 1492
232 Ga0157372_10026660 3300013307 Bacteria 6289
233 Ga0157372_10095966 3300013307 Bacteria 3379
234 Ga0157372_10950755 3300013307 Bacteria 996
235 Ga0157375_10015356 3300013308 Bacteria 6852
236 Ga0157375_10057956 3300013308 Bacteria 3830
237 Ga0157375_10551268 3300013308 Bacteria 1314
238 Ga0163163_10046161 3300014325 Bacteria 4278
239 Ga0163163_10079887 3300014325 Bacteria 3269
240 Ga0157380_10064029 3300014326 Bacteria 2950
241 Ga0157380_10080197 3300014326 Unclassified 2668
242 Ga0157377_10020259 3300014745 Bacteria 3482
243 Ga0157379_10033378 3300014968 Bacteria 4590
244 Ga0157379_10472817 3300014968 Bacteria 1159
245 Ga0157376_11361570 3300014969 Unclassified 741
246 Ga0206356_10490854 3300020070 Bacteria 7785
247 Ga0206352_11323856 3300020078 Bacteria 2012
248 Ga0206350_11208628 3300020080 Bacteria 1885
249 Ga0206354_11275857 3300020081 Bacteria 1862
250 Ga0206353_11130673 3300020082 Bacteria 1902
251 Ga0154015_1065785 3300020610 Bacteria 6632
252 Ga0213876_10001651 3300021384 Bacteria 13606
253 Ga0224712_10215850 3300022467 Bacteria 876
254 Ga0207673_1047737 3300025290 Bacteria 605
255 Ga0207697_10000261 3300025315 Bacteria 29019
256 Ga0207697_10085178 3300025315 Bacteria 1335
257 Ga0207656_10015391 3300025321 Bacteria 2960
258 Ga0207656_10036495 3300025321 Bacteria 2064
259 Ga0207656_10065264 3300025321 Bacteria 1606
260 Ga0207656_10205297 3300025321 Bacteria 953
261 Ga0207682_10232433 3300025893 Bacteria 855
262 Ga0207688_10000960 3300025901 Bacteria 14662
263 Ga0207688_10055447 3300025901 Bacteria 2224
264 Ga0207680_10131412 3300025903 Bacteria 1650
265 Ga0207680_10654207 3300025903 Bacteria 752
266 Ga0207647_10003579 3300025904 Bacteria 11646
267 Ga0207647_10004221 3300025904 Bacteria 10652
268 Ga0207647_10010636 3300025904 Bacteria 6487
269 Ga0207647_10145294 3300025904 Bacteria 1388
270 Ga0207645_10003103 3300025907 Bacteria 12739
271 Ga0207645_10020570 3300025907 Bacteria 4318
272 Ga0207645_10048325 3300025907 Bacteria 2717
273 Ga0207645_10144678 3300025907 Bacteria 1550
274 Ga0207645_10342934 3300025907 Bacteria 999
275 Ga0207643_10017431 3300025908 Bacteria 3927
276 Ga0207643_10092386 3300025908 Bacteria 1766
277 Ga0207643_10418085 3300025908 Unclassified 850
278 Ga0207705_10038191 3300025909 Bacteria 3437
279 Ga0207705_10053239 3300025909 Bacteria 2915
280 Ga0207705_10057125 3300025909 Bacteria 2815
281 Ga0207707_10000073 3300025912 Bacteria 102375
282 Ga0207707_10217767 3300025912 Bacteria 1662
283 Ga0207707_10688393 3300025912 Unclassified 859
284 Ga0207695_10160662 3300025913 Bacteria 2179
285 Ga0207695_10194173 3300025913 Bacteria 1947
286 Ga0207671_10267701 3300025914 Bacteria 1346
287 Ga0207671_10298016 3300025914 Bacteria 1274
288 Ga0207671_10524721 3300025914 Bacteria 944
289 Ga0207660_10117096 3300025917 Bacteria 2013
290 Ga0207660_10155150 3300025917 Bacteria 1762
291 Ga0207662_10047693 3300025918 Bacteria 2537
292 Ga0207657_10008435 3300025919 Bacteria 10457
293 Ga0207657_10023549 3300025919 Bacteria 5731
294 Ga0207657_10024434 3300025919 Bacteria 5593
295 Ga0207657_10197863 3300025919 Bacteria 1618
296 Ga0207657_10213566 3300025919 Bacteria 1548
297 Ga0207657_10720852 3300025919 Unclassified 774
298 Ga0207657_11314200 3300025919 Bacteria 546
299 Ga0207649_10035426 3300025920 Bacteria 2999
300 Ga0207649_10214857 3300025920 Bacteria 1366
301 Ga0207652_10076572 3300025921 Bacteria 2918
302 Ga0207652_10598891 3300025921 Bacteria 988
303 Ga0207681_10016320 3300025923 Bacteria 4644
304 Ga0207681_10072149 3300025923 Bacteria 2410
305 Ga0207681_10106994 3300025923 Bacteria 2028
306 Ga0207694_10613788 3300025924 Unclassified 915
307 Ga0207650_10027925 3300025925 Bacteria 4042
