F462075

General Info

Members Datasets Scaffolds Average Seq Length
547 251 1094 158

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100980032|Ga0070706_1009800322
Length 145
Sequence VTGTKPDTGCVFCDAPRPPHPDSLIVYERKTYPYNNGHLMVVPYRHTPSLASLTADERHEMADLQALSEKALVEAYSPHGINVGINLGKPAGAGVLEHVHVHLVPRWNGDTNFMTVVGTTRVLPEDLHQSAARLKPIFAKLGGSR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 16.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100980032 3300005467 Bacteria 780
2 JGI24751J29686_10067699 3300002459 Bacteria 735
3 Ga0065704_10100033 3300005289 Archaea 2288
4 Ga0065704_10180109 3300005289 Bacteria 1242
5 Ga0065712_10090193 3300005290 Bacteria 2378
6 Ga0065715_10103335 3300005293 Bacteria 3041
7 Ga0065707_10203407 3300005295 Unclassified 1300
8 Ga0065707_10746466 3300005295 Bacteria 620
9 Ga0070676_10063417 3300005328 Bacteria 2201
10 Ga0070676_10422367 3300005328 Bacteria 932
11 Ga0070683_100095946 3300005329 Bacteria 2789
12 Ga0070683_100455478 3300005329 Bacteria 1221
13 Ga0070683_100548268 3300005329 Bacteria 1106
14 Ga0070690_100283298 3300005330 Bacteria 1183
15 Ga0070690_100689043 3300005330 Bacteria 784
16 Ga0070670_100002451 3300005331 Bacteria 15294
17 Ga0070670_100023207 3300005331 Bacteria 5339
18 Ga0070670_100211254 3300005331 Bacteria 1687
19 Ga0070670_100255633 3300005331 Unclassified 1526
20 Ga0070670_101895125 3300005331 Bacteria 549
21 Ga0070666_10166757 3300005335 Bacteria 1541
22 Ga0070666_10263674 3300005335 Unclassified 1222
23 Ga0070666_10439772 3300005335 Bacteria 941
24 Ga0070680_100150761 3300005336 Bacteria 1952
25 Ga0070680_100178794 3300005336 Bacteria 1787
26 Ga0070680_100440945 3300005336 Bacteria 1112
27 Ga0070680_100954657 3300005336 Bacteria 740
28 Ga0068868_101390895 3300005338 Bacteria 654
29 Ga0070689_100007697 3300005340 Bacteria 7548
30 Ga0070689_100040857 3300005340 Bacteria 3557
31 Ga0070689_100319374 3300005340 Bacteria 1296
32 Ga0070689_100374634 3300005340 Unclassified 1199
33 Ga0070691_10016935 3300005341 Bacteria 3352
34 Ga0070691_10070953 3300005341 Bacteria 1690
35 Ga0070687_100003597 3300005343 Bacteria 6045
36 Ga0070661_100333852 3300005344 Bacteria 1186
37 Ga0070661_101153296 3300005344 Bacteria 647
38 Ga0070692_10006258 3300005345 Bacteria 5157
39 Ga0070692_10239634 3300005345 Bacteria 1081
40 Ga0070668_100028798 3300005347 Bacteria 4215
41 Ga0070669_100020423 3300005353 Bacteria 4731
42 Ga0070675_100005411 3300005354 Bacteria 9762
43 Ga0070675_100060315 3300005354 Bacteria 3132
44 Ga0070675_100079908 3300005354 Bacteria 2725
45 Ga0070675_100563573 3300005354 Bacteria 1031
46 Ga0070671_100021077 3300005355 Bacteria 5320
47 Ga0070671_100487219 3300005355 Bacteria 1060
48 Ga0070674_100356615 3300005356 Bacteria 1183
49 Ga0070673_100010171 3300005364 Bacteria 6353
50 Ga0070673_100035583 3300005364 Bacteria 3777
51 Ga0070673_100083414 3300005364 Bacteria 2596
52 Ga0070673_100229397 3300005364 Unclassified 1610
53 Ga0070673_100274568 3300005364 Bacteria 1476
54 Ga0070673_101012747 3300005364 Bacteria 774
55 Ga0070673_101463331 3300005364 Archaea 644
56 Ga0070673_101467258 3300005364 Unclassified 643
57 Ga0070688_100017992 3300005365 Bacteria 4067
58 Ga0070688_100443582 3300005365 Unclassified 969
59 Ga0070688_100488606 3300005365 Unclassified 927
60 Ga0070659_100818387 3300005366 Bacteria 811
61 Ga0070667_100876698 3300005367 Bacteria 835
62 Ga0070713_100061352 3300005436 Bacteria 3145
63 Ga0070705_100008158 3300005440 Bacteria 5178
64 Ga0070705_100010279 3300005440 Bacteria 4679
65 Ga0070705_100030698 3300005440 Bacteria 2969
66 Ga0070705_100094064 3300005440 Unclassified 1875
67 Ga0070705_100242397 3300005440 Bacteria 1260
68 Ga0070705_100682219 3300005440 Bacteria 805
69 Ga0070700_100045566 3300005441 Bacteria 2706
70 Ga0070700_100079708 3300005441 Bacteria 2111
71 Ga0070700_100520240 3300005441 Bacteria 919
72 Ga0070700_100741926 3300005441 Unclassified 785
73 Ga0070694_100003855 3300005444 Bacteria 8959
74 Ga0070694_100036631 3300005444 Bacteria 3250
75 Ga0070694_100065929 3300005444 Unclassified 2482
76 Ga0070694_100080022 3300005444 Bacteria 2269
77 Ga0070694_100162559 3300005444 Unclassified 1639
78 Ga0070694_100422446 3300005444 Bacteria 1048
79 Ga0070708_100178953 3300005445 Unclassified 1982
80 Ga0070708_101270849 3300005445 Bacteria 688
81 Ga0070663_100372006 3300005455 Unclassified 1162
82 Ga0070678_100502682 3300005456 Bacteria 1070
83 Ga0070678_100829736 3300005456 Unclassified 841
84 Ga0070662_100558058 3300005457 Unclassified 960
85 Ga0070681_10014498 3300005458 Bacteria 7843
86 Ga0070681_11485036 3300005458 Unclassified 602
87 Ga0068867_100012627 3300005459 Bacteria 5973
88 Ga0068867_100024981 3300005459 Bacteria 4284
89 Ga0070685_10070575 3300005466 Bacteria 2068
90 Ga0070685_10148832 3300005466 Bacteria 1482
91 Ga0070685_10152478 3300005466 Bacteria 1466
92 Ga0070707_100087504 3300005468 Bacteria 3013
93 Ga0070707_100171766 3300005468 Unclassified 2112
94 Ga0070707_101552278 3300005468 Unclassified 629
95 Ga0070698_100001361 3300005471 Bacteria 27195
96 Ga0070698_100061413 3300005471 Bacteria 3792
97 Ga0070698_100138225 3300005471 Unclassified 2389
98 Ga0070699_100016886 3300005518 Bacteria 6267
