F462073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 547 | 236 | 545 | 496 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100151973|Ga0070678_1001519732 |
| Length | 481 |
| Sequence | MPDKPNILVIWGDDIGITNLSCYSDGLMGYRTPNIDRIANEGMRFTDSYGEQSCTEDPTIAELLKNHGYATAQFGKNHLGDKNEFLPTVHGFDEFYGNLYHLNAEEDPEDPDYXEKHGFEQFRERFGPRGVLRCRATSKDDPKEHPRWGRIGKQRIEDTGPLTRKRMETCDDDFADTACDYIQRQHNRRKPFFCWVNFTHMHLRTHTKRRSLGQAGRWQSPYHDTMIDHDRNVGQLLDLLDRLGIAEDTIVLYGTDNGPHMNSWPDGAMTPFRSEKNTNWEGAFRVPQLVRWPGKIPAGVVSNEIVQLHDWLPTFLAAAGEPDVVEKLKEGHEAAGKTFKVHIDGYNLLPYLTGEESESPRKGFIYFSDDGDLVALRFDNWKLVFMEQRARGTLELWAEPFVPLRVPKLFNLRTDPFERADTTSNTYWDWYISKAYLIMAAQALVTDFLATFRDFPPRQKAASFTIDQALERMQDAAVGHH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 3 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 178 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 189 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 234 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 8.23 |
| Rhizosphere | 89.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2292377 | 2162886007 | Bacteria | 24756 |
| 2 | SwRhRL2b_contig_773127 | 2162886007 | Bacteria | 225549 |
| 3 | JGI24737J22298_10016553 | 3300001990 | Bacteria | 2380 |
| 4 | JGI24743J22301_10007685 | 3300001991 | Bacteria | 1876 |
| 5 | JGI24744J21845_10002141 | 3300002077 | Bacteria | 4011 |
| 6 | Ga0058862_10101856 | 3300004803 | Bacteria | 1880 |
| 7 | Ga0065704_10070132 | 3300005289 | Bacteria | 1955461 |
| 8 | Ga0065707_10006674 | 3300005295 | Bacteria | 2708 |
| 9 | Ga0065707_10095396 | 3300005295 | Bacteria | 3383 |
| 10 | Ga0070683_100001559 | 3300005329 | Bacteria | 17711 |
| 11 | Ga0070670_100000035 | 3300005331 | Bacteria | 157570 |
| 12 | Ga0070670_100128030 | 3300005331 | Bacteria | 2191 |
| 13 | Ga0070670_100189888 | 3300005331 | Bacteria | 1784 |
| 14 | Ga0068869_100011023 | 3300005334 | Bacteria | 5921 |
| 15 | Ga0068869_100134972 | 3300005334 | Bacteria | 1900 |
| 16 | Ga0070680_100006439 | 3300005336 | Bacteria | 8922 |
| 17 | Ga0070680_100023379 | 3300005336 | Bacteria | 4929 |
| 18 | Ga0070680_100024773 | 3300005336 | Bacteria | 4796 |
| 19 | Ga0070682_100008990 | 3300005337 | Bacteria | 5645 |
| 20 | Ga0070682_100059009 | 3300005337 | Bacteria | 2421 |
| 21 | Ga0068868_100020539 | 3300005338 | Bacteria | 4965 |
| 22 | Ga0068868_100033147 | 3300005338 | Bacteria | 3979 |
| 23 | Ga0070689_100026191 | 3300005340 | Bacteria | 4389 |
| 24 | Ga0070691_10007311 | 3300005341 | Bacteria | 5056 |
| 25 | Ga0070687_100014731 | 3300005343 | Bacteria | 3520 |
| 26 | Ga0070661_100011619 | 3300005344 | Bacteria | 6138 |
| 27 | Ga0070661_100023704 | 3300005344 | Bacteria | 4401 |
| 28 | Ga0070668_100003075 | 3300005347 | Bacteria | 12336 |
| 29 | Ga0070668_100073071 | 3300005347 | Bacteria | 2673 |
| 30 | Ga0070668_100140924 | 3300005347 | Bacteria | 1943 |
| 31 | Ga0070675_100020625 | 3300005354 | Bacteria | 5259 |
| 32 | Ga0070675_100038923 | 3300005354 | Bacteria | 3878 |
| 33 | Ga0070675_100050339 | 3300005354 | Bacteria | 3420 |
| 34 | Ga0070671_100002658 | 3300005355 | Bacteria | 13844 |
| 35 | Ga0070671_100014978 | 3300005355 | Bacteria | 6261 |
| 36 | Ga0070671_100024450 | 3300005355 | Bacteria | 4945 |
| 37 | Ga0070673_100039134 | 3300005364 | Bacteria | 3627 |
| 38 | Ga0070673_100065309 | 3300005364 | Bacteria | 2902 |
| 39 | Ga0070688_100000851 | 3300005365 | Bacteria | 15140 |
| 40 | Ga0070659_100053978 | 3300005366 | Bacteria | 3164 |
| 41 | Ga0070667_100001410 | 3300005367 | Bacteria | 21500 |
| 42 | Ga0070714_100148428 | 3300005435 | Bacteria | 2110 |
| 43 | Ga0070701_10008959 | 3300005438 | Bacteria | 4359 |
| 44 | Ga0070701_10033744 | 3300005438 | Bacteria | 2559 |
| 45 | Ga0070705_100013186 | 3300005440 | Bacteria | 4222 |
| 46 | Ga0070705_100043317 | 3300005440 | Bacteria | 2578 |
| 47 | Ga0070663_100026651 | 3300005455 | Bacteria | 3917 |
| 48 | Ga0070663_100099423 | 3300005455 | Bacteria | 2169 |
| 49 | Ga0070678_100023729 | 3300005456 | Bacteria | 4093 |
| 50 | Ga0070678_100147925 | 3300005456 | Bacteria | 1888 |
| 51 | Ga0070678_100151973 | 3300005456 | Bacteria | 1866 |
| 52 | Ga0070662_100003735 | 3300005457 | Bacteria | 9529 |
| 53 | Ga0070681_10000470 | 3300005458 | Bacteria | 32838 |
| 54 | Ga0070681_10002312 | 3300005458 | Bacteria | 17416 |
| 55 | Ga0070681_10005785 | 3300005458 | Bacteria | 11960 |
| 56 | Ga0070681_10032056 | 3300005458 | Bacteria | 5275 |
| 57 | Ga0070681_10045567 | 3300005458 | Bacteria | 4387 |
| 58 | Ga0070681_10117690 | 3300005458 | Bacteria | 2594 |
| 59 | Ga0068867_100010668 | 3300005459 | Bacteria | 6482 |
| 60 | Ga0070685_10008294 | 3300005466 | Bacteria | 5334 |
| 61 | Ga0070679_100003126 | 3300005530 | Bacteria | 15138 |
| 62 | Ga0070679_100003849 | 3300005530 | Bacteria | 13785 |
| 63 | Ga0070679_100009421 | 3300005530 | Bacteria | 9234 |
| 64 | Ga0070679_100046317 | 3300005530 | Bacteria | 4334 |
| 65 | Ga0070684_100010414 | 3300005535 | Bacteria | 7367 |
| 66 | Ga0070684_100017772 | 3300005535 | Bacteria | 5843 |
| 67 | Ga0070684_100048841 | 3300005535 | Bacteria | 3671 |
| 68 | Ga0068853_100057951 | 3300005539 | Bacteria | 3343 |
| 69 | Ga0070672_100067392 | 3300005543 | Bacteria | 2836 |
| 70 | Ga0070696_100121238 | 3300005546 | Bacteria | 1893 |
| 71 | Ga0070693_100009124 | 3300005547 | Bacteria | 4923 |
| 72 | Ga0070693_100010027 | 3300005547 | Bacteria | 4728 |
| 73 | Ga0070693_100023508 | 3300005547 | Bacteria | 3295 |
| 74 | Ga0070665_100009895 | 3300005548 | Bacteria | 9641 |
| 75 | Ga0070665_100016403 | 3300005548 | Bacteria | 7429 |
| 76 | Ga0070665_100030121 | 3300005548 | Bacteria | 5460 |
| 77 | Ga0070665_100219508 | 3300005548 | Bacteria | 1902 |
| 78 | Ga0070664_100028869 | 3300005564 | Bacteria | 4620 |
| 79 | Ga0070664_100125189 | 3300005564 | Bacteria | 2253 |
| 80 | Ga0068857_100012211 | 3300005577 | Bacteria | 7472 |
| 81 | Ga0068857_100097540 | 3300005577 | Bacteria | 2635 |
| 82 | Ga0068852_100035821 | 3300005616 | Bacteria | 4144 |
| 83 | Ga0068859_100015032 | 3300005617 | Bacteria | 7771 |
| 84 | Ga0068859_100026120 | 3300005617 | Bacteria | 5858 |
| 85 | Ga0068859_100102151 | 3300005617 | Bacteria | 2925 |
| 86 | Ga0068859_100107117 | 3300005617 | Bacteria | 2855 |
| 87 | Ga0068859_100246739 | 3300005617 | Bacteria | 1875 |
| 88 | Ga0068864_100001144 | 3300005618 | Bacteria | 22133 |
| 89 | Ga0068864_100224261 | 3300005618 | Bacteria | 1735 |
| 90 | Ga0068866_10053487 | 3300005718 | Bacteria | 2064 |
| 91 | Ga0068861_100069056 | 3300005719 | Bacteria | 2732 |
| 92 | Ga0068861_100085247 | 3300005719 | Bacteria | 2481 |
| 93 | Ga0068861_100096551 | 3300005719 | Bacteria | 2342 |
| 94 | Ga0068861_100132345 | 3300005719 | Bacteria | 2025 |
| 95 | Ga0068851_10007861 | 3300005834 | Bacteria | 4911 |
| 96 | Ga0068851_10022236 | 3300005834 | Bacteria | 3086 |
| 97 | Ga0068870_10007317 | 3300005840 | Bacteria | 4919 |
| 98 | Ga0068870_10041983 | 3300005840 | Bacteria | 2379 |
| 99 | Ga0068863_100002037 | 3300005841 | Bacteria | 20029 |
| 100 | Ga0068863_100008569 | 3300005841 | Bacteria | 9993 |
| 101 | Ga0068863_100064641 | 3300005841 | Bacteria | 3460 |
| 102 | Ga0068858_100019078 | 3300005842 | Bacteria | 6414 |
| 103 | Ga0068858_100022804 | 3300005842 | Bacteria | 5839 |
| 104 | Ga0068858_100056067 | 3300005842 | Bacteria | 3643 |
| 105 | Ga0068858_100088189 | 3300005842 | Bacteria | 2886 |
| 106 | Ga0068860_100001374 | 3300005843 | Bacteria | 26435 |
| 107 | Ga0068860_100040544 | 3300005843 | Bacteria | 4449 |
| 108 | Ga0068860_100080540 | 3300005843 | Bacteria | 3096 |
| 109 | Ga0068862_100000368 | 3300005844 | Bacteria | 48907 |
| 110 | Ga0068862_100010849 | 3300005844 | Bacteria | 7522 |
| 111 | Ga0068862_100145198 | 3300005844 | Bacteria | 2108 |
| 112 | Ga0081455_10005039 | 3300005937 | Bacteria | 14596 |