308 Ga0207650_10106781 3300025925 Bacteria 2162
309 Ga0207650_10229947 3300025925 Bacteria 1495
310 Ga0207650_10261052 3300025925 Bacteria 1405
311 Ga0207659_10085258 3300025926 Bacteria 2346
312 Ga0207687_10916789 3300025927 Bacteria 750
313 Ga0207644_10008141 3300025931 Bacteria 6868
314 Ga0207644_10025496 3300025931 Bacteria 4066
315 Ga0207644_10278130 3300025931 Bacteria 1343
316 Ga0207690_10000435 3300025932 Bacteria 27234
317 Ga0207690_10002961 3300025932 Bacteria 10226
318 Ga0207690_10107352 3300025932 Bacteria 2005
319 Ga0207706_10002190 3300025933 Bacteria 19037
320 Ga0207706_10052184 3300025933 Bacteria 3611
321 Ga0207706_10346093 3300025933 Bacteria 1293
322 Ga0207706_10579244 3300025933 Bacteria 965
323 Ga0207709_10142261 3300025935 Bacteria 1650
324 Ga0207709_10174644 3300025935 Bacteria 1511
325 Ga0207670_10068770 3300025936 Bacteria 2441
326 Ga0207670_10830718 3300025936 Bacteria 771
327 Ga0207669_10024865 3300025937 Bacteria 3226
328 Ga0207669_10028144 3300025937 Bacteria 3088
329 Ga0207704_10133863 3300025938 Bacteria 1722
330 Ga0207704_10154283 3300025938 Bacteria 1625
331 Ga0207704_10356034 3300025938 Bacteria 1141
332 Ga0207704_10403512 3300025938 Bacteria 1079
333 Ga0207691_10001863 3300025940 Bacteria 20621
334 Ga0207691_10009856 3300025940 Bacteria 9168
335 Ga0207691_10064569 3300025940 Bacteria 3316
336 Ga0207691_10071686 3300025940 Bacteria 3126
337 Ga0207711_10005496 3300025941 Bacteria 10712
338 Ga0207711_10006794 3300025941 Bacteria 9613
339 Ga0207711_10010781 3300025941 Bacteria 7597
340 Ga0207711_10174475 3300025941 Bacteria 1952
341 Ga0207711_10220633 3300025941 Unclassified 1734
342 Ga0207689_10000341 3300025942 Bacteria 43585
343 Ga0207689_10038398 3300025942 Bacteria 3966
344 Ga0207689_10094379 3300025942 Bacteria 2457
345 Ga0207661_10019609 3300025944 Bacteria 5045
346 Ga0207661_10052818 3300025944 Bacteria 3249
347 Ga0207661_10244451 3300025944 Bacteria 1593
348 Ga0207679_10004345 3300025945 Bacteria 8818
349 Ga0207679_11346808 3300025945 Bacteria 655
350 Ga0207667_10021644 3300025949 Bacteria 7123
351 Ga0207667_10024671 3300025949 Bacteria 6596
352 Ga0207667_10677072 3300025949 Bacteria 1035
353 Ga0207651_10009435 3300025960 Bacteria 5344
354 Ga0207651_10561796 3300025960 Bacteria 993
355 Ga0207712_10039041 3300025961 Bacteria 3250
356 Ga0207668_10000239 3300025972 Bacteria 36850
357 Ga0207668_10130818 3300025972 Bacteria 1916
358 Ga0207640_10008985 3300025981 Bacteria 5570
359 Ga0207640_10052953 3300025981 Bacteria 2646
360 Ga0207640_10242999 3300025981 Bacteria 1392
361 Ga0207640_10348733 3300025981 Bacteria 1189
362 Ga0207658_10027136 3300025986 Bacteria 4021
363 Ga0207658_10046312 3300025986 Bacteria 3175
364 Ga0207658_10083275 3300025986 Bacteria 2458
365 Ga0207658_10204171 3300025986 Bacteria 1652
366 Ga0207658_10276288 3300025986 Bacteria 1438
367 Ga0207658_10368308 3300025986 Bacteria 1255
368 Ga0207677_10047612 3300026023 Bacteria 2880
369 Ga0207677_10810509 3300026023 Unclassified 839
370 Ga0207677_11696482 3300026023 Bacteria 586
371 Ga0207703_10003682 3300026035 Bacteria 12771
372 Ga0207703_10169996 3300026035 Bacteria 1916
373 Ga0207703_11434761 3300026035 Unclassified 664
374 Ga0207639_10001803 3300026041 Bacteria 14408
375 Ga0207639_10054967 3300026041 Bacteria 3045
376 Ga0207639_10104800 3300026041 Bacteria 2293
377 Ga0207639_10134198 3300026041 Bacteria 2053
378 Ga0207639_10655772 3300026041 Bacteria 971
379 Ga0207639_11232105 3300026041 Unclassified 702
380 Ga0207678_10221930 3300026067 Bacteria 1618
381 Ga0207678_10229737 3300026067 Bacteria 1588
382 Ga0207678_10307501 3300026067 Bacteria 1363
383 Ga0207678_10367673 3300026067 Bacteria 1242
384 Ga0207678_10609290 3300026067 Bacteria 957