99 Ga0070699_100113485 3300005518 Bacteria 2380
100 Ga0070699_100163343 3300005518 Unclassified 1972
101 Ga0070699_100653742 3300005518 Bacteria 960
102 Ga0070679_100969418 3300005530 Bacteria 794
103 Ga0070684_100233942 3300005535 Unclassified 1678
104 Ga0070697_100011740 3300005536 Bacteria 6852
105 Ga0070697_100104356 3300005536 Bacteria 2357
106 Ga0070672_100018000 3300005543 Bacteria 5098
107 Ga0070672_100053346 3300005543 Bacteria 3160
108 Ga0070672_100098462 3300005543 Bacteria 2369
109 Ga0070672_100139244 3300005543 Bacteria 2000
110 Ga0070672_100344544 3300005543 Bacteria 1269
111 Ga0070695_100005101 3300005545 Bacteria 7738
112 Ga0070695_100015572 3300005545 Bacteria 4592
113 Ga0070695_100125899 3300005545 Bacteria 1759
114 Ga0070695_100812563 3300005545 Bacteria 750
115 Ga0070696_100065393 3300005546 Bacteria 2549
116 Ga0070696_100065866 3300005546 Bacteria 2540
117 Ga0070696_100069406 3300005546 Bacteria 2476
118 Ga0070696_100388883 3300005546 Archaea 1089
119 Ga0070693_100396202 3300005547 Bacteria 956
120 Ga0070704_100003039 3300005549 Bacteria 9549
121 Ga0070704_100037136 3300005549 Bacteria 3325
122 Ga0070704_100043293 3300005549 Bacteria 3120
123 Ga0070704_100046514 3300005549 Bacteria 3026
124 Ga0070704_100061459 3300005549 Bacteria 2688
125 Ga0070704_100269355 3300005549 Bacteria 1406
126 Ga0070664_100049913 3300005564 Bacteria 3539
127 Ga0070664_100172510 3300005564 Unclassified 1919
128 Ga0070664_100384978 3300005564 Bacteria 1281
129 Ga0070664_100662062 3300005564 Bacteria 971
130 Ga0070664_101526972 3300005564 Unclassified 632
131 Ga0068857_100051093 3300005577 Bacteria 3666
132 Ga0068857_100051374 3300005577 Unclassified 3657
133 Ga0068857_100239775 3300005577 Unclassified 1660
134 Ga0070702_100000965 3300005615 Bacteria 11328
135 Ga0070702_100180870 3300005615 Bacteria 1379
136 Ga0070702_100308688 3300005615 Bacteria 1097
137 Ga0068852_100557134 3300005616 Bacteria 1147
138 Ga0068859_100023597 3300005617 Bacteria 6173
139 Ga0068859_100064783 3300005617 Bacteria 3688
140 Ga0068859_100071915 3300005617 Bacteria 3494
141 Ga0068859_100166076 3300005617 Bacteria 2287
142 Ga0068859_100197247 3300005617 Bacteria 2097
143 Ga0068864_100083126 3300005618 Unclassified 2811
144 Ga0068864_100209498 3300005618 Bacteria 1794
145 Ga0068864_100927353 3300005618 Unclassified 861
146 Ga0068866_10768479 3300005718 Archaea 667
147 Ga0068861_100148242 3300005719 Bacteria 1922
148 Ga0068861_100257421 3300005719 Unclassified 1492
149 Ga0068870_10045198 3300005840 Bacteria 2304
150 Ga0068870_10944254 3300005840 Archaea 612
151 Ga0068863_100095079 3300005841 Bacteria 2828
152 Ga0068858_100121589 3300005842 Unclassified 2442
153 Ga0068860_100020262 3300005843 Bacteria 6442
154 Ga0068862_100000965 3300005844 Bacteria 27670
155 Ga0068862_100218680 3300005844 Bacteria 1724
156 Ga0068862_100841563 3300005844 Bacteria 899
157 Ga0068862_100987930 3300005844 Bacteria 832
158 Ga0068862_101199189 3300005844 Bacteria 757
159 Ga0081538_10093702 3300005981 Bacteria 1541
160 Ga0070717_10877320 3300006028 Bacteria 817
161 Ga0070712_100258361 3300006175 Unclassified 1395
162 Ga0097621_100387678 3300006237 Bacteria 1249
163 Ga0097621_100777198 3300006237 Unclassified 886
164 Ga0068871_100170961 3300006358 Bacteria 1863
165 Ga0068871_100769508 3300006358 Bacteria 886
166 Ga0075428_100002389 3300006844 Bacteria 20390
167 Ga0075428_100032481 3300006844 Bacteria 5765
168 Ga0075428_100136346 3300006844 Bacteria 2668
169 Ga0075428_100850620 3300006844 Unclassified 968
170 Ga0075430_100136994 3300006846 Bacteria 2039
171 Ga0075430_100565033 3300006846 Bacteria 938
172 Ga0075431_100140280 3300006847 Bacteria 2491
173 Ga0075433_10057114 3300006852 Bacteria 3410
174 Ga0075433_10319892 3300006852 Bacteria 1373
175 Ga0075434_100002227 3300006871 Bacteria 16930
176 Ga0075434_100026891 3300006871 Bacteria 5643
177 Ga0075434_100144037 3300006871 Bacteria 2403
178 Ga0075429_100096361 3300006880 Bacteria 2581
179 Ga0068865_100135288 3300006881 Bacteria 1851
180 Ga0068865_100182877 3300006881 Bacteria 1615
181 Ga0068865_100468511 3300006881 Bacteria 1045
182 Ga0068865_101218147 3300006881 Bacteria 667
183 Ga0068865_101269200 3300006881 Archaea 654
184 Ga0097620_100023597 3300006931 Bacteria 6173
185 Ga0097620_100064780 3300006931 Bacteria 3688
186 Ga0097620_100071917 3300006931 Bacteria 3494
187 Ga0097620_100166064 3300006931 Bacteria 2287
188 Ga0097620_100197261 3300006931 Bacteria 2097
189 Ga0097620_100687890 3300006931 Bacteria 1114
190 Ga0075435_100017622 3300007076 Bacteria 5411
191 Ga0075435_100096882 3300007076 Bacteria 2441
192 Ga0075435_100135197 3300007076 Unclassified 2065
193 Ga0105240_11793162 3300009093 Bacteria 640
194 Ga0111539_10000853 3300009094 Bacteria 39770
195 Ga0111539_10031527 3300009094 Bacteria 6438
196 Ga0111539_10130395 3300009094 Bacteria 2944
197 Ga0111539_10167961 3300009094 Bacteria 2564
198 Ga0111539_10557837 3300009094 Bacteria 1334
199 Ga0111539_12896408 3300009094 Unclassified 555
200 Ga0111539_13198878 3300009094 Bacteria 528
201 Ga0105245_10491697 3300009098 Bacteria 1242
202 Ga0114129_10000511 3300009147 Bacteria 47494
203 Ga0114129_10005475 3300009147 Bacteria 17945