| 113 | Ga0081455_10026745 | 3300005937 | Bacteria | 5297 |
| 114 | Ga0081540_1000597 | 3300005983 | Bacteria | 34582 |
| 115 | Ga0081540_1001789 | 3300005983 | Bacteria | 18022 |
| 116 | Ga0081540_1012407 | 3300005983 | Bacteria | 5615 |
| 117 | Ga0081540_1034901 | 3300005983 | Bacteria | 2704 |
| 118 | Ga0081539_10012088 | 3300005985 | Bacteria | 6708 |
| 119 | Ga0070717_10005329 | 3300006028 | Bacteria | 9374 |
| 120 | Ga0075365_10092976 | 3300006038 | Bacteria | 2056 |
| 121 | Ga0075364_10013247 | 3300006051 | Bacteria | 5062 |
| 122 | Ga0075432_10000128 | 3300006058 | Bacteria | 17320 |
| 123 | Ga0075432_10000401 | 3300006058 | Bacteria | 12654 |
| 124 | Ga0075370_10044474 | 3300006353 | Bacteria | 2510 |
| 125 | Ga0068871_100072247 | 3300006358 | Bacteria | 2841 |
| 126 | Ga0075428_100001080 | 3300006844 | Bacteria | 28982 |
| 127 | Ga0075428_100012937 | 3300006844 | Bacteria | 9282 |
| 128 | Ga0075428_100049422 | 3300006844 | Bacteria | 4614 |
| 129 | Ga0075428_100151039 | 3300006844 | Bacteria | 2523 |
| 130 | Ga0075430_100000100 | 3300006846 | Bacteria | 51326 |
| 131 | Ga0075430_100004032 | 3300006846 | Bacteria | 12389 |
| 132 | Ga0075430_100020890 | 3300006846 | Bacteria | 5567 |
| 133 | Ga0075430_100077355 | 3300006846 | Bacteria | 2789 |
| 134 | Ga0075431_100002899 | 3300006847 | Bacteria | 16590 |
| 135 | Ga0075431_100025609 | 3300006847 | Bacteria | 6047 |
| 136 | Ga0075431_100048484 | 3300006847 | Bacteria | 4381 |
| 137 | Ga0075431_100091632 | 3300006847 | Bacteria | 3137 |
| 138 | Ga0075431_100197330 | 3300006847 | Bacteria | 2060 |
| 139 | Ga0075433_10000223 | 3300006852 | Bacteria | 32380 |
| 140 | Ga0075433_10000850 | 3300006852 | Bacteria | 21451 |
| 141 | Ga0075433_10163010 | 3300006852 | Bacteria | 1984 |
| 142 | Ga0075433_10163761 | 3300006852 | Bacteria | 1979 |
| 143 | Ga0075434_100000419 | 3300006871 | Bacteria | 31470 |
| 144 | Ga0075434_100001545 | 3300006871 | Bacteria | 19487 |
| 145 | Ga0075434_100002360 | 3300006871 | Bacteria | 16536 |
| 146 | Ga0075434_100078755 | 3300006871 | Bacteria | 3292 |
| 147 | Ga0075434_100120955 | 3300006871 | Bacteria | 2634 |
| 148 | Ga0075434_100178340 | 3300006871 | Bacteria | 2144 |
| 149 | Ga0075434_100207380 | 3300006871 | Bacteria | 1981 |
| 150 | Ga0075434_100252333 | 3300006871 | Bacteria | 1783 |
| 151 | Ga0075429_100039287 | 3300006880 | Bacteria | 4119 |
| 152 | Ga0075429_100043016 | 3300006880 | Bacteria | 3930 |
| 153 | Ga0075429_100145637 | 3300006880 | Bacteria | 2073 |
| 154 | Ga0075436_100016001 | 3300006914 | Bacteria | 5135 |
| 155 | Ga0075436_100021410 | 3300006914 | Bacteria | 4439 |
| 156 | Ga0097620_100015032 | 3300006931 | Bacteria | 7771 |
| 157 | Ga0097620_100026120 | 3300006931 | Bacteria | 5858 |
| 158 | Ga0097620_100102151 | 3300006931 | Bacteria | 2925 |
| 159 | Ga0097620_100107110 | 3300006931 | Bacteria | 2855 |
| 160 | Ga0097620_100246764 | 3300006931 | Bacteria | 1875 |
| 161 | Ga0075435_100001108 | 3300007076 | Bacteria | 17154 |
| 162 | Ga0075435_100020797 | 3300007076 | Bacteria | 5036 |
| 163 | Ga0075435_100034251 | 3300007076 | Bacteria | 4023 |
| 164 | Ga0111539_10003119 | 3300009094 | Bacteria | 21952 |
| 165 | Ga0111539_10016101 | 3300009094 | Bacteria | 9278 |
| 166 | Ga0111539_10071752 | 3300009094 | Bacteria | 4086 |
| 167 | Ga0111539_10136153 | 3300009094 | Bacteria | 2876 |
| 168 | Ga0111539_10144765 | 3300009094 | Bacteria | 2782 |
| 169 | Ga0111539_10161993 | 3300009094 | Bacteria | 2616 |
| 170 | Ga0105245_10006615 | 3300009098 | Bacteria | 10180 |
| 171 | Ga0105245_10016616 | 3300009098 | Bacteria | 6423 |
| 172 | Ga0105245_10034154 | 3300009098 | Bacteria | 4510 |
| 173 | Ga0105245_10038926 | 3300009098 | Bacteria | 4232 |
| 174 | Ga0105245_10174136 | 3300009098 | Bacteria | 2051 |
| 175 | Ga0105245_10243457 | 3300009098 | Bacteria | 1744 |
| 176 | Ga0105247_10003873 | 3300009101 | Bacteria | 9682 |
| 177 | Ga0114129_10003344 | 3300009147 | Bacteria | 22531 |
| 178 | Ga0114129_10008045 | 3300009147 | Bacteria | 15023 |
| 179 | Ga0114129_10048945 | 3300009147 | Bacteria | 5941 |
| 180 | Ga0114129_10111059 | 3300009147 | Bacteria | 3783 |
| 181 | Ga0114129_10194162 | 3300009147 | Bacteria | 2754 |
| 182 | Ga0114129_10207959 | 3300009147 | Bacteria | 2647 |
| 183 | Ga0114129_10228265 | 3300009147 | Bacteria | 2508 |
| 184 | Ga0105243_10033221 | 3300009148 | Bacteria | 3989 |
| 185 | Ga0105243_10043700 | 3300009148 | Bacteria | 3512 |
| 186 | Ga0105241_10007822 | 3300009174 | Bacteria | 7862 |
| 187 | Ga0105242_10007684 | 3300009176 | Bacteria | 8297 |
| 188 | Ga0105242_10041059 | 3300009176 | Bacteria | 3729 |
| 189 | Ga0105248_10007747 | 3300009177 | Bacteria | 11793 |
| 190 | Ga0105248_10157208 | 3300009177 | Bacteria | 2565 |
| 191 | Ga0105237_10012749 | 3300009545 | Bacteria | 8841 |
| 192 | Ga0105238_10015667 | 3300009551 | Bacteria | 7674 |
| 193 | Ga0105238_10034047 | 3300009551 | Bacteria | 5184 |
| 194 | Ga0105238_10083586 | 3300009551 | Bacteria | 3182 |
| 195 | Ga0105249_10000525 | 3300009553 | Bacteria | 35250 |
| 196 | Ga0105249_10009115 | 3300009553 | Bacteria | 8679 |
| 197 | Ga0105249_10042752 | 3300009553 | Bacteria | 4122 |
| 198 | Ga0105249_10104628 | 3300009553 | Bacteria | 2667 |
| 199 | Ga0105239_10011907 | 3300010375 | Bacteria | 9703 |
| 200 | Ga0105239_10071410 | 3300010375 | Bacteria | 3814 |
| 201 | Ga0105246_10011537 | 3300011119 | Bacteria | 5485 |
| 202 | Ga0105246_10115491 | 3300011119 | Bacteria | 1980 |
| 203 | Ga0157373_10007041 | 3300013100 | Bacteria | 8379 |
| 204 | Ga0157370_10003313 | 3300013104 | Bacteria | 18970 |
| 205 | Ga0157370_10016021 | 3300013104 | Bacteria | 7604 |
| 206 | Ga0157374_10021287 | 3300013296 | Bacteria | 5767 |
| 207 | Ga0157378_10054182 | 3300013297 | Bacteria | 3571 |
| 208 | Ga0157378_10069459 | 3300013297 | Bacteria | 3160 |
| 209 | Ga0157378_10193385 | 3300013297 | Bacteria | 1920 |
| 210 | Ga0163162_10010790 | 3300013306 | Bacteria | 8888 |
| 211 | Ga0163162_10084510 | 3300013306 | Bacteria | 3249 |
| 212 | Ga0163162_10208355 | 3300013306 | Bacteria | 2084 |
| 213 | Ga0163162_10242808 | 3300013306 | Bacteria | 1932 |
| 214 | Ga0157372_10034001 | 3300013307 | Bacteria | 5601 |
| 215 | Ga0157372_10043990 | 3300013307 | Bacteria | 4947 |
| 216 | Ga0157372_10070507 | 3300013307 | Bacteria | 3932 |
| 217 | Ga0157375_10020699 | 3300013308 | Bacteria | 6017 |
| 218 | Ga0157375_10194723 | 3300013308 | Bacteria | 2182 |
| 219 | Ga0163163_10066573 | 3300014325 | Bacteria | 3578 |
| 220 | Ga0163163_10086840 | 3300014325 | Bacteria | 3137 |
| 221 | Ga0182008_10002548 | 3300014497 | Bacteria | 11356 |
| 222 | Ga0157377_10038926 | 3300014745 | Bacteria | 2628 |
| 223 | Ga0157377_10084616 | 3300014745 | Bacteria | 1861 |
| 224 | Ga0157379_10003228 | 3300014968 | Bacteria | 13814 |
| 225 | Ga0157379_10125602 | 3300014968 | Bacteria | 2308 |
| 226 | Ga0182007_10002312 | 3300015262 | Bacteria | 9577 |
| 227 | Ga0163161_10078448 | 3300017792 | Bacteria | 2427 |
| 228 | Ga0163161_10116702 | 3300017792 | Bacteria | 2001 |
| 229 | Ga0213875_10001707 | 3300021388 | Bacteria | 13798 |
| 230 | Ga0207656_10008776 | 3300025321 | Bacteria | 3736 |
| 231 | Ga0207656_10051971 | 3300025321 | Bacteria | 1773 |
| 232 | Ga0207710_10002117 | 3300025900 | Bacteria | 9378 |
| 233 | Ga0207710_10018775 | 3300025900 | Bacteria | 2943 |
| 234 | Ga0207688_10013532 | 3300025901 | Bacteria | 4434 |
| 235 | Ga0207688_10084053 | 3300025901 | Bacteria | 1821 |
| 236 | Ga0207699_10028116 | 3300025906 | Bacteria | 3121 |
| 237 | Ga0207645_10036558 | 3300025907 | Bacteria | 3153 |
| 238 | Ga0207645_10076671 | 3300025907 | Bacteria | 2141 |
| 239 | Ga0207643_10000243 | 3300025908 | Bacteria | 37871 |
| 240 | Ga0207643_10028091 | 3300025908 | Bacteria | 3122 |