385 Ga0207708_10175262 3300026075 Bacteria 1700
386 Ga0207702_10013240 3300026078 Bacteria 6859
387 Ga0207702_10788153 3300026078 Unclassified 939
388 Ga0207641_10007172 3300026088 Bacteria 9297
389 Ga0207641_10027611 3300026088 Bacteria 4688
390 Ga0207641_10361702 3300026088 Unclassified 1385
391 Ga0207648_10001125 3300026089 Bacteria 30026
392 Ga0207648_10004645 3300026089 Bacteria 14056
393 Ga0207648_10095986 3300026089 Bacteria 2594
394 Ga0207648_11120160 3300026089 Bacteria 738
395 Ga0207676_10000917 3300026095 Bacteria 22834
396 Ga0207676_10063591 3300026095 Unclassified 2931
397 Ga0207676_10636250 3300026095 Bacteria 1028
398 Ga0207676_11318905 3300026095 Bacteria 717
399 Ga0207676_12451920 3300026095 Bacteria 518
400 Ga0207674_10001209 3300026116 Bacteria 33653
401 Ga0207674_10012512 3300026116 Bacteria 9480
402 Ga0207674_10080551 3300026116 Bacteria 3259
403 Ga0207674_10165830 3300026116 Bacteria 2163
404 Ga0207674_10339745 3300026116 Bacteria 1452
405 Ga0207675_100112867 3300026118 Bacteria 2566
406 Ga0207675_100127460 3300026118 Bacteria 2412
407 Ga0207675_102298137 3300026118 Unclassified 553
408 Ga0207683_10168799 3300026121 Bacteria 1981
409 Ga0207698_10006420 3300026142 Bacteria 7336
410 Ga0207698_10056536 3300026142 Bacteria 3030
411 Ga0207698_10231360 3300026142 Bacteria 1678
412 Ga0207698_10562713 3300026142 Bacteria 1119
413 Ga0268266_10008413 3300028379 Bacteria 9174
414 Ga0268266_10008414 3300028379 Bacteria 9174
415 Ga0268266_10120460 3300028379 Bacteria 2335
416 Ga0268265_10062564 3300028380 Bacteria 2860
417 Ga0268265_10647155 3300028380 Bacteria 1016
418 Ga0268264_10025050 3300028381 Bacteria 4875
419 Ga0268264_10035798 3300028381 Bacteria 4088
420 Ga0268264_10120968 3300028381 Bacteria 2307
421 Ga0268264_10325778 3300028381 Bacteria 1454
422 Ga0307515_10223635 3300028794 Bacteria 1693
423 Ga0316182_1066667 3300030745 Bacteria 2868
424 Ga0307513_10055328 3300031456 Bacteria 4247
425 Ga0307408_100235398 3300031548 Bacteria 1502
426 Ga0307405_10005967 3300031731 Bacteria 5943
427 Ga0307405_10131384 3300031731 Bacteria 1731
428 Ga0307413_10778306 3300031824 Bacteria 802
429 Ga0307412_10378606 3300031911 Bacteria 1145
430 Ga0307412_10400752 3300031911 Bacteria 1117
431 Ga0307409_100082681 3300031995 Bacteria 2600
432 Ga0307416_100031657 3300032002 Bacteria 3985
433 Ga0307416_100641535 3300032002 Bacteria 1146
434 Ga0307416_100784405 3300032002 Unclassified 1048
435 Ga0307411_10019866 3300032005 Bacteria 3892
436 Ga0307415_100014358 3300032126 Bacteria 4654
437 Ga0373926_0447854 3300035083 Bacteria 512
438 Ga0373925_0147686 3300037068 Unclassified 1844
439 Ga0395899_0002225 3300037312 Bacteria 15897
440 Ga0395900_0417212 3300037418 Bacteria 1304
441 Ga0395900_0488030 3300037418 Bacteria 1184
442 Ga0395900_0528738 3300037418 Bacteria 1126
443 Ga0395900_0542112 3300037418 Bacteria 1109
444 Ga0395900_0753958 3300037418 Bacteria 903
445 Ga0395900_0815309 3300037418 Bacteria 860
446 Ga0395900_0909050 3300037418 Bacteria 803
447 Ga0395898_0072954 3300037466 Bacteria 3315
448 Ga0395905_0132790 3300037471 Bacteria 2341
449 Ga0395905_0284048 3300037471 Bacteria 1541
450 Ga0395905_0370150 3300037471 Bacteria 1326
451 Ga0395905_0401475 3300037471 Unclassified 1266
452 Ga0395905_0449232 3300037471 Bacteria 1187
453 Ga0395901_0031057 3300038443 Bacteria 5507
454 Ga0395901_0062704 3300038443 Bacteria 3868
455 Ga0395901_0200748 3300038443 Bacteria 2090
456 Ga0395901_0775840 3300038443 Bacteria 949
457 Ga0436365_1312492 3300039437 Bacteria 36510
458 Ga0436363_0667254 3300039450 Bacteria 1120
459 Ga0451791_0479145 3300041451 Bacteria 1410
460 Ga0451791_0550543 3300041451 Unclassified 690