204 Ga0114129_10020481 3300009147 Bacteria 9407
205 Ga0114129_10043525 3300009147 Bacteria 6316
206 Ga0114129_10068174 3300009147 Bacteria 4960
207 Ga0114129_10201202 3300009147 Bacteria 2697
208 Ga0114129_10259051 3300009147 Bacteria 2332
209 Ga0114129_10471982 3300009147 Bacteria 1643
210 Ga0114129_11139610 3300009147 Bacteria 974
211 Ga0105243_10028803 3300009148 Unclassified 4267
212 Ga0105243_10117778 3300009148 Bacteria 2234
213 Ga0105243_10444299 3300009148 Bacteria 1215
214 Ga0105242_10520967 3300009176 Bacteria 1134
215 Ga0105248_10745200 3300009177 Bacteria 1105
216 Ga0105248_11677939 3300009177 Unclassified 720
217 Ga0105248_12047608 3300009177 Bacteria 651
218 Ga0105249_10012343 3300009553 Bacteria 7528
219 Ga0105249_11692250 3300009553 Bacteria 705
220 Ga0157369_11064926 3300013105 Bacteria 827
221 Ga0157374_10266360 3300013296 Bacteria 1689
222 Ga0157378_10110852 3300013297 Bacteria 2515
223 Ga0157378_10201344 3300013297 Bacteria 1883
224 Ga0157378_11750594 3300013297 Bacteria 669
225 Ga0163162_10679885 3300013306 Bacteria 1152
226 Ga0163162_10833364 3300013306 Archaea 1038
227 Ga0157375_10146571 3300013308 Bacteria 2492
228 Ga0157375_10681893 3300013308 Unclassified 1182
229 Ga0157375_10682464 3300013308 Bacteria 1182
230 Ga0157375_10758618 3300013308 Bacteria 1121
231 Ga0157375_12330235 3300013308 Bacteria 638
232 Ga0163163_10510177 3300014325 Unclassified 1264
233 Ga0163163_11293810 3300014325 Bacteria 791
234 Ga0157380_10324523 3300014326 Bacteria 1429
235 Ga0157380_10467797 3300014326 Bacteria 1216
236 Ga0157380_10699361 3300014326 Bacteria 1018
237 Ga0157380_10745102 3300014326 Bacteria 990
238 Ga0157380_10929530 3300014326 Bacteria 898
239 Ga0157377_10018607 3300014745 Bacteria 3613
240 Ga0157377_10397511 3300014745 Bacteria 938
241 Ga0157377_10552774 3300014745 Bacteria 813
242 Ga0157379_10783768 3300014968 Unclassified 899
243 Ga0157376_10395202 3300014969 Unclassified 1335
244 Ga0157376_11427817 3300014969 Unclassified 724
245 Ga0207642_10022487 3300025899 Bacteria 2502
246 Ga0207642_10533842 3300025899 Unclassified 722
247 Ga0207645_10016706 3300025907 Bacteria 4853
248 Ga0207645_10258953 3300025907 Bacteria 1152
249 Ga0207645_10453804 3300025907 Bacteria 865
250 Ga0207643_10015908 3300025908 Bacteria 4098
251 Ga0207643_10158930 3300025908 Unclassified 1359
252 Ga0207707_10025344 3300025912 Bacteria 5187
253 Ga0207695_10763843 3300025913 Bacteria 847
254 Ga0207693_10164355 3300025915 Bacteria 1747
255 Ga0207660_10316325 3300025917 Unclassified 1246
256 Ga0207660_10396689 3300025917 Bacteria 1111
257 Ga0207660_11196155 3300025917 Bacteria 619
258 Ga0207662_10011633 3300025918 Bacteria 4888
259 Ga0207662_10266536 3300025918 Unclassified 1129
260 Ga0207657_10318354 3300025919 Unclassified 1230
261 Ga0207646_10186210 3300025922 Unclassified 1875
262 Ga0207646_10521168 3300025922 Bacteria 1070
263 Ga0207681_10015298 3300025923 Bacteria 4783
264 Ga0207650_10051282 3300025925 Bacteria 3053
265 Ga0207650_10076907 3300025925 Bacteria 2522
266 Ga0207650_10142112 3300025925 Bacteria 1888
267 Ga0207650_10654464 3300025925 Bacteria 886
268 Ga0207659_10001023 3300025926 Bacteria 16624
269 Ga0207659_10059596 3300025926 Bacteria 2745
270 Ga0207659_10239583 3300025926 Bacteria 1467
271 Ga0207687_10737430 3300025927 Bacteria 838
272 Ga0207687_10886526 3300025927 Bacteria 763
273 Ga0207700_10029353 3300025928 Bacteria 3879
274 Ga0207644_10834280 3300025931 Unclassified 771
275 Ga0207690_10091268 3300025932 Bacteria 2153
276 Ga0207706_10147120 3300025933 Bacteria 2072
277 Ga0207706_10689770 3300025933 Bacteria 873
278 Ga0207686_10217288 3300025934 Bacteria 1378
279 Ga0207686_10442820 3300025934 Bacteria 998
280 Ga0207709_10046225 3300025935 Bacteria 2641
281 Ga0207709_10063982 3300025935 Bacteria 2307
282 Ga0207709_10094782 3300025935 Unclassified 1960
283 Ga0207709_10175055 3300025935 Unclassified 1510
284 Ga0207709_10697987 3300025935 Bacteria 812
285 Ga0207670_10001697 3300025936 Bacteria 11484
286 Ga0207670_10040480 3300025936 Bacteria 3059
287 Ga0207670_10092728 3300025936 Bacteria 2138
288 Ga0207670_10462525 3300025936 Bacteria 1024
289 Ga0207669_10282113 3300025937 Bacteria 1253
290 Ga0207704_10101926 3300025938 Bacteria 1916
291 Ga0207704_10663842 3300025938 Bacteria 860
292 Ga0207704_11263555 3300025938 Archaea 631
293 Ga0207691_10003770 3300025940 Bacteria 14719
294 Ga0207691_10060909 3300025940 Bacteria 3429
295 Ga0207691_10119089 3300025940 Unclassified 2342
296 Ga0207691_10387691 3300025940 Unclassified 1192
297 Ga0207691_10936067 3300025940 Unclassified 724
298 Ga0207711_10054570 3300025941 Bacteria 3430
299 Ga0207711_10275913 3300025941 Bacteria 1547
300 Ga0207689_10863879 3300025942 Bacteria 763
301 Ga0207661_10027456 3300025944 Bacteria 4348
302 Ga0207661_10490397 3300025944 Bacteria 1122
303 Ga0207679_10012106 3300025945 Bacteria 5613
304 Ga0207679_10075054 3300025945 Bacteria 2564
305 Ga0207679_10258515 3300025945 Bacteria 1484
306 Ga0207679_11633713 3300025945 Bacteria 590
307 Ga0207667_10443823 3300025949 Bacteria 1319
308 Ga0207667_10776711 3300025949 Bacteria 956
309 Ga0207651_10027096 3300025960 Bacteria 3594
310 Ga0207651_10081179 3300025960 Bacteria 2337