| 241 | Ga0207654_10021804 | 3300025911 | Bacteria | 3411 |
| 242 | Ga0207707_10002452 | 3300025912 | Bacteria | 16681 |
| 243 | Ga0207707_10006942 | 3300025912 | Bacteria | 9874 |
| 244 | Ga0207707_10015567 | 3300025912 | Bacteria | 6624 |
| 245 | Ga0207707_10039645 | 3300025912 | Bacteria | 4116 |
| 246 | Ga0207671_10080078 | 3300025914 | Bacteria | 2448 |
| 247 | Ga0207660_10004678 | 3300025917 | Bacteria | 8914 |
| 248 | Ga0207662_10012678 | 3300025918 | Bacteria | 4698 |
| 249 | Ga0207657_10022648 | 3300025919 | Bacteria | 5871 |
| 250 | Ga0207657_10082024 | 3300025919 | Bacteria | 2707 |
| 251 | Ga0207649_10005130 | 3300025920 | Bacteria | 7078 |
| 252 | Ga0207649_10029971 | 3300025920 | Bacteria | 3217 |
| 253 | Ga0207652_10005044 | 3300025921 | Bacteria | 10703 |
| 254 | Ga0207652_10008278 | 3300025921 | Bacteria | 8360 |
| 255 | Ga0207652_10008498 | 3300025921 | Bacteria | 8263 |
| 256 | Ga0207652_10061184 | 3300025921 | Bacteria | 3251 |
| 257 | Ga0207681_10106805 | 3300025923 | Bacteria | 2029 |
| 258 | Ga0207694_10029888 | 3300025924 | Bacteria | 4160 |
| 259 | Ga0207650_10000350 | 3300025925 | Bacteria | 44409 |
| 260 | Ga0207650_10003444 | 3300025925 | Bacteria | 10873 |
| 261 | Ga0207659_10161303 | 3300025926 | Bacteria | 1760 |
| 262 | Ga0207687_10009904 | 3300025927 | Bacteria | 6241 |
| 263 | Ga0207687_10019774 | 3300025927 | Bacteria | 4464 |
| 264 | Ga0207687_10054649 | 3300025927 | Bacteria | 2794 |
| 265 | Ga0207687_10095691 | 3300025927 | Bacteria | 2175 |
| 266 | Ga0207664_10003321 | 3300025929 | Bacteria | 10698 |
| 267 | Ga0207644_10003384 | 3300025931 | Bacteria | 10293 |
| 268 | Ga0207644_10008178 | 3300025931 | Bacteria | 6853 |
| 269 | Ga0207644_10070229 | 3300025931 | Bacteria | 2559 |
| 270 | Ga0207706_10014041 | 3300025933 | Bacteria | 7263 |
| 271 | Ga0207706_10021415 | 3300025933 | Bacteria | 5806 |
| 272 | Ga0207686_10028752 | 3300025934 | Bacteria | 3271 |
| 273 | Ga0207709_10046626 | 3300025935 | Bacteria | 2631 |
| 274 | Ga0207709_10085038 | 3300025935 | Bacteria | 2050 |
| 275 | Ga0207670_10056049 | 3300025936 | Bacteria | 2666 |
| 276 | Ga0207704_10004443 | 3300025938 | Bacteria | 6413 |
| 277 | Ga0207691_10087492 | 3300025940 | Bacteria | 2795 |
| 278 | Ga0207711_10015908 | 3300025941 | Bacteria | 6239 |
| 279 | Ga0207689_10000249 | 3300025942 | Bacteria | 48288 |
| 280 | Ga0207661_10023870 | 3300025944 | Bacteria | 4626 |
| 281 | Ga0207661_10063855 | 3300025944 | Bacteria | 2983 |
| 282 | Ga0207661_10077777 | 3300025944 | Bacteria | 2729 |
| 283 | Ga0207679_10035527 | 3300025945 | Bacteria | 3527 |
| 284 | Ga0207679_10074994 | 3300025945 | Bacteria | 2565 |
| 285 | Ga0207679_10078021 | 3300025945 | Bacteria | 2522 |
| 286 | Ga0207679_10111171 | 3300025945 | Bacteria | 2163 |
| 287 | Ga0207712_10002507 | 3300025961 | Bacteria | 11815 |
| 288 | Ga0207712_10012556 | 3300025961 | Bacteria | 5412 |
| 289 | Ga0207712_10046959 | 3300025961 | Bacteria | 2996 |
| 290 | Ga0207712_10083386 | 3300025961 | Bacteria | 2333 |
| 291 | Ga0207668_10000035 | 3300025972 | Bacteria | 119182 |
| 292 | Ga0207668_10038484 | 3300025972 | Bacteria | 3211 |
| 293 | Ga0207640_10017095 | 3300025981 | Bacteria | 4236 |
| 294 | Ga0207640_10044861 | 3300025981 | Bacteria | 2835 |
| 295 | Ga0207658_10000300 | 3300025986 | Bacteria | 51413 |
| 296 | Ga0207677_10010341 | 3300026023 | Bacteria | 5277 |
| 297 | Ga0207677_10057890 | 3300026023 | Bacteria | 2665 |
| 298 | Ga0207703_10010366 | 3300026035 | Bacteria | 7294 |
| 299 | Ga0207703_10042135 | 3300026035 | Bacteria | 3661 |
| 300 | Ga0207703_10059628 | 3300026035 | Bacteria | 3117 |
| 301 | Ga0207639_10015825 | 3300026041 | Bacteria | 5326 |
| 302 | Ga0207639_10135894 | 3300026041 | Bacteria | 2042 |
| 303 | Ga0207678_10000437 | 3300026067 | Bacteria | 37849 |
| 304 | Ga0207678_10030120 | 3300026067 | Bacteria | 4738 |
| 305 | Ga0207708_10004965 | 3300026075 | Bacteria | 9798 |
| 306 | Ga0207702_10017470 | 3300026078 | Bacteria | 5934 |
| 307 | Ga0207641_10006570 | 3300026088 | Bacteria | 9773 |
| 308 | Ga0207641_10015259 | 3300026088 | Bacteria | 6295 |
| 309 | Ga0207641_10037979 | 3300026088 | Bacteria | 4024 |
| 310 | Ga0207641_10056025 | 3300026088 | Bacteria | 3349 |
| 311 | Ga0207641_10103248 | 3300026088 | Bacteria | 2515 |
| 312 | Ga0207648_10029297 | 3300026089 | Bacteria | 4882 |
| 313 | Ga0207648_10107449 | 3300026089 | Bacteria | 2449 |
| 314 | Ga0207676_10000970 | 3300026095 | Bacteria | 22157 |
| 315 | Ga0207676_10014884 | 3300026095 | Bacteria | 5602 |
| 316 | Ga0207676_10199476 | 3300026095 | Bacteria | 1767 |
| 317 | Ga0207674_10015718 | 3300026116 | Bacteria | 8304 |
| 318 | Ga0207674_10019194 | 3300026116 | Bacteria | 7413 |
| 319 | Ga0207674_10020541 | 3300026116 | Bacteria | 7132 |
| 320 | Ga0207674_10075803 | 3300026116 | Bacteria | 3373 |
| 321 | Ga0207675_100006521 | 3300026118 | Bacteria | 11048 |
| 322 | Ga0207675_100060762 | 3300026118 | Bacteria | 3528 |
| 323 | Ga0207675_100079475 | 3300026118 | Bacteria | 3073 |
| 324 | Ga0207675_100093608 | 3300026118 | Bacteria | 2827 |
| 325 | Ga0207675_100239113 | 3300026118 | Bacteria | 1754 |
| 326 | Ga0207683_10002713 | 3300026121 | Bacteria | 15458 |
| 327 | Ga0207683_10171706 | 3300026121 | Bacteria | 1964 |
| 328 | Ga0207683_10183623 | 3300026121 | Bacteria | 1897 |
| 329 | Ga0209974_10002211 | 3300027876 | Bacteria | 7087 |
| 330 | Ga0207428_10000389 | 3300027907 | Bacteria | 54953 |
| 331 | Ga0207428_10000696 | 3300027907 | Bacteria | 39096 |
| 332 | Ga0207428_10002628 | 3300027907 | Bacteria | 17910 |
| 333 | Ga0207428_10005573 | 3300027907 | Bacteria | 11712 |
| 334 | Ga0207428_10010342 | 3300027907 | Bacteria | 8341 |
| 335 | Ga0207428_10070753 | 3300027907 | Bacteria | 2742 |
| 336 | Ga0268266_10004822 | 3300028379 | Bacteria | 12803 |
| 337 | Ga0268266_10019025 | 3300028379 | Bacteria | 5850 |
| 338 | Ga0268266_10041842 | 3300028379 | Bacteria | 3912 |
| 339 | Ga0268265_10010277 | 3300028380 | Bacteria | 6321 |
| 340 | Ga0268264_10000211 | 3300028381 | Bacteria | 117108 |
| 341 | Ga0268264_10038616 | 3300028381 | Bacteria | 3941 |
| 342 | Ga0268264_10048217 | 3300028381 | Bacteria | 3543 |
| 343 | Ga0307408_100038788 | 3300031548 | Bacteria | 3363 |
| 344 | Ga0307406_10051155 | 3300031901 | Bacteria | 2622 |
| 345 | Ga0307412_10017289 | 3300031911 | Bacteria | 4315 |
| 346 | Ga0307409_100004239 | 3300031995 | Bacteria | 8004 |
| 347 | Ga0307416_100030423 | 3300032002 | Bacteria | 4050 |
| 348 | Ga0307416_100073663 | 3300032002 | Bacteria | 2849 |
| 349 | Ga0307416_100074693 | 3300032002 | Bacteria | 2833 |
| 350 | Ga0307411_10029226 | 3300032005 | Bacteria | 3362 |
| 351 | Ga0307415_100009092 | 3300032126 | Bacteria | 5547 |
| 352 | Ga0307415_100045365 | 3300032126 | Bacteria | 2946 |
| 353 | Ga0373939_0009081 | 3300035114 | Bacteria | 2457 |
| 354 | Ga0373962_0003830 | 3300035242 | Bacteria | 3615 |
| 355 | Ga0373931_0059737 | 3300035691 | Bacteria | 2051 |
| 356 | Ga0373933_0050737 | 3300035724 | Bacteria | 2478 |
| 357 | Ga0373937_0025872 | 3300036401 | Bacteria | 5299 |
| 358 | Ga0395900_0168451 | 3300037418 | Bacteria | 2231 |
| 359 | Ga0395905_0072278 | 3300037471 | Bacteria | 3234 |
| 360 | Ga0436364_0520686 | 3300037853 | Bacteria | 33191 |
| 361 | Ga0395901_0054966 | 3300038443 | Bacteria | 4139 |
| 362 | Ga0395901_0070634 | 3300038443 | Bacteria | 3638 |
| 363 | Ga0436365_1837480 | 3300039437 | Bacteria | 3359 |
| 364 | Ga0439448_0018763 | 3300042005 | Bacteria | 2123 |
| 365 | Ga0495653_0047162 | 3300046463 | Bacteria | 3334 |
| 366 | Ga0495653_0064725 | 3300046463 | Bacteria | 2754 |
| 367 | Ga0495650_0000799 | 3300046471 | Bacteria | 38407 |
| 368 | Ga0495630_0059727 | 3300046517 | Bacteria | 2861 |
| 369 | Ga0495636_0006117 | 3300047318 | Bacteria | 4727 |