461 Ga0451791_1455926 3300041451 Bacteria 1649
462 Ga0451797_0173670 3300041453 Unclassified 946
463 Ga0451797_1204322 3300041453 Unclassified 641
464 Ga0451795_1040185 3300041456 Bacteria 1029
465 Ga0451798_0140840 3300041458 Bacteria 721
466 Ga0451802_0733495 3300041460 Bacteria 3777
467 Ga0451807_0115289 3300041486 Bacteria 1576
468 Ga0451833_0553402 3300041491 Bacteria 2569
469 Ga0451835_0825198 3300041492 Unclassified 539
470 Ga0451837_0381824 3300041494 Bacteria 1145
471 Ga0451841_1340610 3300041498 Bacteria 556
472 Ga0451845_0604038 3300041501 Bacteria 1314
473 Ga0451849_0393161 3300041505 Bacteria 617
474 Ga0451849_0649684 3300041505 Bacteria 886
475 Ga0451843_0217937 3300041509 Bacteria 895
476 Ga0451853_2748198 3300041512 Bacteria 1467
477 Ga0439440_0014346 3300042993 Bacteria 1710
478 Ga0466969_0000010 3300044656 Bacteria 117215
479 Ga0466969_0041345 3300044656 Bacteria 2307
480 Ga0466969_0193272 3300044656 Unclassified 929
481 Ga0466966_0016309 3300044684 Bacteria 4913
482 Ga0466966_0037490 3300044684 Bacteria 3126
483 Ga0466966_0376814 3300044684 Bacteria 852
484 Ga0466961_0021040 3300044693 Bacteria 4198
485 Ga0466961_0077298 3300044693 Bacteria 2108
486 Ga0466961_0449991 3300044693 Bacteria 779
487 Ga0466963_0682098 3300044694 Bacteria 725
488 Ga0466964_0025530 3300044706 Bacteria 2308
489 Ga0466971_0012125 3300044719 Bacteria 3777
490 Ga0466971_0195958 3300044719 Bacteria 953
491 Ga0466970_0050903 3300044765 Bacteria 2210
492 Ga0466957_0037370 3300044842 Bacteria 2923
493 Ga0466957_0306409 3300044842 Bacteria 1068
494 Ga0466959_0044414 3300045049 Bacteria 3274
495 Ga0466959_0136347 3300045049 Unclassified 1737
496 Ga0466959_0688280 3300045049 Bacteria 685
497 Ga0451576_0031688 3300045051 Bacteria 5635
498 Ga0451576_0442920 3300045051 Bacteria 1363
499 Ga0451576_0473031 3300045051 Bacteria 1316
500 Ga0466958_0043228 3300045836 Bacteria 2713
501 Ga0466958_0228962 3300045836 Bacteria 1186
502 Ga0466967_0043057 3300045976 Bacteria 3907
503 Ga0466967_1274140 3300045976 Bacteria 732
504 Ga0495629_0141202 3300046459 Unclassified 1676
505 Ga0495663_0357852 3300046525 Bacteria 532
506 Ga0495642_0239521 3300046528 Bacteria 793
507 Ga0495658_0179532 3300046683 Bacteria 1313
508 Ga0495658_0559412 3300046683 Unclassified 732
509 Ga0495669_0108763 3300046684 Bacteria 1293
510 Ga0495669_0586700 3300046684 Bacteria 542
511 Ga0495613_0060547 3300046689 Bacteria 2773
512 Ga0496104_1272950 3300048907 Unclassified 639
513 Ga0496105_0106822 3300048908 Bacteria 2311
514 Ga0496106_1020124 3300048909 Bacteria 650
515 Ga0496108_0629683 3300048911 Bacteria 933
516 Ga0496108_0843851 3300048911 Viruses 789
517 Ga0496109_0045477 3300048912 Bacteria 3984
518 Ga0496109_1244573 3300048912 Bacteria 681
519 Ga0496111_0461291 3300048914 Bacteria 937
520 Ga0496112_0072686 3300048915 Bacteria 3400
521 Ga0496112_0335236 3300048915 Bacteria 1456
522 Ga0496113_0001649 3300048916 Bacteria 12591
523 Ga0496113_0398381 3300048916 Bacteria 1105
524 Ga0496115_0001635 3300048918 Bacteria 16127
525 Ga0496116_0065141 3300048919 Bacteria 2339
526 Ga0496122_0006726 3300048925 Bacteria 13085
527 Ga0496123_0015308 3300048926 Bacteria 6299
528 Ga0496123_0311277 3300048926 Bacteria 747
529 Ga0496124_0139872 3300048927 Bacteria 1911
530 Ga0496125_0001814 3300048928 Bacteria 29487
531 Ga0501037_1042555 3300049573 Unclassified 531
532 Ga0501043_0332307 3300049579 Bacteria 1157
533 Ga0501069_0566429 3300049585 Bacteria 680
534 Ga0501069_0623989 3300049585 Bacteria 648
535 Ga0501070_0153475 3300049586 Bacteria 1899
536 Ga0501074_0009744 3300049590 Bacteria 6975
537 Ga0501074_0089336 3300049590 Bacteria 2206
538 Ga0501080_0006373 3300049742 Bacteria 10585