311 Ga0207651_10101568 3300025960 Bacteria 2135
312 Ga0207651_10375768 3300025960 Bacteria 1203
313 Ga0207651_10818722 3300025960 Bacteria 826
314 Ga0207651_11290584 3300025960 Archaea 656
315 Ga0207712_10061818 3300025961 Unclassified 2660
316 Ga0207712_10130364 3300025961 Bacteria 1915
317 Ga0207668_10070061 3300025972 Unclassified 2499
318 Ga0207668_10152761 3300025972 Bacteria 1789
319 Ga0207640_10134317 3300025981 Bacteria 1793
320 Ga0207658_11463816 3300025986 Unclassified 625
321 Ga0207677_10431320 3300026023 Unclassified 1125
322 Ga0207703_10035522 3300026035 Bacteria 3961
323 Ga0207703_10449211 3300026035 Bacteria 1204
324 Ga0207708_10052834 3300026075 Unclassified 3095
325 Ga0207708_10121474 3300026075 Bacteria 2035
326 Ga0207708_11083780 3300026075 Unclassified 698
327 Ga0207641_10728989 3300026088 Unclassified 977
328 Ga0207641_10732172 3300026088 Unclassified 975
329 Ga0207641_11182112 3300026088 Unclassified 764
330 Ga0207648_10003593 3300026089 Bacteria 16219
331 Ga0207648_10010521 3300026089 Bacteria 8763
332 Ga0207648_10472408 3300026089 Bacteria 1144
333 Ga0207676_10006494 3300026095 Bacteria 8264
334 Ga0207676_10130975 3300026095 Bacteria 2132
335 Ga0207676_10142568 3300026095 Unclassified 2053
336 Ga0207676_10860020 3300026095 Unclassified 887
337 Ga0207674_10002363 3300026116 Bacteria 23849
338 Ga0207674_10070658 3300026116 Bacteria 3510
339 Ga0207675_100018350 3300026118 Bacteria 6524
340 Ga0207675_100123180 3300026118 Bacteria 2454
341 Ga0207675_100439318 3300026118 Bacteria 1291
342 Ga0207683_10162585 3300026121 Bacteria 2019
343 Ga0207683_10739556 3300026121 Bacteria 912
344 Ga0207428_10003282 3300027907 Bacteria 15733
345 Ga0207428_10026387 3300027907 Bacteria 4849
346 Ga0207428_10130408 3300027907 Bacteria 1924
347 Ga0207428_11169572 3300027907 Bacteria 536
348 Ga0268265_10000887 3300028380 Bacteria 27910
349 Ga0268264_10051956 3300028381 Bacteria 3417
350 Ga0307408_100014020 3300031548 Bacteria 5325
351 Ga0307408_100423817 3300031548 Bacteria 1148
352 Ga0307405_10070098 3300031731 Bacteria 2250
353 Ga0307413_10121866 3300031824 Archaea 1768
354 Ga0307410_10069503 3300031852 Bacteria 2436
355 Ga0307410_10239874 3300031852 Bacteria 1404
356 Ga0307406_10672300 3300031901 Bacteria 862
357 Ga0307407_10004828 3300031903 Bacteria 5778
358 Ga0307407_10007859 3300031903 Bacteria 4858
359 Ga0307409_100039776 3300031995 Bacteria 3493
360 Ga0307409_100042783 3300031995 Archaea 3395
361 Ga0307416_100040088 3300032002 Bacteria 3634
362 Ga0307416_100163715 3300032002 Bacteria 2060
363 Ga0307414_10107278 3300032004 Bacteria 2116
364 Ga0307414_10114799 3300032004 Bacteria 2058
365 Ga0307411_10008422 3300032005 Bacteria 5342
366 Ga0307411_10419377 3300032005 Bacteria 1111
367 Ga0307415_100084460 3300032126 Bacteria 2278
368 Ga0307415_100233357 3300032126 Bacteria 1483
369 Ga0307415_101744869 3300032126 Bacteria 601
370 Ga0373928_0048978 3300035084 Unclassified 992
371 Ga0373949_0018997 3300035090 Bacteria 1562
372 Ga0373939_0221632 3300035114 Unclassified 724
373 Ga0373956_0339303 3300035119 Bacteria 716
374 Ga0373960_0071460 3300035121 Bacteria 1074
375 Ga0373946_0432887 3300035171 Bacteria 668
376 Ga0373961_0030744 3300035241 Unclassified 1496
377 Ga0373931_0028331 3300035691 Bacteria 2867
378 Ga0373935_0277225 3300035692 Bacteria 1180
379 Ga0373933_0311868 3300035724 Bacteria 1019
380 Ga0373937_0055579 3300036401 Bacteria 3634
381 Ga0373937_0061317 3300036401 Bacteria 3457
382 Ga0373925_0261958 3300037068 Bacteria 1389
383 Ga0373925_0540175 3300037068 Bacteria 958
384 Ga0395901_1308635 3300038443 Bacteria 686
385 Ga0439453_0082291 3300041408 Bacteria 696
386 Ga0439461_0112076 3300041410 Unclassified 674
387 Ga0439449_0128146 3300042007 Bacteria 943
388 Ga0439449_0240142 3300042007 Bacteria 680
389 Ga0439446_0109534 3300042156 Bacteria 880
390 Ga0439464_0065642 3300042439 Archaea 1068
391 Ga0451576_0014894 3300045051 Bacteria 8639
392 Ga0451576_0023166 3300045051 Bacteria 6728
393 Ga0451576_0054986 3300045051 Bacteria 4166
394 Ga0451576_0057788 3300045051 Bacteria 4055
395 Ga0451576_0083905 3300045051 Bacteria 3314
396 Ga0451576_0432020 3300045051 Unclassified 1382
397 Ga0495590_0195213 3300046457 Bacteria 743
398 Ga0495580_0354129 3300046472 Bacteria 994
399 Ga0495584_0080153 3300046491 Unclassified 1642
400 Ga0495584_0123597 3300046491 Bacteria 1311
401 Ga0495584_0473579 3300046491 Bacteria 637
402 Ga0495594_0100482 3300046499 Unclassified 1627
403 Ga0495607_0152389 3300046501 Bacteria 1182
404 Ga0495628_0524679 3300046516 Bacteria 853
405 Ga0495644_0154754 3300046523 Unclassified 878
406 Ga0495644_0216395 3300046523 Bacteria 740
407 Ga0495663_0060565 3300046525 Unclassified 1189
408 Ga0495642_0020339 3300046528 Bacteria 2607
409 Ga0495642_0204324 3300046528 Bacteria 861
410 Ga0495642_0442445 3300046528 Unclassified 574
411 Ga0495609_0074920 3300046538 Bacteria 1484
412 Ga0495609_0228639 3300046538 Unclassified 771
413 Ga0495621_0005570 3300046539 Bacteria 3628
414 Ga0495621_0010020 3300046539 Bacteria 2892
415 Ga0495621_0069226 3300046539 Bacteria 1297
416 Ga0495645_0092170 3300046543 Bacteria 2164
417 Ga0495633_0410065 3300046558 Unclassified 613