| 370 | Ga0496100_0044860 | 3300048903 | Bacteria | 2834 |
| 371 | Ga0496100_0045981 | 3300048903 | Bacteria | 2804 |
| 372 | Ga0496100_0108598 | 3300048903 | Bacteria | 1924 |
| 373 | Ga0496101_0028579 | 3300048904 | Bacteria | 3894 |
| 374 | Ga0496102_0006178 | 3300048905 | Bacteria | 10212 |
| 375 | Ga0496102_0019108 | 3300048905 | Bacteria | 6033 |
| 376 | Ga0496102_0031931 | 3300048905 | Bacteria | 4728 |
| 377 | Ga0496102_0034834 | 3300048905 | Bacteria | 4531 |
| 378 | Ga0496102_0236677 | 3300048905 | Bacteria | 1722 |
| 379 | Ga0496103_0007114 | 3300048906 | Bacteria | 6683 |
| 380 | Ga0496103_0047692 | 3300048906 | Bacteria | 2647 |
| 381 | Ga0496104_0000945 | 3300048907 | Bacteria | 24980 |
| 382 | Ga0496104_0004139 | 3300048907 | Bacteria | 12596 |
| 383 | Ga0496104_0007518 | 3300048907 | Bacteria | 9630 |
| 384 | Ga0496104_0123795 | 3300048907 | Bacteria | 2482 |
| 385 | Ga0496105_0003345 | 3300048908 | Bacteria | 11853 |
| 386 | Ga0496105_0007722 | 3300048908 | Bacteria | 8343 |
| 387 | Ga0496105_0016680 | 3300048908 | Bacteria | 5867 |
| 388 | Ga0496106_0052975 | 3300048909 | Bacteria | 3063 |
| 389 | Ga0496106_0130260 | 3300048909 | Bacteria | 1972 |
| 390 | Ga0496107_0005148 | 3300048910 | Bacteria | 8924 |
| 391 | Ga0496107_0024327 | 3300048910 | Bacteria | 4285 |
| 392 | Ga0496107_0075834 | 3300048910 | Bacteria | 2448 |
| 393 | Ga0496108_0004591 | 3300048911 | Bacteria | 11125 |
| 394 | Ga0496108_0067329 | 3300048911 | Bacteria | 3020 |
| 395 | Ga0496109_0000051 | 3300048912 | Bacteria | 126695 |
| 396 | Ga0496109_0007052 | 3300048912 | Bacteria | 9481 |
| 397 | Ga0496109_0014891 | 3300048912 | Bacteria | 6768 |
| 398 | Ga0496109_0014955 | 3300048912 | Bacteria | 6756 |
| 399 | Ga0496109_0047294 | 3300048912 | Bacteria | 3911 |
| 400 | Ga0496110_0017760 | 3300048913 | Bacteria | 5952 |
| 401 | Ga0496110_0050667 | 3300048913 | Bacteria | 3646 |
| 402 | Ga0496110_0058758 | 3300048913 | Bacteria | 3387 |
| 403 | Ga0496110_0180546 | 3300048913 | Bacteria | 1916 |
| 404 | Ga0496111_0002200 | 3300048914 | Bacteria | 11692 |
| 405 | Ga0496111_0040935 | 3300048914 | Bacteria | 3324 |
| 406 | Ga0496112_0074910 | 3300048915 | Bacteria | 3347 |
| 407 | Ga0496112_0082892 | 3300048915 | Bacteria | 3171 |
| 408 | Ga0496113_0068008 | 3300048916 | Bacteria | 2703 |
| 409 | Ga0496114_0001139 | 3300048917 | Bacteria | 20090 |
| 410 | Ga0496114_0006397 | 3300048917 | Bacteria | 9277 |
| 411 | Ga0496114_0026428 | 3300048917 | Bacteria | 4752 |
| 412 | Ga0496114_0038768 | 3300048917 | Bacteria | 3942 |
| 413 | Ga0496115_0043343 | 3300048918 | Bacteria | 3588 |
| 414 | Ga0496115_0054661 | 3300048918 | Bacteria | 3207 |
| 415 | Ga0496124_0000003 | 3300048927 | Bacteria | 1300161 |
| 416 | Ga0501031_0000607 | 3300049568 | Bacteria | 21131 |
| 417 | Ga0501031_0009858 | 3300049568 | Bacteria | 6218 |
| 418 | Ga0501031_0078197 | 3300049568 | Bacteria | 2155 |
| 419 | Ga0501032_0152397 | 3300049569 | Bacteria | 1519 |
| 420 | Ga0501033_0010820 | 3300049570 | Bacteria | 6996 |
| 421 | Ga0501036_0000485 | 3300049572 | Bacteria | 28397 |
| 422 | Ga0501036_0006945 | 3300049572 | Bacteria | 9206 |
| 423 | Ga0501037_0005761 | 3300049573 | Bacteria | 9044 |
| 424 | Ga0501037_0020900 | 3300049573 | Bacteria | 4833 |
| 425 | Ga0501037_0047820 | 3300049573 | Bacteria | 3135 |
| 426 | Ga0501038_0001862 | 3300049574 | Bacteria | 19478 |
| 427 | Ga0501038_0016713 | 3300049574 | Bacteria | 6647 |
| 428 | Ga0501039_0000598 | 3300049575 | Bacteria | 26078 |
| 429 | Ga0501039_0009380 | 3300049575 | Bacteria | 7460 |
| 430 | Ga0501040_0000088 | 3300049576 | Bacteria | 45722 |
| 431 | Ga0501041_0000553 | 3300049577 | Bacteria | 19361 |
| 432 | Ga0501041_0004965 | 3300049577 | Bacteria | 7739 |
| 433 | Ga0501041_0005227 | 3300049577 | Bacteria | 7580 |
| 434 | Ga0501042_0000023 | 3300049578 | Bacteria | 49896 |
| 435 | Ga0501042_0000473 | 3300049578 | Bacteria | 20832 |
| 436 | Ga0501042_0002659 | 3300049578 | Bacteria | 11000 |
| 437 | Ga0501043_0002969 | 3300049579 | Bacteria | 14138 |
| 438 | Ga0501043_0012800 | 3300049579 | Bacteria | 6559 |
| 439 | Ga0501043_0018311 | 3300049579 | Bacteria | 5491 |
| 440 | Ga0501046_0000527 | 3300049580 | Bacteria | 37914 |
| 441 | Ga0501046_0001000 | 3300049580 | Bacteria | 27627 |
| 442 | Ga0501046_0010607 | 3300049580 | Bacteria | 7907 |
| 443 | Ga0501047_0001240 | 3300049581 | Bacteria | 25269 |
| 444 | Ga0501048_0000757 | 3300049582 | Bacteria | 23666 |
| 445 | Ga0501048_0002635 | 3300049582 | Bacteria | 13718 |
| 446 | Ga0501067_0000268 | 3300049583 | Bacteria | 28422 |
| 447 | Ga0501068_0000403 | 3300049584 | Bacteria | 21916 |
| 448 | Ga0501068_0003313 | 3300049584 | Bacteria | 8634 |
| 449 | Ga0501069_0001051 | 3300049585 | Bacteria | 13204 |
| 450 | Ga0501072_0000021 | 3300049588 | Bacteria | 152489 |
| 451 | Ga0501072_0000131 | 3300049588 | Bacteria | 55832 |
| 452 | Ga0501072_0005570 | 3300049588 | Bacteria | 9578 |
| 453 | Ga0501072_0008206 | 3300049588 | Bacteria | 7930 |
| 454 | Ga0501073_0004234 | 3300049589 | Bacteria | 10757 |
| 455 | Ga0501074_0000080 | 3300049590 | Bacteria | 47252 |
| 456 | Ga0501074_0000540 | 3300049590 | Bacteria | 23262 |
| 457 | Ga0501074_0020464 | 3300049590 | Bacteria | 4808 |
| 458 | Ga0501074_0056191 | 3300049590 | Bacteria | 2836 |
| 459 | Ga0501075_0000343 | 3300049591 | Bacteria | 26423 |
| 460 | Ga0501075_0036847 | 3300049591 | Bacteria | 3651 |
| 461 | Ga0501075_0155388 | 3300049591 | Bacteria | 1744 |
| 462 | Ga0501076_0000018 | 3300049592 | Bacteria | 92605 |
| 463 | Ga0501076_0000184 | 3300049592 | Bacteria | 37225 |
| 464 | Ga0501077_0002210 | 3300049593 | Bacteria | 11731 |
| 465 | Ga0501077_0011109 | 3300049593 | Bacteria | 5617 |
| 466 | Ga0501077_0016678 | 3300049593 | Bacteria | 4630 |
| 467 | Ga0501225_0020457 | 3300049705 | Bacteria | 1829 |
| 468 | Ga0501079_0000128 | 3300049741 | Bacteria | 40662 |
| 469 | Ga0501079_0002661 | 3300049741 | Bacteria | 12986 |
| 470 | Ga0501079_0005318 | 3300049741 | Bacteria | 9582 |
| 471 | Ga0501080_0000875 | 3300049742 | Bacteria | 24645 |
| 472 | Ga0501080_0068131 | 3300049742 | Bacteria | 3311 |
| 473 | Ga0501081_0000388 | 3300049743 | Bacteria | 24270 |
| 474 | Ga0501081_0008441 | 3300049743 | Bacteria | 6690 |
| 475 | Ga0501083_0007199 | 3300049744 | Bacteria | 7900 |
| 476 | Ga0501035_0231305 | 3300049822 | Bacteria | 1575 |
| 477 | Ga0501044_0081300 | 3300049823 | Bacteria | 3280 |
| 478 | Ga0501045_0000642 | 3300049824 | Bacteria | 22093 |
| 479 | Ga0501045_0002399 | 3300049824 | Bacteria | 12735 |
| 480 | nmdc:mga0yw44_68489_c1 | 3300050492 | Bacteria | 2195 |
| 481 | nmdc:mga05p37_17542_c1 | 3300050507 | Bacteria | 8642 |
| 482 | nmdc:mga05p37_177174_c1 | 3300050507 | Bacteria | 2597 |
| 483 | nmdc:mga05p37_3096_c1 | 3300050507 | Bacteria | 19330 |
| 484 | nmdc:mga05p37_3524_c1 | 3300050507 | Bacteria | 18277 |
| 485 | nmdc:mga05p37_4509_c1 | 3300050507 | Bacteria | 16276 |
| 486 | nmdc:mga05p37_45124_c1 | 3300050507 | Bacteria | 5422 |
| 487 | nmdc:mga05p37_5324_c1 | 3300050507 | Bacteria | 15107 |
| 488 | nmdc:mga05p37_54421_c1 | 3300050507 | Bacteria | 4924 |
| 489 | nmdc:mga05p37_55012_c1 | 3300050507 | Bacteria | 4896 |
| 490 | nmdc:mga05p37_9378_c1 | 3300050507 | Bacteria | 11584 |
| 491 | nmdc:mga05p37_9567_c1 | 3300050507 | Bacteria | 11479 |
| 492 | nmdc:mga09592_123832_c1 | 3300050508 | Bacteria | 2222 |
| 493 | nmdc:mga09592_29575_c1 | 3300050508 | Bacteria | 4556 |
| 494 | nmdc:mga09592_52665_c1 | 3300050508 | Bacteria | 3435 |
| 495 | nmdc:mga09592_54213_c1 | 3300050508 | Bacteria | 3388 |
| 496 | nmdc:mga09592_65422_c1 | 3300050508 | Bacteria | 3080 |
| 497 | nmdc:mga0qj67_21617_c1 | 3300050509 | Bacteria | 4936 |
| 498 | nmdc:mga0qj67_362_c1 | 3300050509 | Bacteria | 31322 |