539 Ga0501080_0009653 3300049742 Bacteria 8812
540 Ga0501080_0028435 3300049742 Bacteria 5200
541 Ga0501035_0045689 3300049822 Bacteria 3939
542 nmdc:mga07m45_586641_c1 3300050496 Bacteria 644
543 nmdc:mga08y16_1284251_c1 3300050511 Unclassified 699
544 nmdc:mga08y16_2135855_c1 3300050511 Bacteria 507
545 nmdc:mga0rr50_246250_c1 3300050513 Bacteria 1483
546 Ga0466962_0040933 3300061719 Bacteria 2217
547 2895397365 2895395659 Bacteria 3983269
548 Ga0163163_10016795
549 JGI24741J21665_1001048
550 JGI24740J21852_10002069
551 JGI24740J21852_10005078
552 JGI24740J21852_10012345
553 JGI24740J21852_10021387
554 JGI24739J22299_10002462
555 JGI24737J22298_10000821
556 JGI24737J22298_10033948
557 JGI24735J21928_10007641
558 JGI24738J21930_10001458
559 rootL2_10173465
560 Ga0065712_10327745
561 Ga0070658_10053956
562 Ga0070658_10064067
563 Ga0070658_10236251
564 Ga0070658_10515811
565 Ga0070676_10052834
566 Ga0070676_10064783
567 Ga0070676_10087522
568 Ga0070676_10144351
569 Ga0070676_10936938
570 Ga0070683_100039423
571 Ga0070683_100883007
572 Ga0070690_100012126
573 Ga0070690_100227705
574 Ga0070670_100043376
575 Ga0070670_100068679
576 Ga0070670_100104511
577 Ga0070670_100807251
578 Ga0070677_10105068
579 Ga0070677_10170165
580 Ga0068869_100037770
581 Ga0068869_100238258
582 Ga0068869_100251127
583 Ga0070666_10547997
584 Ga0070666_10701964
585 Ga0070666_11112729
586 Ga0070680_100093489
587 Ga0070680_100306634
588 Ga0070680_101311480
589 Ga0070682_100040576
590 Ga0068868_100001904
591 Ga0068868_100173978
592 Ga0068868_100580776
593 Ga0068868_102073064
594 Ga0070660_100000118
595 Ga0070660_100014905
596 Ga0070660_100262778
597 Ga0070660_100280674
598 Ga0070660_100382807
599 Ga0070689_100042808
600 Ga0070689_101436128
601 Ga0070691_10000023
602 Ga0070691_10092052
603 Ga0070691_10140700
604 Ga0070691_10154641
605 Ga0070661_100108493
606 Ga0070661_100364245
607 Ga0070661_100611176
608 Ga0070692_10000318
609 Ga0070692_10020391
610 Ga0070692_10234833
611 Ga0070692_10316793
612 Ga0070668_100001033
613 Ga0070668_100004982
614 Ga0070668_100069233
615 Ga0070668_101579075
616 Ga0070669_100001401
617 Ga0070669_100038557
618 Ga0070669_100201140
619 Ga0070669_100210669
620 Ga0070669_100544548
621 Ga0070669_100545892
622 Ga0070675_100012535
623 Ga0070671_100011341
624 Ga0070671_100039184
625 Ga0070671_100628628
626 Ga0070674_100003561
627 Ga0070674_100078005
628 Ga0070673_100001138
629 Ga0070673_100104640
630 Ga0070673_100393530
631 Ga0070673_100745857
632 Ga0070673_101202239
633 Ga0070659_100007254
634 Ga0070659_100044177
635 Ga0070659_100443980
636 Ga0070667_100005201
637 Ga0070667_100043557
638 Ga0070667_100371001
639 Ga0070667_100538864
640 Ga0070700_100040812
641 Ga0070700_100778255
642 Ga0070663_100127601
643 Ga0070663_100183658
644 Ga0070663_100230786
645 Ga0070663_101317110
646 Ga0070678_100101195
647 Ga0070678_100118382
648 Ga0070662_100000441
649 Ga0070662_100327973
650 Ga0070662_101047972
651 Ga0070681_10691195
652 Ga0068867_100089543
653 Ga0068867_100111192
654 Ga0068867_100239514
655 Ga0070685_10061667
656 Ga0070679_100325955
657 Ga0070679_101165598
658 Ga0070684_100202891
659 Ga0068853_100002367
660 Ga0068853_100116810
661 Ga0068853_100902816
662 Ga0070672_100000140
663 Ga0070672_100074222
664 Ga0070672_100964656
665 Ga0070696_100010618
666 Ga0070696_100764493
667 Ga0070693_100089378
668 Ga0070693_100340489
669 Ga0070665_100005596
670 Ga0070665_100080514
671 Ga0070665_100097546
672 Ga0070665_100144496
673 Ga0070665_101170933
674 Ga0070704_100740973
675 Ga0068855_100006734
676 Ga0068855_100008925
677 Ga0070664_100037506
678 Ga0070664_100109920
679 Ga0070664_100703227
680 Ga0070664_101046009
681 Ga0068857_100000090
682 Ga0068857_100062838