418 Ga0495656_0163188 3300046615 Bacteria 1084
419 Ga0495659_0003294 3300046664 Bacteria 5177
420 Ga0495659_0011973 3300046664 Bacteria 2800
421 Ga0495659_0023750 3300046664 Bacteria 2086
422 Ga0495659_0039978 3300046664 Bacteria 1669
423 Ga0495588_0004248 3300046674 Bacteria 6319
424 Ga0495658_0071803 3300046683 Bacteria 2012
425 Ga0495669_0013941 3300046684 Bacteria 3432
426 Ga0495669_0025562 3300046684 Bacteria 2575
427 Ga0495670_0446323 3300046691 Bacteria 701
428 Ga0495600_0518803 3300046809 Bacteria 731
429 Ga0495604_0676280 3300047317 Unclassified 657
430 Ga0495636_0003349 3300047318 Bacteria 6213
431 Ga0495636_0145508 3300047318 Unclassified 1061
432 Ga0495680_0442851 3300047322 Bacteria 890
433 Ga0495685_057460 3300047447 Bacteria 1314
434 Ga0495685_168475 3300047447 Bacteria 708
435 Ga0496100_0739870 3300048903 Bacteria 769
436 Ga0496102_1369753 3300048905 Bacteria 626
437 Ga0496106_0028157 3300048909 Bacteria 4185
438 Ga0496107_0256986 3300048910 Bacteria 1300
439 Ga0496109_0356973 3300048912 Bacteria 1381
440 Ga0496111_0798490 3300048914 Bacteria 683
441 Ga0496112_0734312 3300048915 Bacteria 914
442 Ga0496113_0836227 3300048916 Unclassified 730
443 Ga0496114_1260422 3300048917 Archaea 626
444 Ga0501031_0889204 3300049568 Bacteria 570
445 Ga0501036_0084644 3300049572 Bacteria 2681
446 Ga0501038_0435802 3300049574 Bacteria 1010
447 Ga0501039_0320992 3300049575 Bacteria 1217
448 Ga0501039_0343818 3300049575 Archaea 1172
449 Ga0501039_0476332 3300049575 Bacteria 980
450 Ga0501040_0126858 3300049576 Bacteria 1793
451 Ga0501040_0641516 3300049576 Archaea 767
452 Ga0501041_0137055 3300049577 Bacteria 1525
453 Ga0501042_0039283 3300049578 Bacteria 3362
454 Ga0501042_0362733 3300049578 Archaea 1048
455 Ga0501042_0717915 3300049578 Bacteria 727
456 Ga0501046_0090038 3300049580 Bacteria 2361
457 Ga0501046_0331055 3300049580 Unclassified 1108
458 Ga0501046_0475989 3300049580 Archaea 896
459 Ga0501047_0115263 3300049581 Bacteria 2569
460 Ga0501048_0340957 3300049582 Bacteria 1068
461 Ga0501048_0610336 3300049582 Unclassified 783
462 Ga0501067_0094758 3300049583 Unclassified 1657
463 Ga0501069_0114346 3300049585 Unclassified 1539
464 Ga0501069_0375817 3300049585 Archaea 839
465 Ga0501071_0003830 3300049587 Bacteria 9464
466 Ga0501071_0511883 3300049587 Unclassified 921
467 Ga0501072_0034447 3300049588 Bacteria 3969
468 Ga0501072_0108543 3300049588 Bacteria 2208
469 Ga0501072_0272446 3300049588 Bacteria 1347
470 Ga0501072_0612427 3300049588 Bacteria 858
471 Ga0501072_0709460 3300049588 Bacteria 790
472 Ga0501074_0014239 3300049590 Bacteria 5784
473 Ga0501074_0454819 3300049590 Bacteria 908
474 Ga0501075_0088182 3300049591 Bacteria 2352
475 Ga0501075_0121663 3300049591 Bacteria 1986
476 Ga0501075_0365555 3300049591 Bacteria 1100
477 Ga0501075_0396390 3300049591 Bacteria 1052
478 Ga0501076_0543972 3300049592 Bacteria 957
479 Ga0501077_0053054 3300049593 Bacteria 2574
480 Ga0501077_0116053 3300049593 Bacteria 1697
481 Ga0501225_0181129 3300049705 Bacteria 659
482 Ga0501079_0112405 3300049741 Bacteria 2117
483 Ga0501079_0541600 3300049741 Archaea 915
484 Ga0501079_0993666 3300049741 Bacteria 661
485 Ga0501080_0483055 3300049742 Archaea 1108
486 Ga0501080_1387597 3300049742 Bacteria 600
487 Ga0501081_0076917 3300049743 Bacteria 2331
488 Ga0501081_0191474 3300049743 Bacteria 1481
489 Ga0501035_1086127 3300049822 Bacteria 625
490 Ga0501044_1180091 3300049823 Bacteria 634
491 Ga0501045_0005626 3300049824 Bacteria 8677
492 Ga0501045_0112133 3300049824 Bacteria 2022
493 Ga0501045_0302227 3300049824 Bacteria 1191
494 nmdc:mga00v17_11027_c1 3300050491 Bacteria 4956
495 nmdc:mga0yw44_162659_c1 3300050492 Unclassified 1462
496 nmdc:mga0k408_39833_c1 3300050493 Bacteria 2702
497 nmdc:mga06z11_652277_c1 3300050494 Bacteria 641
498 nmdc:mga06z11_6783_c1 3300050494 Bacteria 4679
499 nmdc:mga04h51_66865_c1 3300050495 Unclassified 1246
500 nmdc:mga07m45_14186_c1 3300050496 Bacteria 4239
501 nmdc:mga05p37_1022992_c1 3300050507 Bacteria 875
502 nmdc:mga05p37_11_c1 3300050507 Bacteria 149577
503 nmdc:mga05p37_135828_c1 3300050507 Bacteria 3016
504 nmdc:mga05p37_1442264_c1 3300050507 Bacteria 690
505 nmdc:mga05p37_1831_c1 3300050507 Bacteria 24798
506 nmdc:mga05p37_209847_c1 3300050507 Bacteria 2355
507 nmdc:mga05p37_391207_c1 3300050507 Bacteria 1626
508 nmdc:mga05p37_474931_c1 3300050507 Bacteria 1442
509 nmdc:mga05p37_483318_c1 3300050507 Bacteria 1426
510 nmdc:mga09592_131223_c1 3300050508 Bacteria 2156
511 nmdc:mga09592_433978_c1 3300050508 Bacteria 1134
512 nmdc:mga09592_467066_c1 3300050508 Bacteria 1088
513 nmdc:mga09592_76621_c1 3300050508 Bacteria 2844
514 nmdc:mga0qj67_17094_c1 3300050509 Bacteria 5513
515 nmdc:mga06r32_13881_c1 3300050510 Bacteria 7310
516 nmdc:mga08y16_13369_c1 3300050511 Bacteria 8634
517 nmdc:mga08y16_1409048_c1 3300050511 Unclassified 660
518 nmdc:mga08y16_29115_c1 3300050511 Bacteria 5821
519 nmdc:mga08y16_306240_c1 3300050511 Bacteria 1637
520 nmdc:mga08y16_331061_c1 3300050511 Bacteria 1566
521 nmdc:mga08y16_468569_c1 3300050511 Bacteria 1283
522 nmdc:mga08y16_7473_c1 3300050511 Bacteria 11446
523 nmdc:mga08y16_74883_c1 3300050511 Bacteria 3529