| 499 | nmdc:mga0qj67_53991_c1 | 3300050509 | Bacteria | 3182 |
| 500 | nmdc:mga0qj67_965_c1 | 3300050509 | Bacteria | 19791 |
| 501 | nmdc:mga06r32_114822_c1 | 3300050510 | Bacteria | 2651 |
| 502 | nmdc:mga06r32_170870_c1 | 3300050510 | Bacteria | 2158 |
| 503 | nmdc:mga06r32_34298_c1 | 3300050510 | Bacteria | 4785 |
| 504 | nmdc:mga06r32_4024_c1 | 3300050510 | Bacteria | 13176 |
| 505 | nmdc:mga06r32_53883_c1 | 3300050510 | Bacteria | 3856 |
| 506 | nmdc:mga06r32_99545_c1 | 3300050510 | Bacteria | 2852 |
| 507 | nmdc:mga08y16_18810_c1 | 3300050511 | Bacteria | 7279 |
| 508 | nmdc:mga08y16_192507_c1 | 3300050511 | Bacteria | 2115 |
| 509 | nmdc:mga08y16_25120_c1 | 3300050511 | Bacteria | 6284 |
| 510 | nmdc:mga08y16_278088_c1 | 3300050511 | Bacteria | 1727 |
| 511 | nmdc:mga08y16_34583_c1 | 3300050511 | Bacteria | 5309 |
| 512 | nmdc:mga08y16_54045_c1 | 3300050511 | Bacteria | 4198 |
| 513 | nmdc:mga0n895_155955_c1 | 3300050512 | Bacteria | 2314 |
| 514 | nmdc:mga0n895_16542_c1 | 3300050512 | Bacteria | 6772 |
| 515 | nmdc:mga0n895_166409_c1 | 3300050512 | Bacteria | 2236 |
| 516 | nmdc:mga0n895_181073_c1 | 3300050512 | Bacteria | 2139 |
| 517 | nmdc:mga0n895_233326_c1 | 3300050512 | Bacteria | 1868 |
| 518 | nmdc:mga0n895_239584_c1 | 3300050512 | Bacteria | 1841 |
| 519 | nmdc:mga0n895_39756_c1 | 3300050512 | Bacteria | 4567 |
| 520 | nmdc:mga0n895_5958_c1 | 3300050512 | Bacteria | 10258 |
| 521 | nmdc:mga0n895_8418_c1 | 3300050512 | Bacteria | 8928 |
| 522 | nmdc:mga0n895_8539_c1 | 3300050512 | Bacteria | 8878 |
| 523 | nmdc:mga0rr50_26785_c1 | 3300050513 | Bacteria | 4029 |
| 524 | nmdc:mga0rr50_28398_c1 | 3300050513 | Bacteria | 3933 |
| 525 | nmdc:mga0rr50_31480_c1 | 3300050513 | Bacteria | 3768 |
| 526 | nmdc:mga0rr50_5888_c1 | 3300050513 | Bacteria | 7377 |
| 527 | nmdc:mga08x19_10855_c1 | 3300050514 | Bacteria | 5478 |
| 528 | nmdc:mga08x19_14382_c1 | 3300050514 | Bacteria | 4799 |
| 529 | nmdc:mga0a205_13740_c1 | 3300050515 | Bacteria | 7546 |
| 530 | nmdc:mga0a205_13767_c1 | 3300050515 | Bacteria | 7539 |
| 531 | nmdc:mga0a205_20798_c1 | 3300050515 | Bacteria | 6200 |
| 532 | nmdc:mga0a205_5117_c1 | 3300050515 | Bacteria | 11790 |
| 533 | nmdc:mga0a205_63025_c1 | 3300050515 | Bacteria | 3582 |
| 534 | nmdc:mga0a205_64678_c1 | 3300050515 | Bacteria | 3534 |
| 535 | nmdc:mga0a205_9999_c1 | 3300050515 | Bacteria | 8704 |
| 536 | Ga0500635_0000002 | 3300053080 | Bacteria | 265613 |
| 537 | Ga0501084_0000066 | 3300054114 | Bacteria | 81054 |
| 538 | Ga0501084_0000946 | 3300054114 | Bacteria | 22472 |
| 539 | Ga0501084_0002767 | 3300054114 | Bacteria | 14161 |
| 540 | Ga0501082_0000096 | 3300060353 | Bacteria | 67949 |
| 541 | Ga0501082_0000108 | 3300060353 | Bacteria | 64464 |
| 542 | Ga0501082_0000370 | 3300060353 | Bacteria | 39717 |
| 543 | Ga0530510_0001459 | 3300061734 | Bacteria | 15848 |
| 544 | Ga0530510_0005350 | 3300061734 | Bacteria | 8879 |
| 545 | Ga0530510_0022987 | 3300061734 | Bacteria | 4443 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006847 | Ga0075431_100197330 | Ga0075431_1001973303 | 443 |
| 2 | 3300050510 | nmdc:mga06r32_170870_c1 | nmdc:mga06r32_170870_c1_296_1693 | 443 |
| 3 | 3300050508 | nmdc:mga09592_52665_c1 | nmdc:mga09592_52665_c1_51_1460 | 450 |
| 4 | 3300050515 | nmdc:mga0a205_64678_c1 | nmdc:mga0a205_64678_c1_54_1463 | 450 |
| 5 | 3300004803 | Ga0058862_10101856 | Ga0058862_101018562 | 452 |
| 6 | 3300005336 | Ga0070680_100023379 | Ga0070680_1000233794 | 452 |
| 7 | 3300005458 | Ga0070681_10005785 | Ga0070681_100057859 | 452 |
| 8 | 3300005530 | Ga0070679_100003849 | Ga0070679_10000384911 | 452 |
| 9 | 3300025912 | Ga0207707_10006942 | Ga0207707_100069422 | 452 |
| 10 | 3300025917 | Ga0207660_10004678 | Ga0207660_100046783 | 452 |
| 11 | 3300025921 | Ga0207652_10008498 | Ga0207652_100084983 | 452 |
| 12 | 3300050492 | nmdc:mga0yw44_68489_c1 | nmdc:mga0yw44_68489_c1_611_2068 | 454 |
| 13 | 3300050511 | nmdc:mga08y16_192507_c1 | nmdc:mga08y16_192507_c1_601_2058 | 454 |
| 14 | 3300049569 | Ga0501032_0152397 | Ga0501032_0152397_20_1480 | 459 |
| 15 | 3300048912 | Ga0496109_0000051 | Ga0496109_0000051_44780_46252 | 464 |
| 16 | 3300049822 | Ga0501035_0231305 | Ga0501035_0231305_91_1548 | 464 |
| 17 | 3300050507 | nmdc:mga05p37_9567_c1 | nmdc:mga05p37_9567_c1_10008_11465 | 464 |
| 18 | 3300005435 | Ga0070714_100148428 | Ga0070714_1001484282 | 470 |
| 19 | 3300006028 | Ga0070717_10005329 | Ga0070717_100053295 | 470 |
| 20 | 3300006871 | Ga0075434_100120955 | Ga0075434_1001209552 | 470 |
| 21 | 3300025906 | Ga0207699_10028116 | Ga0207699_100281161 | 470 |
| 22 | 3300025929 | Ga0207664_10003321 | Ga0207664_1000332111 | 470 |
| 23 | 3300026118 | Ga0207675_100093608 | Ga0207675_1000936082 | 470 |
| 24 | 3300017792 | Ga0163161_10116702 | Ga0163161_101167021 | 473 |
| 25 | 3300006051 | Ga0075364_10013247 | Ga0075364_100132474 | 474 |
| 26 | 3300027907 | Ga0207428_10070753 | Ga0207428_100707532 | 474 |
| 27 | 3300050508 | nmdc:mga09592_29575_c1 | nmdc:mga09592_29575_c1_2122_3663 | 474 |
| 28 | 3300005983 | Ga0081540_1000597 | Ga0081540_100059713 | 475 |
| 29 | 3300006852 | Ga0075433_10163761 | Ga0075433_101637611 | 476 |
| 30 | 3300006871 | Ga0075434_100178340 | Ga0075434_1001783402 | 476 |
| 31 | 3300006880 | Ga0075429_100145637 | Ga0075429_1001456371 | 476 |
| 32 | 3300009147 | Ga0114129_10111059 | Ga0114129_101110592 | 476 |
| 33 | 3300009147 | Ga0114129_10207959 | Ga0114129_102079591 | 476 |
| 34 | 3300050507 | nmdc:mga05p37_177174_c1 | nmdc:mga05p37_177174_c1_692_2245 | 476 |
| 35 | 3300050507 | nmdc:mga05p37_55012_c1 | nmdc:mga05p37_55012_c1_1482_3029 | 476 |
| 36 | 3300050508 | nmdc:mga09592_123832_c1 | nmdc:mga09592_123832_c1_29_1582 | 476 |
| 37 | 3300050512 | nmdc:mga0n895_181073_c1 | nmdc:mga0n895_181073_c1_256_1809 | 476 |
| 38 | 3300006846 | Ga0075430_100004032 | Ga0075430_10000403213 | 477 |
| 39 | 3300050509 | nmdc:mga0qj67_362_c1 | nmdc:mga0qj67_362_c1_15334_16878 | 477 |
| 40 | 3300005456 | Ga0070678_100151973 | Ga0070678_1001519732 | 478 |
| 41 | 3300035724 | Ga0373933_0050737 | Ga0373933_0050737_843_2390 | 478 |
| 42 | 3300036401 | Ga0373937_0025872 | Ga0373937_0025872_1953_3500 | 478 |
| 43 | 3300046517 | Ga0495630_0059727 | Ga0495630_0059727_908_2452 | 478 |
| 44 | 3300005937 | Ga0081455_10026745 | Ga0081455_100267451 | 480 |
| 45 | 3300005983 | Ga0081540_1001789 | Ga0081540_100178910 | 480 |
| 46 | 3300005983 | Ga0081540_1034901 | Ga0081540_10349013 | 480 |
| 47 | 3300006846 | Ga0075430_100000100 | Ga0075430_10000010019 | 480 |
| 48 | 3300006871 | Ga0075434_100078755 | Ga0075434_1000787552 | 480 |
| 49 | 3300009094 | Ga0111539_10161993 | Ga0111539_101619932 | 480 |
| 50 | 3300009147 | Ga0114129_10003344 | Ga0114129_1000334419 | 480 |
| 51 | 3300009147 | Ga0114129_10228265 | Ga0114129_102282652 | 480 |
| 52 | 3300037418 | Ga0395900_0168451 | Ga0395900_0168451_56_1603 | 480 |
| 53 | 3300049588 | Ga0501072_0005570 | Ga0501072_0005570_5792_7372 | 480 |
| 54 | 3300050507 | nmdc:mga05p37_3096_c1 | nmdc:mga05p37_3096_c1_17700_19259 | 480 |
| 55 | 3300050509 | nmdc:mga0qj67_965_c1 | nmdc:mga0qj67_965_c1_17549_19108 | 480 |
| 56 | 3300050511 | nmdc:mga08y16_278088_c1 | nmdc:mga08y16_278088_c1_117_1661 | 480 |
| 57 | 3300005295 | Ga0065707_10006674 | Ga0065707_100066742 | 481 |
| 58 | 3300005355 | Ga0070671_100024450 | Ga0070671_1000244502 | 481 |
| 59 | 3300005438 | Ga0070701_10008959 | Ga0070701_100089593 | 481 |
| 60 | 3300005546 | Ga0070696_100121238 | Ga0070696_1001212382 | 481 |
| 61 | 3300005617 | Ga0068859_100015032 | Ga0068859_1000150323 | 481 |
| 62 | 3300006931 | Ga0097620_100015032 | Ga0097620_1000150325 | 481 |
| 63 | 3300009101 | Ga0105247_10003873 | Ga0105247_100038732 | 481 |
| 64 | 3300009148 | Ga0105243_10043700 | Ga0105243_100437005 | 481 |