683 Ga0068857_100327654
684 Ga0068854_100003349
685 Ga0068854_100742418
686 Ga0068856_100360829
687 Ga0068856_100469215
688 Ga0068852_100080917
689 Ga0068852_101761487
690 Ga0068859_100001249
691 Ga0068859_100234512
692 Ga0068859_101344754
693 Ga0068864_100000842
694 Ga0068864_100416235
695 Ga0068864_100639686
696 Ga0068866_10101840
697 Ga0068861_100068736
698 Ga0068861_100335646
699 Ga0068861_100875021
700 Ga0068851_10029461
701 Ga0068851_10032823
702 Ga0068870_10400368
703 Ga0068870_10813594
704 Ga0068863_100001768
705 Ga0068863_100023998
706 Ga0068863_100085543
707 Ga0068863_100378927
708 Ga0068863_100679335
709 Ga0068858_100003441
710 Ga0068860_100005039
711 Ga0068860_100019638
712 Ga0068860_100025832
713 Ga0068860_100289744
714 Ga0068862_100052615
715 Ga0068862_100324839
716 Ga0068862_101011763
717 Ga0075366_11031379
718 Ga0097621_100068494
719 Ga0097621_100266727
720 Ga0068871_100093089
721 Ga0068871_100487831
722 Ga0068865_100000519
723 Ga0068865_100063002
724 Ga0068865_100293472
725 Ga0068865_100482259
726 Ga0097620_100001249
727 Ga0097620_100234525
728 Ga0097620_101344740
729 Ga0075435_100128428
730 Ga0105240_10035951
731 Ga0105240_11112970
732 Ga0111539_10333404
733 Ga0105245_10000958
734 Ga0105245_10268402
735 Ga0105245_10302297
736 Ga0105245_10484578
737 Ga0105243_10269904
738 Ga0105241_10390017
739 Ga0105241_10893560
740 Ga0105248_10001159
741 Ga0105248_10003559
742 Ga0105248_10007594
743 Ga0105248_10058882
744 Ga0105248_10970737
745 Ga0105237_10313875
746 Ga0105237_10906475
747 Ga0105238_10027548
748 Ga0105238_10109904
749 Ga0105238_10283952
750 Ga0105238_10528666
751 Ga0105249_10044832
752 Ga0105239_10013044
753 Ga0105239_10068307
754 Ga0105239_10083274
755 Ga0105239_10130657
756 Ga0105239_12233185
757 Ga0105246_10008877
758 Ga0105246_10033746
759 Ga0105246_10034328
760 Ga0105246_11226580
761 Ga0157373_10028521
762 Ga0157373_10242026
763 Ga0157373_10339218
764 Ga0157371_10002258
765 Ga0157371_10122305
766 Ga0157370_10024835
767 Ga0157370_10045567
768 Ga0157370_10058130
769 Ga0157370_10089014
770 Ga0157369_10012729
771 Ga0157369_10133121
772 Ga0157369_10458793
773 Ga0157374_10282177
774 Ga0157378_10076816
775 Ga0163162_10019532
776 Ga0163162_10058463
777 Ga0163162_10206304
778 Ga0163162_10407495
779 Ga0157372_10026660
780 Ga0157372_10095966
781 Ga0157372_10950755
782 Ga0157375_10015356
783 Ga0157375_10057956
784 Ga0157375_10551268
785 Ga0163163_10046161
786 Ga0163163_10079887
787 Ga0157380_10064029
788 Ga0157380_10080197
789 Ga0157377_10020259
790 Ga0157379_10033378
791 Ga0157379_10472817
792 Ga0157376_11361570
793 Ga0206356_10490854
794 Ga0206352_11323856
795 Ga0206350_11208628
796 Ga0206354_11275857
797 Ga0206353_11130673
798 Ga0154015_1065785
799 Ga0213876_10001651
800 Ga0224712_10215850
801 Ga0207673_1047737
802 Ga0207697_10000261
803 Ga0207697_10085178
804 Ga0207656_10015391
805 Ga0207656_10036495
806 Ga0207656_10065264
807 Ga0207656_10205297
808 Ga0207682_10232433
809 Ga0207688_10000960
810 Ga0207688_10055447
811 Ga0207680_10131412
812 Ga0207680_10654207
813 Ga0207647_10003579
814 Ga0207647_10004221
815 Ga0207647_10010636
816 Ga0207647_10145294
817 Ga0207645_10003103
818 Ga0207645_10020570
819 Ga0207645_10048325
820 Ga0207645_10144678
821 Ga0207645_10342934
822 Ga0207643_10017431
823 Ga0207643_10092386
824 Ga0207643_10418085
825 Ga0207705_10038191
826 Ga0207705_10053239
827 Ga0207705_10057125
828 Ga0207707_10000073
829 Ga0207707_10217767
830 Ga0207707_10688393
831 Ga0207695_10160662
832 Ga0207695_10194173
833 Ga0207671_10267701
834 Ga0207671_10298016
835 Ga0207671_10524721
836 Ga0207660_10117096
837 Ga0207660_10155150
838 Ga0207662_10047693
839 Ga0207657_10008435
840 Ga0207657_10023549
841 Ga0207657_10024434