524 nmdc:mga08y16_806578_c1 3300050511 Unclassified 931
525 nmdc:mga0n895_131478_c1 3300050512 Bacteria 2528
526 nmdc:mga0n895_134936_c1 3300050512 Bacteria 2494
527 nmdc:mga0n895_280067_c1 3300050512 Bacteria 1691
528 nmdc:mga0n895_348295_c1 3300050512 Bacteria 1500
529 nmdc:mga0rr50_16057_c1 3300050513 Bacteria 4960
530 nmdc:mga0rr50_231584_c1 3300050513 Bacteria 1529
531 nmdc:mga0rr50_78403_c1 3300050513 Bacteria 2542
532 nmdc:mga0a205_17772_c1 3300050515 Bacteria 6673
533 nmdc:mga0a205_184646_c2 3300050515 Bacteria 1396
534 nmdc:mga0a205_44075_c1 3300050515 Bacteria 4299
535 nmdc:mga0a205_84978_c1 3300050515 Bacteria 3057
536 nmdc:mga0sz30_108533_c1 3300050516 Unclassified 1215
537 Ga0495601_0072763 3300053077 Bacteria 2196
538 Ga0495595_0220667 3300053084 Bacteria 946
539 Ga0501084_0018804 3300054114 Bacteria 5752
540 Ga0501084_0242449 3300054114 Unclassified 1521
541 Ga0590071_000449 3300059421 Bacteria 11961
542 Ga0590075_001979 3300059424 Bacteria 4956
543 Ga0590077_000057 3300059426 Bacteria 27217
544 Ga0501082_0068607 3300060353 Bacteria 3053
545 Ga0501082_0232969 3300060353 Bacteria 1603
546 Ga0530510_0001838 3300061734 Bacteria 14505
547 Ga0530510_0497847 3300061734 Bacteria 924
548 Ga0070706_100980032
549 JGI24751J29686_10067699
550 Ga0065704_10100033
551 Ga0065704_10180109
552 Ga0065712_10090193
553 Ga0065715_10103335
554 Ga0065707_10203407
555 Ga0065707_10746466
556 Ga0070676_10063417
557 Ga0070676_10422367
558 Ga0070683_100095946
559 Ga0070683_100455478
560 Ga0070683_100548268
561 Ga0070690_100283298
562 Ga0070690_100689043
563 Ga0070670_100002451
564 Ga0070670_100023207
565 Ga0070670_100211254
566 Ga0070670_100255633
567 Ga0070670_101895125
568 Ga0070666_10166757
569 Ga0070666_10263674
570 Ga0070666_10439772
571 Ga0070680_100150761
572 Ga0070680_100178794
573 Ga0070680_100440945
574 Ga0070680_100954657
575 Ga0068868_101390895
576 Ga0070689_100007697
577 Ga0070689_100040857
578 Ga0070689_100319374
579 Ga0070689_100374634
580 Ga0070691_10016935
581 Ga0070691_10070953
582 Ga0070687_100003597
583 Ga0070661_100333852
584 Ga0070661_101153296
585 Ga0070692_10006258
586 Ga0070692_10239634
587 Ga0070668_100028798
588 Ga0070669_100020423
589 Ga0070675_100005411
590 Ga0070675_100060315
591 Ga0070675_100079908
592 Ga0070675_100563573
593 Ga0070671_100021077
594 Ga0070671_100487219
595 Ga0070674_100356615
596 Ga0070673_100010171
597 Ga0070673_100035583
598 Ga0070673_100083414
599 Ga0070673_100229397
600 Ga0070673_100274568
601 Ga0070673_101012747
602 Ga0070673_101463331
603 Ga0070673_101467258
604 Ga0070688_100017992
605 Ga0070688_100443582
606 Ga0070688_100488606
607 Ga0070659_100818387
608 Ga0070667_100876698
609 Ga0070713_100061352
610 Ga0070705_100008158
611 Ga0070705_100010279
612 Ga0070705_100030698
613 Ga0070705_100094064
614 Ga0070705_100242397
615 Ga0070705_100682219
616 Ga0070700_100045566
617 Ga0070700_100079708
618 Ga0070700_100520240
619 Ga0070700_100741926
620 Ga0070694_100003855
621 Ga0070694_100036631
622 Ga0070694_100065929
623 Ga0070694_100080022
624 Ga0070694_100162559
625 Ga0070694_100422446
626 Ga0070708_100178953
627 Ga0070708_101270849
628 Ga0070663_100372006
629 Ga0070678_100502682
630 Ga0070678_100829736
631 Ga0070662_100558058
632 Ga0070681_10014498
633 Ga0070681_11485036
634 Ga0068867_100012627
635 Ga0068867_100024981
636 Ga0070685_10070575
637 Ga0070685_10148832
638 Ga0070685_10152478
639 Ga0070707_100087504
640 Ga0070707_100171766
641 Ga0070707_101552278
642 Ga0070698_100001361
643 Ga0070698_100061413
644 Ga0070698_100138225
645 Ga0070699_100016886
646 Ga0070699_100113485
647 Ga0070699_100163343
648 Ga0070699_100653742
649 Ga0070679_100969418
650 Ga0070684_100233942
651 Ga0070697_100011740
652 Ga0070697_100104356
653 Ga0070672_100018000
654 Ga0070672_100053346
655 Ga0070672_100098462
656 Ga0070672_100139244
657 Ga0070672_100344544
658 Ga0070695_100005101
659 Ga0070695_100015572
660 Ga0070695_100125899
661 Ga0070695_100812563
662 Ga0070696_100065393
663 Ga0070696_100065866
664 Ga0070696_100069406
665 Ga0070696_100388883
666 Ga0070693_100396202
667 Ga0070704_100003039
668 Ga0070704_100037136
669 Ga0070704_100043293
670 Ga0070704_100046514
671 Ga0070704_100061459
672 Ga0070704_100269355
673 Ga0070664_100049913
674 Ga0070664_100172510
675 Ga0070664_100384978
676 Ga0070664_100662062
677 Ga0070664_101526972
678 Ga0068857_100051093
679 Ga0068857_100051374
680 Ga0068857_100239775
681 Ga0070702_100000965
682 Ga0070702_100180870
683 Ga0070702_100308688
684 Ga0068852_100557134
685 Ga0068859_100023597
686 Ga0068859_100064783
687 Ga0068859_100071915
688 Ga0068859_100166076
689 Ga0068859_100197247
690 Ga0068864_100083126
691 Ga0068864_100209498
692 Ga0068864_100927353
693 Ga0068866_10768479
694 Ga0068861_100148242
695 Ga0068861_100257421
696 Ga0068870_10045198
697 Ga0068870_10944254
698 Ga0068863_100095079
699 Ga0068858_100121589
700 Ga0068860_100020262
701 Ga0068862_100000965
702 Ga0068862_100218680
703 Ga0068862_100841563
704 Ga0068862_100987930
705 Ga0068862_101199189
706 Ga0081538_10093702
707 Ga0070717_10877320
708 Ga0070712_100258361
709 Ga0097621_100387678
710 Ga0097621_100777198
711 Ga0068871_100170961
712 Ga0068871_100769508
713 Ga0075428_100002389