| 65 | 3300013297 | Ga0157378_10054182 | Ga0157378_100541825 | 481 |
| 66 | 3300025900 | Ga0207710_10002117 | Ga0207710_100021172 | 481 |
| 67 | 3300025931 | Ga0207644_10070229 | Ga0207644_100702292 | 481 |
| 68 | 3300032002 | Ga0307416_100074693 | Ga0307416_1000746933 | 481 |
| 69 | 3300032126 | Ga0307415_100009092 | Ga0307415_1000090922 | 481 |
| 70 | 3300005456 | Ga0070678_100023729 | Ga0070678_1000237293 | 482 |
| 71 | 3300005458 | Ga0070681_10002312 | Ga0070681_100023128 | 482 |
| 72 | 3300005530 | Ga0070679_100009421 | Ga0070679_1000094218 | 482 |
| 73 | 3300005535 | Ga0070684_100010414 | Ga0070684_1000104142 | 482 |
| 74 | 3300005547 | Ga0070693_100023508 | Ga0070693_1000235082 | 482 |
| 75 | 3300005564 | Ga0070664_100028869 | Ga0070664_1000288692 | 482 |
| 76 | 3300005719 | Ga0068861_100132345 | Ga0068861_1001323452 | 482 |
| 77 | 3300005985 | Ga0081539_10012088 | Ga0081539_100120888 | 482 |
| 78 | 3300009098 | Ga0105245_10016616 | Ga0105245_100166164 | 482 |
| 79 | 3300025921 | Ga0207652_10008278 | Ga0207652_100082784 | 482 |
| 80 | 3300025927 | Ga0207687_10054649 | Ga0207687_100546493 | 482 |
| 81 | 3300025935 | Ga0207709_10085038 | Ga0207709_100850382 | 482 |
| 82 | 3300025944 | Ga0207661_10023870 | Ga0207661_100238703 | 482 |
| 83 | 3300025945 | Ga0207679_10078021 | Ga0207679_100780212 | 482 |
| 84 | 3300026118 | Ga0207675_100239113 | Ga0207675_1002391131 | 482 |
| 85 | 3300026121 | Ga0207683_10171706 | Ga0207683_101717062 | 482 |
| 86 | 3300031548 | Ga0307408_100038788 | Ga0307408_1000387882 | 482 |
| 87 | 3300031901 | Ga0307406_10051155 | Ga0307406_100511551 | 482 |
| 88 | 3300031911 | Ga0307412_10017289 | Ga0307412_100172894 | 482 |
| 89 | 3300031995 | Ga0307409_100004239 | Ga0307409_1000042393 | 482 |
| 90 | 3300032005 | Ga0307411_10029226 | Ga0307411_100292263 | 482 |
| 91 | 3300032126 | Ga0307415_100045365 | Ga0307415_1000453652 | 482 |
| 92 | 3300038443 | Ga0395901_0070634 | Ga0395901_0070634_491_2038 | 482 |
| 93 | 3300046471 | Ga0495650_0000799 | Ga0495650_0000799_12645_14189 | 482 |
| 94 | 3300048905 | Ga0496102_0006178 | Ga0496102_0006178_5671_7209 | 482 |
| 95 | 3300048906 | Ga0496103_0007114 | Ga0496103_0007114_5040_6578 | 482 |
| 96 | 3300048907 | Ga0496104_0004139 | Ga0496104_0004139_6998_8536 | 482 |
| 97 | 3300048917 | Ga0496114_0001139 | Ga0496114_0001139_16078_17616 | 482 |
| 98 | 3300049568 | Ga0501031_0000607 | Ga0501031_0000607_6006_7583 | 482 |
| 99 | 3300049570 | Ga0501033_0010820 | Ga0501033_0010820_2538_4115 | 482 |
| 100 | 3300049572 | Ga0501036_0000485 | Ga0501036_0000485_4529_6106 | 482 |
| 101 | 3300049573 | Ga0501037_0020900 | Ga0501037_0020900_699_2276 | 482 |
| 102 | 3300049574 | Ga0501038_0001862 | Ga0501038_0001862_10393_11970 | 482 |
| 103 | 3300049575 | Ga0501039_0000598 | Ga0501039_0000598_7276_8853 | 482 |
| 104 | 3300049576 | Ga0501040_0000088 | Ga0501040_0000088_30823_32400 | 482 |
| 105 | 3300049577 | Ga0501041_0000553 | Ga0501041_0000553_10935_12512 | 482 |
| 106 | 3300049578 | Ga0501042_0000473 | Ga0501042_0000473_5923_7500 | 482 |
| 107 | 3300049579 | Ga0501043_0012800 | Ga0501043_0012800_2356_3933 | 482 |
| 108 | 3300049580 | Ga0501046_0000527 | Ga0501046_0000527_33273_34850 | 482 |
| 109 | 3300049582 | Ga0501048_0000757 | Ga0501048_0000757_15372_16949 | 482 |
| 110 | 3300049588 | Ga0501072_0000131 | Ga0501072_0000131_16832_18409 | 482 |
| 111 | 3300049590 | Ga0501074_0020464 | Ga0501074_0020464_635_2212 | 482 |
| 112 | 3300049591 | Ga0501075_0000343 | Ga0501075_0000343_14419_15996 | 482 |
| 113 | 3300049592 | Ga0501076_0000184 | Ga0501076_0000184_30898_32475 | 482 |
| 114 | 3300049593 | Ga0501077_0002210 | Ga0501077_0002210_4893_6470 | 482 |
| 115 | 3300049705 | Ga0501225_0020457 | Ga0501225_0020457_265_1806 | 482 |
| 116 | 3300049741 | Ga0501079_0005318 | Ga0501079_0005318_5299_6876 | 482 |
| 117 | 3300049742 | Ga0501080_0068131 | Ga0501080_0068131_925_2502 | 482 |
| 118 | 3300049743 | Ga0501081_0008441 | Ga0501081_0008441_2827_4404 | 482 |
| 119 | 3300049824 | Ga0501045_0000642 | Ga0501045_0000642_9671_11248 | 482 |
| 120 | 3300054114 | Ga0501084_0000946 | Ga0501084_0000946_9961_11538 | 482 |
| 121 | 3300060353 | Ga0501082_0000108 | Ga0501082_0000108_48350_49927 | 482 |
| 122 | 3300061734 | Ga0530510_0001459 | Ga0530510_0001459_10932_12509 | 482 |
| 123 | 3300005347 | Ga0070668_100140924 | Ga0070668_1001409241 | 483 |
| 124 | 3300005719 | Ga0068861_100096551 | Ga0068861_1000965512 | 483 |
| 125 | 3300005983 | Ga0081540_1012407 | Ga0081540_10124073 | 483 |
| 126 | 3300006038 | Ga0075365_10092976 | Ga0075365_100929761 | 483 |
| 127 | 3300009553 | Ga0105249_10104628 | Ga0105249_101046282 | 483 |
| 128 | 3300013306 | Ga0163162_10084510 | Ga0163162_100845102 | 483 |
| 129 | 3300025933 | Ga0207706_10021415 | Ga0207706_100214155 | 483 |
| 130 | 3300025945 | Ga0207679_10111171 | Ga0207679_101111712 | 483 |
| 131 | 3300025961 | Ga0207712_10046959 | Ga0207712_100469591 | 483 |
| 132 | 3300026118 | Ga0207675_100006521 | Ga0207675_1000065212 | 483 |
| 133 | 3300037471 | Ga0395905_0072278 | Ga0395905_0072278_669_2213 | 483 |
| 134 | 3300038443 | Ga0395901_0054966 | Ga0395901_0054966_1913_3457 | 483 |
| 135 | 3300009147 | Ga0114129_10194162 | Ga0114129_101941622 | 484 |
| 136 | 3300005937 | Ga0081455_10005039 | Ga0081455_100050392 | 485 |
| 137 | 3300001991 | JGI24743J22301_10007685 | JGI24743J22301_100076851 | 486 |
| 138 | 3300005331 | Ga0070670_100189888 | Ga0070670_1001898881 | 486 |
| 139 | 3300005334 | Ga0068869_100134972 | Ga0068869_1001349722 | 486 |
| 140 | 3300005336 | Ga0070680_100024773 | Ga0070680_1000247735 | 486 |
| 141 | 3300005340 | Ga0070689_100026191 | Ga0070689_1000261912 | 486 |
| 142 | 3300005343 | Ga0070687_100014731 | Ga0070687_1000147313 | 486 |
| 143 | 3300005354 | Ga0070675_100020625 | Ga0070675_1000206255 | 486 |
| 144 | 3300005355 | Ga0070671_100014978 | Ga0070671_1000149786 | 486 |
| 145 | 3300005364 | Ga0070673_100039134 | Ga0070673_1000391343 | 486 |
| 146 | 3300005365 | Ga0070688_100000851 | Ga0070688_10000085127 | 486 |
| 147 | 3300005366 | Ga0070659_100053978 | Ga0070659_1000539783 | 486 |
| 148 | 3300005438 | Ga0070701_10033744 | Ga0070701_100337442 | 486 |
| 149 | 3300005440 | Ga0070705_100043317 | Ga0070705_1000433172 | 486 |
| 150 | 3300005455 | Ga0070663_100099423 | Ga0070663_1000994232 | 486 |
| 151 | 3300005456 | Ga0070678_100147925 | Ga0070678_1001479251 | 486 |
| 152 | 3300005459 | Ga0068867_100010668 | Ga0068867_1000106686 | 486 |
| 153 | 3300005466 | Ga0070685_10008294 | Ga0070685_100082944 | 486 |
| 154 | 3300005535 | Ga0070684_100048841 | Ga0070684_1000488413 | 486 |
| 155 | 3300005543 | Ga0070672_100067392 | Ga0070672_1000673923 | 486 |
| 156 | 3300005548 | Ga0070665_100219508 | Ga0070665_1002195082 | 486 |
| 157 | 3300005616 | Ga0068852_100035821 | Ga0068852_1000358213 | 486 |
| 158 | 3300005617 | Ga0068859_100246739 | Ga0068859_1002467392 | 486 |
| 159 | 3300005618 | Ga0068864_100224261 | Ga0068864_1002242612 | 486 |
| 160 | 3300005718 | Ga0068866_10053487 | Ga0068866_100534872 | 486 |
| 161 | 3300005834 | Ga0068851_10022236 | Ga0068851_100222362 | 486 |
| 162 | 3300005840 | Ga0068870_10041983 | Ga0068870_100419831 | 486 |
| 163 | 3300005841 | Ga0068863_100064641 | Ga0068863_1000646412 | 486 |
| 164 | 3300005842 | Ga0068858_100088189 | Ga0068858_1000881892 | 486 |
| 165 | 3300005843 | Ga0068860_100080540 | Ga0068860_1000805404 | 486 |
| 166 | 3300005844 | Ga0068862_100145198 | Ga0068862_1001451982 | 486 |
| 167 | 3300006358 | Ga0068871_100072247 | Ga0068871_1000722472 | 486 |
| 168 | 3300006852 | Ga0075433_10000850 | Ga0075433_100008503 | 486 |
| 169 | 3300006871 | Ga0075434_100001545 | Ga0075434_10000154518 | 486 |
| 170 | 3300006931 | Ga0097620_100246764 | Ga0097620_1002467642 | 486 |