842 Ga0207657_10197863
843 Ga0207657_10213566
844 Ga0207657_10720852
845 Ga0207657_11314200
846 Ga0207649_10035426
847 Ga0207649_10214857
848 Ga0207652_10076572
849 Ga0207652_10598891
850 Ga0207681_10016320
851 Ga0207681_10072149
852 Ga0207681_10106994
853 Ga0207694_10613788
854 Ga0207650_10027925
855 Ga0207650_10106781
856 Ga0207650_10229947
857 Ga0207650_10261052
858 Ga0207659_10085258
859 Ga0207687_10916789
860 Ga0207644_10008141
861 Ga0207644_10025496
862 Ga0207644_10278130
863 Ga0207690_10000435
864 Ga0207690_10002961
865 Ga0207690_10107352
866 Ga0207706_10002190
867 Ga0207706_10052184
868 Ga0207706_10346093
869 Ga0207706_10579244
870 Ga0207709_10142261
871 Ga0207709_10174644
872 Ga0207670_10068770
873 Ga0207670_10830718
874 Ga0207669_10024865
875 Ga0207669_10028144
876 Ga0207704_10133863
877 Ga0207704_10154283
878 Ga0207704_10356034
879 Ga0207704_10403512
880 Ga0207691_10001863
881 Ga0207691_10009856
882 Ga0207691_10064569
883 Ga0207691_10071686
884 Ga0207711_10005496
885 Ga0207711_10006794
886 Ga0207711_10010781
887 Ga0207711_10174475
888 Ga0207711_10220633
889 Ga0207689_10000341
890 Ga0207689_10038398
891 Ga0207689_10094379
892 Ga0207661_10019609
893 Ga0207661_10052818
894 Ga0207661_10244451
895 Ga0207679_10004345
896 Ga0207679_11346808
897 Ga0207667_10021644
898 Ga0207667_10024671
899 Ga0207667_10677072
900 Ga0207651_10009435
901 Ga0207651_10561796
902 Ga0207712_10039041
903 Ga0207668_10000239
904 Ga0207668_10130818
905 Ga0207640_10008985
906 Ga0207640_10052953
907 Ga0207640_10242999
908 Ga0207640_10348733
909 Ga0207658_10027136
910 Ga0207658_10046312
911 Ga0207658_10083275
912 Ga0207658_10204171
913 Ga0207658_10276288
914 Ga0207658_10368308
915 Ga0207677_10047612
916 Ga0207677_10810509
917 Ga0207677_11696482
918 Ga0207703_10003682
919 Ga0207703_10169996
920 Ga0207703_11434761
921 Ga0207639_10001803
922 Ga0207639_10054967
923 Ga0207639_10104800
924 Ga0207639_10134198
925 Ga0207639_10655772
926 Ga0207639_11232105
927 Ga0207678_10221930
928 Ga0207678_10229737
929 Ga0207678_10307501
930 Ga0207678_10367673
931 Ga0207678_10609290
932 Ga0207708_10175262
933 Ga0207702_10013240
934 Ga0207702_10788153
935 Ga0207641_10007172
936 Ga0207641_10027611
937 Ga0207641_10361702
938 Ga0207648_10001125
939 Ga0207648_10004645
940 Ga0207648_10095986
941 Ga0207648_11120160
942 Ga0207676_10000917
943 Ga0207676_10063591
944 Ga0207676_10636250
945 Ga0207676_11318905
946 Ga0207676_12451920
947 Ga0207674_10001209
948 Ga0207674_10012512
949 Ga0207674_10080551
950 Ga0207674_10165830
951 Ga0207674_10339745
952 Ga0207675_100112867
953 Ga0207675_100127460
954 Ga0207675_102298137
955 Ga0207683_10168799
956 Ga0207698_10006420
957 Ga0207698_10056536
958 Ga0207698_10231360
959 Ga0207698_10562713
960 Ga0268266_10008413
961 Ga0268266_10008414
962 Ga0268266_10120460
963 Ga0268265_10062564
964 Ga0268265_10647155
965 Ga0268264_10025050
966 Ga0268264_10035798
967 Ga0268264_10120968
968 Ga0268264_10325778
969 Ga0307515_10223635
970 Ga0316182_1066667
971 Ga0307513_10055328
972 Ga0307408_100235398
973 Ga0307405_10005967
974 Ga0307405_10131384
975 Ga0307413_10778306
976 Ga0307412_10378606
977 Ga0307412_10400752
978 Ga0307409_100082681
979 Ga0307416_100031657
980 Ga0307416_100641535
981 Ga0307416_100784405
982 Ga0307411_10019866
983 Ga0307415_100014358
984 Ga0373926_0447854
985 Ga0373925_0147686
986 Ga0395899_0002225
987 Ga0395900_0417212
988 Ga0395900_0488030
989 Ga0395900_0528738
990 Ga0395900_0542112
991 Ga0395900_0753958
992 Ga0395900_0815309
993 Ga0395900_0909050
994 Ga0395898_0072954
995 Ga0395905_0132790
996 Ga0395905_0284048
997 Ga0395905_0370150
998 Ga0395905_0401475
999 Ga0395905_0449232
1000 Ga0395901_0031057
1001 Ga0395901_0062704