714 Ga0075428_100032481
715 Ga0075428_100136346
716 Ga0075428_100850620
717 Ga0075430_100136994
718 Ga0075430_100565033
719 Ga0075431_100140280
720 Ga0075433_10057114
721 Ga0075433_10319892
722 Ga0075434_100002227
723 Ga0075434_100026891
724 Ga0075434_100144037
725 Ga0075429_100096361
726 Ga0068865_100135288
727 Ga0068865_100182877
728 Ga0068865_100468511
729 Ga0068865_101218147
730 Ga0068865_101269200
731 Ga0097620_100023597
732 Ga0097620_100064780
733 Ga0097620_100071917
734 Ga0097620_100166064
735 Ga0097620_100197261
736 Ga0097620_100687890
737 Ga0075435_100017622
738 Ga0075435_100096882
739 Ga0075435_100135197
740 Ga0105240_11793162
741 Ga0111539_10000853
742 Ga0111539_10031527
743 Ga0111539_10130395
744 Ga0111539_10167961
745 Ga0111539_10557837
746 Ga0111539_12896408
747 Ga0111539_13198878
748 Ga0105245_10491697
749 Ga0114129_10000511
750 Ga0114129_10005475
751 Ga0114129_10020481
752 Ga0114129_10043525
753 Ga0114129_10068174
754 Ga0114129_10201202
755 Ga0114129_10259051
756 Ga0114129_10471982
757 Ga0114129_11139610
758 Ga0105243_10028803
759 Ga0105243_10117778
760 Ga0105243_10444299
761 Ga0105242_10520967
762 Ga0105248_10745200
763 Ga0105248_11677939
764 Ga0105248_12047608
765 Ga0105249_10012343
766 Ga0105249_11692250
767 Ga0157369_11064926
768 Ga0157374_10266360
769 Ga0157378_10110852
770 Ga0157378_10201344
771 Ga0157378_11750594
772 Ga0163162_10679885
773 Ga0163162_10833364
774 Ga0157375_10146571
775 Ga0157375_10681893
776 Ga0157375_10682464
777 Ga0157375_10758618
778 Ga0157375_12330235
779 Ga0163163_10510177
780 Ga0163163_11293810
781 Ga0157380_10324523
782 Ga0157380_10467797
783 Ga0157380_10699361
784 Ga0157380_10745102
785 Ga0157380_10929530
786 Ga0157377_10018607
787 Ga0157377_10397511
788 Ga0157377_10552774
789 Ga0157379_10783768
790 Ga0157376_10395202
791 Ga0157376_11427817
792 Ga0207642_10022487
793 Ga0207642_10533842
794 Ga0207645_10016706
795 Ga0207645_10258953
796 Ga0207645_10453804
797 Ga0207643_10015908
798 Ga0207643_10158930
799 Ga0207707_10025344
800 Ga0207695_10763843
801 Ga0207693_10164355
802 Ga0207660_10316325
803 Ga0207660_10396689
804 Ga0207660_11196155
805 Ga0207662_10011633
806 Ga0207662_10266536
807 Ga0207657_10318354
808 Ga0207646_10186210
809 Ga0207646_10521168
810 Ga0207681_10015298
811 Ga0207650_10051282
812 Ga0207650_10076907
813 Ga0207650_10142112
814 Ga0207650_10654464
815 Ga0207659_10001023
816 Ga0207659_10059596
817 Ga0207659_10239583
818 Ga0207687_10737430
819 Ga0207687_10886526
820 Ga0207700_10029353
821 Ga0207644_10834280
822 Ga0207690_10091268
823 Ga0207706_10147120
824 Ga0207706_10689770
825 Ga0207686_10217288
826 Ga0207686_10442820
827 Ga0207709_10046225
828 Ga0207709_10063982
829 Ga0207709_10094782
830 Ga0207709_10175055
831 Ga0207709_10697987
832 Ga0207670_10001697
833 Ga0207670_10040480
834 Ga0207670_10092728
835 Ga0207670_10462525
836 Ga0207669_10282113
837 Ga0207704_10101926
838 Ga0207704_10663842
839 Ga0207704_11263555
840 Ga0207691_10003770
841 Ga0207691_10060909
842 Ga0207691_10119089
843 Ga0207691_10387691
844 Ga0207691_10936067
845 Ga0207711_10054570
846 Ga0207711_10275913
847 Ga0207689_10863879
848 Ga0207661_10027456
849 Ga0207661_10490397
850 Ga0207679_10012106
851 Ga0207679_10075054
852 Ga0207679_10258515
853 Ga0207679_11633713
854 Ga0207667_10443823
855 Ga0207667_10776711
856 Ga0207651_10027096
857 Ga0207651_10081179
858 Ga0207651_10101568
859 Ga0207651_10375768
860 Ga0207651_10818722
861 Ga0207651_11290584
862 Ga0207712_10061818
863 Ga0207712_10130364
864 Ga0207668_10070061
865 Ga0207668_10152761
866 Ga0207640_10134317
867 Ga0207658_11463816
868 Ga0207677_10431320
869 Ga0207703_10035522
870 Ga0207703_10449211
871 Ga0207708_10052834
872 Ga0207708_10121474
873 Ga0207708_11083780
874 Ga0207641_10728989
875 Ga0207641_10732172
876 Ga0207641_11182112
877 Ga0207648_10003593
878 Ga0207648_10010521
879 Ga0207648_10472408
880 Ga0207676_10006494
881 Ga0207676_10130975
882 Ga0207676_10142568
883 Ga0207676_10860020
884 Ga0207674_10002363
885 Ga0207674_10070658
886 Ga0207675_100018350
887 Ga0207675_100123180
888 Ga0207675_100439318
889 Ga0207683_10162585
890 Ga0207683_10739556
891 Ga0207428_10003282
892 Ga0207428_10026387
893 Ga0207428_10130408
894 Ga0207428_11169572
895 Ga0268265_10000887
896 Ga0268264_10051956
897 Ga0307408_100014020
898 Ga0307408_100423817
899 Ga0307405_10070098
900 Ga0307413_10121866
901 Ga0307410_10069503
902 Ga0307410_10239874
903 Ga0307406_10672300
904 Ga0307407_10004828
905 Ga0307407_10007859
906 Ga0307409_100039776
907 Ga0307409_100042783
908 Ga0307416_100040088
909 Ga0307416_100163715
910 Ga0307414_10107278
911 Ga0307414_10114799
912 Ga0307411_10008422
913 Ga0307411_10419377
914 Ga0307415_100084460
915 Ga0307415_100233357
916 Ga0307415_101744869
917 Ga0373928_0048978
918 Ga0373949_0018997
919 Ga0373939_0221632
920 Ga0373956_0339303
921 Ga0373960_0071460
922 Ga0373946_0432887
923 Ga0373961_0030744
924 Ga0373931_0028331
925 Ga0373935_0277225
926 Ga0373933_0311868
927 Ga0373937_0055579
928 Ga0373937_0061317
929 Ga0373925_0261958
930 Ga0373925_0540175
931 Ga0395901_1308635
932 Ga0439453_0082291
933 Ga0439461_0112076
934 Ga0439449_0128146
935 Ga0439449_0240142
936 Ga0439446_0109534