| 171 | 3300007076 | Ga0075435_100034251 | Ga0075435_1000342511 | 486 |
| 172 | 3300009098 | Ga0105245_10174136 | Ga0105245_101741362 | 486 |
| 173 | 3300009098 | Ga0105245_10243457 | Ga0105245_102434572 | 486 |
| 174 | 3300009176 | Ga0105242_10041059 | Ga0105242_100410593 | 486 |
| 175 | 3300009177 | Ga0105248_10157208 | Ga0105248_101572081 | 486 |
| 176 | 3300011119 | Ga0105246_10115491 | Ga0105246_101154912 | 486 |
| 177 | 3300013308 | Ga0157375_10194723 | Ga0157375_101947232 | 486 |
| 178 | 3300014325 | Ga0163163_10066573 | Ga0163163_100665732 | 486 |
| 179 | 3300014745 | Ga0157377_10084616 | Ga0157377_100846161 | 486 |
| 180 | 3300014968 | Ga0157379_10125602 | Ga0157379_101256022 | 486 |
| 181 | 3300025908 | Ga0207643_10028091 | Ga0207643_100280911 | 486 |
| 182 | 3300025918 | Ga0207662_10012678 | Ga0207662_100126785 | 486 |
| 183 | 3300025926 | Ga0207659_10161303 | Ga0207659_101613031 | 486 |
| 184 | 3300025931 | Ga0207644_10008178 | Ga0207644_100081782 | 486 |
| 185 | 3300025934 | Ga0207686_10028752 | Ga0207686_100287523 | 486 |
| 186 | 3300025935 | Ga0207709_10046626 | Ga0207709_100466262 | 486 |
| 187 | 3300025936 | Ga0207670_10056049 | Ga0207670_100560492 | 486 |
| 188 | 3300025940 | Ga0207691_10087492 | Ga0207691_100874924 | 486 |
| 189 | 3300026035 | Ga0207703_10059628 | Ga0207703_100596284 | 486 |
| 190 | 3300026067 | Ga0207678_10030120 | Ga0207678_100301202 | 486 |
| 191 | 3300026075 | Ga0207708_10004965 | Ga0207708_100049652 | 486 |
| 192 | 3300026088 | Ga0207641_10056025 | Ga0207641_100560252 | 486 |
| 193 | 3300026089 | Ga0207648_10107449 | Ga0207648_101074492 | 486 |
| 194 | 3300026121 | Ga0207683_10183623 | Ga0207683_101836232 | 486 |
| 195 | 3300028379 | Ga0268266_10041842 | Ga0268266_100418422 | 486 |
| 196 | 3300028381 | Ga0268264_10038616 | Ga0268264_100386163 | 486 |
| 197 | 3300035114 | Ga0373939_0009081 | Ga0373939_0009081_176_1717 | 486 |
| 198 | 3300035242 | Ga0373962_0003830 | Ga0373962_0003830_560_2101 | 486 |
| 199 | 3300035691 | Ga0373931_0059737 | Ga0373931_0059737_469_2010 | 486 |
| 200 | 3300048903 | Ga0496100_0108598 | Ga0496100_0108598_186_1727 | 486 |
| 201 | 3300048905 | Ga0496102_0236677 | Ga0496102_0236677_136_1677 | 486 |
| 202 | 3300048907 | Ga0496104_0123795 | Ga0496104_0123795_766_2307 | 486 |
| 203 | 3300048909 | Ga0496106_0130260 | Ga0496106_0130260_43_1584 | 486 |
| 204 | 3300048910 | Ga0496107_0075834 | Ga0496107_0075834_859_2400 | 486 |
| 205 | 3300048911 | Ga0496108_0067329 | Ga0496108_0067329_367_1908 | 486 |
| 206 | 3300048912 | Ga0496109_0047294 | Ga0496109_0047294_879_2420 | 486 |
| 207 | 3300048913 | Ga0496110_0050667 | Ga0496110_0050667_94_1635 | 486 |
| 208 | 3300048914 | Ga0496111_0040935 | Ga0496111_0040935_902_2443 | 486 |
| 209 | 3300048917 | Ga0496114_0038768 | Ga0496114_0038768_1173_2714 | 486 |
| 210 | 3300050512 | nmdc:mga0n895_8418_c1 | nmdc:mga0n895_8418_c1_369_1913 | 486 |
| 211 | 3300050513 | nmdc:mga0rr50_26785_c1 | nmdc:mga0rr50_26785_c1_970_2514 | 486 |
| 212 | 3300050515 | nmdc:mga0a205_13767_c1 | nmdc:mga0a205_13767_c1_49_1593 | 486 |
| 213 | 3300005458 | Ga0070681_10117690 | Ga0070681_101176902 | 487 |
| 214 | 3300005535 | Ga0070684_100017772 | Ga0070684_1000177724 | 487 |
| 215 | 3300009551 | Ga0105238_10015667 | Ga0105238_100156673 | 487 |
| 216 | 3300013307 | Ga0157372_10043990 | Ga0157372_100439903 | 487 |
| 217 | 3300025924 | Ga0207694_10029888 | Ga0207694_100298883 | 487 |
| 218 | 3300049568 | Ga0501031_0009858 | Ga0501031_0009858_4276_5820 | 487 |
| 219 | 3300049573 | Ga0501037_0047820 | Ga0501037_0047820_89_1633 | 487 |
| 220 | 3300049577 | Ga0501041_0004965 | Ga0501041_0004965_5950_7494 | 487 |
| 221 | 3300049578 | Ga0501042_0002659 | Ga0501042_0002659_621_2165 | 487 |
| 222 | 3300049579 | Ga0501043_0018311 | Ga0501043_0018311_134_1678 | 487 |
| 223 | 3300049580 | Ga0501046_0010607 | Ga0501046_0010607_246_1790 | 487 |
| 224 | 3300049584 | Ga0501068_0003313 | Ga0501068_0003313_6472_8016 | 487 |
| 225 | 3300049590 | Ga0501074_0056191 | Ga0501074_0056191_610_2154 | 487 |
| 226 | 3300049593 | Ga0501077_0011109 | Ga0501077_0011109_1647_3191 | 487 |
| 227 | 3300049744 | Ga0501083_0007199 | Ga0501083_0007199_4467_6011 | 487 |
| 228 | 3300006844 | Ga0075428_100151039 | Ga0075428_1001510392 | 488 |
| 229 | 3300006914 | Ga0075436_100016001 | Ga0075436_1000160014 | 488 |
| 230 | 3300027907 | Ga0207428_10005573 | Ga0207428_100055733 | 488 |
| 231 | 3300042005 | Ga0439448_0018763 | Ga0439448_0018763_112_1656 | 488 |
| 232 | 3300049574 | Ga0501038_0016713 | Ga0501038_0016713_3039_4586 | 488 |
| 233 | 3300049579 | Ga0501043_0002969 | Ga0501043_0002969_3967_5514 | 488 |
| 234 | 3300049581 | Ga0501047_0001240 | Ga0501047_0001240_14817_16364 | 488 |
| 235 | 3300049583 | Ga0501067_0000268 | Ga0501067_0000268_23659_25206 | 488 |
| 236 | 3300049584 | Ga0501068_0000403 | Ga0501068_0000403_15777_17324 | 488 |
| 237 | 3300049585 | Ga0501069_0001051 | Ga0501069_0001051_7725_9272 | 488 |
| 238 | 3300049588 | Ga0501072_0000021 | Ga0501072_0000021_89075_90622 | 488 |
| 239 | 3300049589 | Ga0501073_0004234 | Ga0501073_0004234_2062_3609 | 488 |
| 240 | 3300049590 | Ga0501074_0000540 | Ga0501074_0000540_13798_15345 | 488 |
| 241 | 3300049593 | Ga0501077_0016678 | Ga0501077_0016678_2257_3804 | 488 |
| 242 | 3300049741 | Ga0501079_0002661 | Ga0501079_0002661_7626_9173 | 488 |
| 243 | 3300049742 | Ga0501080_0000875 | Ga0501080_0000875_18895_20442 | 488 |
| 244 | 3300049823 | Ga0501044_0081300 | Ga0501044_0081300_930_2477 | 488 |
| 245 | 3300050512 | nmdc:mga0n895_39756_c1 | nmdc:mga0n895_39756_c1_486_2030 | 488 |
| 246 | 3300050514 | nmdc:mga08x19_10855_c1 | nmdc:mga08x19_10855_c1_3588_5132 | 488 |
| 247 | 3300050515 | nmdc:mga0a205_5117_c1 | nmdc:mga0a205_5117_c1_6591_8135 | 488 |
| 248 | 3300054114 | Ga0501084_0000066 | Ga0501084_0000066_18685_20232 | 488 |
| 249 | 3300060353 | Ga0501082_0000370 | Ga0501082_0000370_31028_32575 | 488 |
| 250 | 3300061734 | Ga0530510_0022987 | Ga0530510_0022987_323_1870 | 488 |
| 251 | 3300005337 | Ga0070682_100008990 | Ga0070682_1000089902 | 489 |
| 252 | 3300006058 | Ga0075432_10000128 | Ga0075432_100001289 | 489 |
| 253 | 3300006852 | Ga0075433_10000223 | Ga0075433_1000022327 | 489 |
| 254 | 3300006871 | Ga0075434_100000419 | Ga0075434_10000041926 | 489 |
| 255 | 3300007076 | Ga0075435_100001108 | Ga0075435_10000110817 | 489 |
| 256 | 3300009094 | Ga0111539_10003119 | Ga0111539_1000311917 | 489 |
| 257 | 3300027907 | Ga0207428_10000696 | Ga0207428_1000069640 | 489 |
| 258 | 3300049588 | Ga0501072_0008206 | Ga0501072_0008206_294_1829 | 489 |
| 259 | 3300050511 | nmdc:mga08y16_34583_c1 | nmdc:mga08y16_34583_c1_2962_4500 | 489 |
| 260 | 3300050513 | nmdc:mga0rr50_5888_c1 | nmdc:mga0rr50_5888_c1_2854_4392 | 489 |
| 261 | 3300005719 | Ga0068861_100069056 | Ga0068861_1000690563 | 490 |
| 262 | 3300006058 | Ga0075432_10000401 | Ga0075432_100004018 | 490 |
| 263 | 3300006353 | Ga0075370_10044474 | Ga0075370_100444742 | 490 |
| 264 | 3300006847 | Ga0075431_100048484 | Ga0075431_1000484843 | 490 |
| 265 | 3300006852 | Ga0075433_10163010 | Ga0075433_101630102 | 490 |
| 266 | 3300006871 | Ga0075434_100252333 | Ga0075434_1002523332 | 490 |
| 267 | 3300006880 | Ga0075429_100043016 | Ga0075429_1000430164 | 490 |
| 268 | 3300009094 | Ga0111539_10016101 | Ga0111539_100161013 | 490 |
| 269 | 3300009147 | Ga0114129_10008045 | Ga0114129_1000804512 | 490 |
| 270 | 3300009553 | Ga0105249_10042752 | Ga0105249_100427523 | 490 |
| 271 | 3300013306 | Ga0163162_10242808 | Ga0163162_102428081 | 490 |
| 272 | 3300013307 | Ga0157372_10070507 | Ga0157372_100705072 | 490 |
| 273 | 3300017792 | Ga0163161_10078448 | Ga0163161_100784482 | 490 |
| 274 | 3300025927 | Ga0207687_10095691 | Ga0207687_100956912 | 490 |