1002 Ga0395901_0200748
1003 Ga0395901_0775840
1004 Ga0436365_1312492
1005 Ga0436363_0667254
1006 Ga0451791_0479145
1007 Ga0451791_0550543
1008 Ga0451791_1455926
1009 Ga0451797_0173670
1010 Ga0451797_1204322
1011 Ga0451795_1040185
1012 Ga0451798_0140840
1013 Ga0451802_0733495
1014 Ga0451807_0115289
1015 Ga0451833_0553402
1016 Ga0451835_0825198
1017 Ga0451837_0381824
1018 Ga0451841_1340610
1019 Ga0451845_0604038
1020 Ga0451849_0393161
1021 Ga0451849_0649684
1022 Ga0451843_0217937
1023 Ga0451853_2748198
1024 Ga0439440_0014346
1025 Ga0466969_0000010
1026 Ga0466969_0041345
1027 Ga0466969_0193272
1028 Ga0466966_0016309
1029 Ga0466966_0037490
1030 Ga0466966_0376814
1031 Ga0466961_0021040
1032 Ga0466961_0077298
1033 Ga0466961_0449991
1034 Ga0466963_0682098
1035 Ga0466964_0025530
1036 Ga0466971_0012125
1037 Ga0466971_0195958
1038 Ga0466970_0050903
1039 Ga0466957_0037370
1040 Ga0466957_0306409
1041 Ga0466959_0044414
1042 Ga0466959_0136347
1043 Ga0466959_0688280
1044 Ga0451576_0031688
1045 Ga0451576_0442920
1046 Ga0451576_0473031
1047 Ga0466958_0043228
1048 Ga0466958_0228962
1049 Ga0466967_0043057
1050 Ga0466967_1274140
1051 Ga0495629_0141202
1052 Ga0495663_0357852
1053 Ga0495642_0239521
1054 Ga0495658_0179532
1055 Ga0495658_0559412
1056 Ga0495669_0108763
1057 Ga0495669_0586700
1058 Ga0495613_0060547
1059 Ga0496104_1272950
1060 Ga0496105_0106822
1061 Ga0496106_1020124
1062 Ga0496108_0629683
1063 Ga0496108_0843851
1064 Ga0496109_0045477
1065 Ga0496109_1244573
1066 Ga0496111_0461291
1067 Ga0496112_0072686
1068 Ga0496112_0335236
1069 Ga0496113_0001649
1070 Ga0496113_0398381
1071 Ga0496115_0001635
1072 Ga0496116_0065141
1073 Ga0496122_0006726
1074 Ga0496123_0015308
1075 Ga0496123_0311277
1076 Ga0496124_0139872
1077 Ga0496125_0001814
1078 Ga0501037_1042555
1079 Ga0501043_0332307
1080 Ga0501069_0566429
1081 Ga0501069_0623989
1082 Ga0501070_0153475
1083 Ga0501074_0009744
1084 Ga0501074_0089336
1085 Ga0501080_0006373
1086 Ga0501080_0009653
1087 Ga0501080_0028435
1088 Ga0501035_0045689
1089 nmdc:mga07m45_586641_c1
1090 nmdc:mga08y16_1284251_c1
1091 nmdc:mga08y16_2135855_c1
1092 nmdc:mga0rr50_246250_c1
1093 Ga0466962_0040933
1094 2895397365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pij-assembly1.cif.gz_A structure of the cro protein from prophage pfl 6 in pseudomonas fluorescens pf-5 0.7775 12 32
8a8o-assembly1.cif.gz_C paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a 0.7537 3 35
7evp-assembly1.cif.gz_B cryo-em structure of the gp168-beta-clamp complex 0.7448 2 32
6deg-assembly1.cif.gz_B crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from bartonella birtlesii ll-wm9 0.741 2 30
7u4c-assembly2.cif.gz_B borrelia burgdorferi htpg n-terminal domain (1-228) in complex with bx-2819 0.7215 2 32
ID Description Score Start End Superfamily
af_Q8IHQ8_419_554_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8245 3 33 2.130.10.10
af_C6Y4B9_1_89_3.30.1410.10 Alpha Beta;2-Layer Sandwich;Gtp Cyclohydrolase I Feedback Regulatory Protein; Chain: K;GTP cyclohydrolase I feedback regulatory protein GFRP 0.7975 2 33 3.30.1410.10
2pijA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7775 12 32 1.10.260.40
3c0bD01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7774 5 31 3.30.420.40
af_A0A0R4IVP6_260_438_2.30.29.230 Mainly Beta;Roll;PH-domain like; 0.7722 2 33 2.30.29.230
ID Description Score Start End GO Terms
AF-A0A4Q2WZT7-F1-model_v4 Uncharacterized protein 0.9922 1 148
AF-A0A4Q2WZT7-F1-model_v4 Uncharacterized protein 0.9855 1 148
AF-A0A0U2LP89-F1-model_v4 Uncharacterized protein 0.9817 1 148
AF-A0A7X6BFA4-F1-model_v4 Uncharacterized protein 0.9787 1 148
AF-A0A0U2LP89-F1-model_v4 Uncharacterized protein 0.9752 1 148

Map