937 Ga0439464_0065642
938 Ga0451576_0014894
939 Ga0451576_0023166
940 Ga0451576_0054986
941 Ga0451576_0057788
942 Ga0451576_0083905
943 Ga0451576_0432020
944 Ga0495590_0195213
945 Ga0495580_0354129
946 Ga0495584_0080153
947 Ga0495584_0123597
948 Ga0495584_0473579
949 Ga0495594_0100482
950 Ga0495607_0152389
951 Ga0495628_0524679
952 Ga0495644_0154754
953 Ga0495644_0216395
954 Ga0495663_0060565
955 Ga0495642_0020339
956 Ga0495642_0204324
957 Ga0495642_0442445
958 Ga0495609_0074920
959 Ga0495609_0228639
960 Ga0495621_0005570
961 Ga0495621_0010020
962 Ga0495621_0069226
963 Ga0495645_0092170
964 Ga0495633_0410065
965 Ga0495656_0163188
966 Ga0495659_0003294
967 Ga0495659_0011973
968 Ga0495659_0023750
969 Ga0495659_0039978
970 Ga0495588_0004248
971 Ga0495658_0071803
972 Ga0495669_0013941
973 Ga0495669_0025562
974 Ga0495670_0446323
975 Ga0495600_0518803
976 Ga0495604_0676280
977 Ga0495636_0003349
978 Ga0495636_0145508
979 Ga0495680_0442851
980 Ga0495685_057460
981 Ga0495685_168475
982 Ga0496100_0739870
983 Ga0496102_1369753
984 Ga0496106_0028157
985 Ga0496107_0256986
986 Ga0496109_0356973
987 Ga0496111_0798490
988 Ga0496112_0734312
989 Ga0496113_0836227
990 Ga0496114_1260422
991 Ga0501031_0889204
992 Ga0501036_0084644
993 Ga0501038_0435802
994 Ga0501039_0320992
995 Ga0501039_0343818
996 Ga0501039_0476332
997 Ga0501040_0126858
998 Ga0501040_0641516
999 Ga0501041_0137055
1000 Ga0501042_0039283
1001 Ga0501042_0362733
1002 Ga0501042_0717915
1003 Ga0501046_0090038
1004 Ga0501046_0331055
1005 Ga0501046_0475989
1006 Ga0501047_0115263
1007 Ga0501048_0340957
1008 Ga0501048_0610336
1009 Ga0501067_0094758
1010 Ga0501069_0114346
1011 Ga0501069_0375817
1012 Ga0501071_0003830
1013 Ga0501071_0511883
1014 Ga0501072_0034447
1015 Ga0501072_0108543
1016 Ga0501072_0272446
1017 Ga0501072_0612427
1018 Ga0501072_0709460
1019 Ga0501074_0014239
1020 Ga0501074_0454819
1021 Ga0501075_0088182
1022 Ga0501075_0121663
1023 Ga0501075_0365555
1024 Ga0501075_0396390
1025 Ga0501076_0543972
1026 Ga0501077_0053054
1027 Ga0501077_0116053
1028 Ga0501225_0181129
1029 Ga0501079_0112405
1030 Ga0501079_0541600
1031 Ga0501079_0993666
1032 Ga0501080_0483055
1033 Ga0501080_1387597
1034 Ga0501081_0076917
1035 Ga0501081_0191474
1036 Ga0501035_1086127
1037 Ga0501044_1180091
1038 Ga0501045_0005626
1039 Ga0501045_0112133
1040 Ga0501045_0302227
1041 nmdc:mga00v17_11027_c1
1042 nmdc:mga0yw44_162659_c1
1043 nmdc:mga0k408_39833_c1
1044 nmdc:mga06z11_652277_c1
1045 nmdc:mga06z11_6783_c1
1046 nmdc:mga04h51_66865_c1
1047 nmdc:mga07m45_14186_c1
1048 nmdc:mga05p37_1022992_c1
1049 nmdc:mga05p37_11_c1
1050 nmdc:mga05p37_135828_c1
1051 nmdc:mga05p37_1442264_c1
1052 nmdc:mga05p37_1831_c1
1053 nmdc:mga05p37_209847_c1
1054 nmdc:mga05p37_391207_c1
1055 nmdc:mga05p37_474931_c1
1056 nmdc:mga05p37_483318_c1
1057 nmdc:mga09592_131223_c1
1058 nmdc:mga09592_433978_c1
1059 nmdc:mga09592_467066_c1
1060 nmdc:mga09592_76621_c1
1061 nmdc:mga0qj67_17094_c1
1062 nmdc:mga06r32_13881_c1
1063 nmdc:mga08y16_13369_c1
1064 nmdc:mga08y16_1409048_c1
1065 nmdc:mga08y16_29115_c1
1066 nmdc:mga08y16_306240_c1
1067 nmdc:mga08y16_331061_c1
1068 nmdc:mga08y16_468569_c1
1069 nmdc:mga08y16_7473_c1
1070 nmdc:mga08y16_74883_c1
1071 nmdc:mga08y16_806578_c1
1072 nmdc:mga0n895_131478_c1
1073 nmdc:mga0n895_134936_c1
1074 nmdc:mga0n895_280067_c1
1075 nmdc:mga0n895_348295_c1
1076 nmdc:mga0rr50_16057_c1
1077 nmdc:mga0rr50_231584_c1
1078 nmdc:mga0rr50_78403_c1
1079 nmdc:mga0a205_17772_c1
1080 nmdc:mga0a205_184646_c2
1081 nmdc:mga0a205_44075_c1
1082 nmdc:mga0a205_84978_c1
1083 nmdc:mga0sz30_108533_c1
1084 Ga0495601_0072763
1085 Ga0495595_0220667
1086 Ga0501084_0018804
1087 Ga0501084_0242449
1088 Ga0590071_000449
1089 Ga0590075_001979
1090 Ga0590077_000057
1091 Ga0501082_0068607
1092 Ga0501082_0232969
1093 Ga0530510_0001838
1094 Ga0530510_0497847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

20

109

0.91

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

3

114

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.9095 36 159
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8834 24 159
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8803 34 156
7p8p-assembly2.cif.gz_C crystal structure of fhit covalently bound to a nucleotide 0.8713 35 157
2fhi-assembly1.cif.gz_A-2 substrate analog (ib2) complex with the his 96 asn substitution of the fragile histidine triad protein, fhit 0.8704 35 157
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9312 34 125 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9143 36 128 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8811 21 128 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8713 21 133 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8704 35 157 3.30.428.10
ID Description Score Start End GO Terms
AF-Q22HE6-F1-model_v4 Bis(5'-adenosyl)-triphosphatase 0.9056 35 132 GO:0003824
AF-A0A7W0LFT2-F1-model_v4 HIT domain-containing protein 0.9011 40 161 GO:0000166
GO:0003824
AF-A0A3N5SMP7-F1-model_v4 deleted 0.8956 38 162
AF-A0A094PQD8-F1-model_v4 HIT domain-containing protein 0.8903 36 159 GO:0000166
GO:0003824
AF-A0A1H2AMV7-F1-model_v4 Diadenosine tetraphosphate (Ap4A) hydrolase 0.8899 5 161 GO:0000166
GO:0016787

Map