| 275 | 3300025961 | Ga0207712_10012556 | Ga0207712_100125564 | 490 |
| 276 | 3300025972 | Ga0207668_10038484 | Ga0207668_100384842 | 490 |
| 277 | 3300026041 | Ga0207639_10135894 | Ga0207639_101358942 | 490 |
| 278 | 3300026118 | Ga0207675_100060762 | Ga0207675_1000607622 | 490 |
| 279 | 3300027907 | Ga0207428_10002628 | Ga0207428_100026289 | 490 |
| 280 | 3300050507 | nmdc:mga05p37_9378_c1 | nmdc:mga05p37_9378_c1_6310_7848 | 490 |
| 281 | 3300050510 | nmdc:mga06r32_114822_c1 | nmdc:mga06r32_114822_c1_288_1826 | 490 |
| 282 | 3300050511 | nmdc:mga08y16_18810_c1 | nmdc:mga08y16_18810_c1_21_1559 | 490 |
| 283 | 3300050512 | nmdc:mga0n895_8539_c1 | nmdc:mga0n895_8539_c1_376_1914 | 490 |
| 284 | 3300050515 | nmdc:mga0a205_20798_c1 | nmdc:mga0a205_20798_c1_4637_6175 | 490 |
| 285 | 3300005329 | Ga0070683_100001559 | Ga0070683_10000155918 | 491 |
| 286 | 3300005336 | Ga0070680_100006439 | Ga0070680_1000064393 | 491 |
| 287 | 3300005458 | Ga0070681_10045567 | Ga0070681_100455673 | 491 |
| 288 | 3300006844 | Ga0075428_100001080 | Ga0075428_10000108021 | 491 |
| 289 | 3300006844 | Ga0075428_100049422 | Ga0075428_1000494223 | 491 |
| 290 | 3300006847 | Ga0075431_100091632 | Ga0075431_1000916323 | 491 |
| 291 | 3300009098 | Ga0105245_10006615 | Ga0105245_100066153 | 491 |
| 292 | 3300009148 | Ga0105243_10033221 | Ga0105243_100332212 | 491 |
| 293 | 3300010375 | Ga0105239_10011907 | Ga0105239_100119078 | 491 |
| 294 | 3300014745 | Ga0157377_10038926 | Ga0157377_100389262 | 491 |
| 295 | 3300025919 | Ga0207657_10082024 | Ga0207657_100820242 | 491 |
| 296 | 3300025927 | Ga0207687_10009904 | Ga0207687_100099042 | 491 |
| 297 | 3300025938 | Ga0207704_10004443 | Ga0207704_100044432 | 491 |
| 298 | 3300027907 | Ga0207428_10000389 | Ga0207428_1000038912 | 491 |
| 299 | 3300048907 | Ga0496104_0007518 | Ga0496104_0007518_8066_9595 | 491 |
| 300 | 3300048908 | Ga0496105_0003345 | Ga0496105_0003345_2018_3547 | 491 |
| 301 | 3300048917 | Ga0496114_0006397 | Ga0496114_0006397_7439_8968 | 491 |
| 302 | 3300049591 | Ga0501075_0155388 | Ga0501075_0155388_160_1695 | 491 |
| 303 | 3300050510 | nmdc:mga06r32_99545_c1 | nmdc:mga06r32_99545_c1_822_2363 | 491 |
| 304 | iso_pu_bacteria | 2816332119 | 2816421731 | 491 |
| 305 | 3300005331 | Ga0070670_100000035 | Ga0070670_100000035146 | 492 |
| 306 | 3300005347 | Ga0070668_100003075 | Ga0070668_1000030757 | 492 |
| 307 | 3300005367 | Ga0070667_100001410 | Ga0070667_1000014107 | 492 |
| 308 | 3300005548 | Ga0070665_100016403 | Ga0070665_1000164033 | 492 |
| 309 | 3300005618 | Ga0068864_100001144 | Ga0068864_10000114412 | 492 |
| 310 | 3300005841 | Ga0068863_100002037 | Ga0068863_10000203718 | 492 |
| 311 | 3300005842 | Ga0068858_100056067 | Ga0068858_1000560672 | 492 |
| 312 | 3300005843 | Ga0068860_100001374 | Ga0068860_10000137418 | 492 |
| 313 | 3300005844 | Ga0068862_100000368 | Ga0068862_10000036841 | 492 |
| 314 | 3300006847 | Ga0075431_100002899 | Ga0075431_1000028993 | 492 |
| 315 | 3300009177 | Ga0105248_10007747 | Ga0105248_1000774715 | 492 |
| 316 | 3300009553 | Ga0105249_10000525 | Ga0105249_1000052539 | 492 |
| 317 | 3300014968 | Ga0157379_10003228 | Ga0157379_1000322810 | 492 |
| 318 | 3300025901 | Ga0207688_10084053 | Ga0207688_100840531 | 492 |
| 319 | 3300025925 | Ga0207650_10000350 | Ga0207650_1000035022 | 492 |
| 320 | 3300025941 | Ga0207711_10015908 | Ga0207711_100159084 | 492 |
| 321 | 3300025961 | Ga0207712_10002507 | Ga0207712_100025074 | 492 |
| 322 | 3300025972 | Ga0207668_10000035 | Ga0207668_10000035105 | 492 |
| 323 | 3300025986 | Ga0207658_10000300 | Ga0207658_1000030019 | 492 |
| 324 | 3300026035 | Ga0207703_10042135 | Ga0207703_100421353 | 492 |
| 325 | 3300026088 | Ga0207641_10006570 | Ga0207641_1000657014 | 492 |
| 326 | 3300026095 | Ga0207676_10000970 | Ga0207676_1000097018 | 492 |
| 327 | 3300028379 | Ga0268266_10004822 | Ga0268266_100048228 | 492 |
| 328 | 3300028380 | Ga0268265_10010277 | Ga0268265_100102775 | 492 |
| 329 | 3300028381 | Ga0268264_10000211 | Ga0268264_1000021118 | 492 |
| 330 | 3300046463 | Ga0495653_0047162 | Ga0495653_0047162_1210_2748 | 492 |
| 331 | 3300048903 | Ga0496100_0044860 | Ga0496100_0044860_1105_2649 | 492 |
| 332 | 3300048904 | Ga0496101_0028579 | Ga0496101_0028579_1272_2816 | 492 |
| 333 | 3300048905 | Ga0496102_0034834 | Ga0496102_0034834_1675_3219 | 492 |
| 334 | 3300048910 | Ga0496107_0005148 | Ga0496107_0005148_4448_5992 | 492 |
| 335 | 3300048917 | Ga0496114_0026428 | Ga0496114_0026428_1695_3239 | 492 |
| 336 | 3300049591 | Ga0501075_0036847 | Ga0501075_0036847_198_1733 | 492 |
| 337 | 3300050507 | nmdc:mga05p37_5324_c1 | nmdc:mga05p37_5324_c1_6573_8153 | 492 |
| 338 | 3300050510 | nmdc:mga06r32_4024_c1 | nmdc:mga06r32_4024_c1_10149_11729 | 492 |
| 339 | 3300050512 | nmdc:mga0n895_233326_c1 | nmdc:mga0n895_233326_c1_276_1832 | 492 |
| 340 | 3300050513 | nmdc:mga0rr50_28398_c1 | nmdc:mga0rr50_28398_c1_2072_3628 | 492 |
| 341 | 3300050514 | nmdc:mga08x19_14382_c1 | nmdc:mga08x19_14382_c1_1862_3418 | 492 |
| 342 | 3300053080 | Ga0500635_0000002 | Ga0500635_0000002_148588_150129 | 492 |
| 343 | iso_pu_bacteria | 2791355123 | 2792750431 | 492 |
| 344 | 3300005334 | Ga0068869_100011023 | Ga0068869_1000110235 | 493 |
| 345 | 3300005337 | Ga0070682_100059009 | Ga0070682_1000590092 | 493 |
| 346 | 3300005338 | Ga0068868_100033147 | Ga0068868_1000331472 | 493 |
| 347 | 3300005341 | Ga0070691_10007311 | Ga0070691_100073113 | 493 |
| 348 | 3300005344 | Ga0070661_100023704 | Ga0070661_1000237045 | 493 |
| 349 | 3300005354 | Ga0070675_100050339 | Ga0070675_1000503394 | 493 |
| 350 | 3300005355 | Ga0070671_100002658 | Ga0070671_1000026585 | 493 |
| 351 | 3300005364 | Ga0070673_100065309 | Ga0070673_1000653093 | 493 |
| 352 | 3300005455 | Ga0070663_100026651 | Ga0070663_1000266512 | 493 |
| 353 | 3300005458 | Ga0070681_10032056 | Ga0070681_100320565 | 493 |
| 354 | 3300005530 | Ga0070679_100046317 | Ga0070679_1000463172 | 493 |
| 355 | 3300005539 | Ga0068853_100057951 | Ga0068853_1000579514 | 493 |
| 356 | 3300005547 | Ga0070693_100010027 | Ga0070693_1000100273 | 493 |
| 357 | 3300005548 | Ga0070665_100030121 | Ga0070665_1000301214 | 493 |
| 358 | 3300005617 | Ga0068859_100102151 | Ga0068859_1001021512 | 493 |
| 359 | 3300005840 | Ga0068870_10007317 | Ga0068870_100073173 | 493 |
| 360 | 3300005842 | Ga0068858_100019078 | Ga0068858_1000190786 | 493 |
| 361 | 3300006871 | Ga0075434_100002360 | Ga0075434_10000236016 | 493 |
| 362 | 3300006914 | Ga0075436_100021410 | Ga0075436_1000214103 | 493 |
| 363 | 3300006931 | Ga0097620_100102151 | Ga0097620_1001021512 | 493 |
| 364 | 3300007076 | Ga0075435_100020797 | Ga0075435_1000207974 | 493 |
| 365 | 3300009094 | Ga0111539_10136153 | Ga0111539_101361532 | 493 |
| 366 | 3300009174 | Ga0105241_10007822 | Ga0105241_100078225 | 493 |
| 367 | 3300009545 | Ga0105237_10012749 | Ga0105237_100127495 | 493 |
| 368 | 3300009551 | Ga0105238_10034047 | Ga0105238_100340473 | 493 |
| 369 | 3300011119 | Ga0105246_10011537 | Ga0105246_100115375 | 493 |
| 370 | 3300013104 | Ga0157370_10016021 | Ga0157370_100160215 | 493 |
| 371 | 3300013296 | Ga0157374_10021287 | Ga0157374_100212874 | 493 |
| 372 | 3300013307 | Ga0157372_10034001 | Ga0157372_100340014 | 493 |
| 373 | 3300025321 | Ga0207656_10008776 | Ga0207656_100087764 | 493 |
| 374 | 3300025907 | Ga0207645_10076671 | Ga0207645_100766712 | 493 |
| 375 | 3300025908 | Ga0207643_10000243 | Ga0207643_1000024329 | 493 |
| 376 | 3300025911 | Ga0207654_10021804 | Ga0207654_100218044 | 493 |
| 377 | 3300025912 | Ga0207707_10039645 | Ga0207707_100396455 | 493 |
| 378 | 3300025914 | Ga0207671_10080078 | Ga0207671_100800782 | 493 |
| 379 | 3300025919 | Ga0207657_10022648 | Ga0207657_100226484 | 493 |
| 380 | 3300025920 | Ga0207649_10029971 | Ga0207649_100299713 | 493 |
| 381 | 3300025925 | Ga0207650_10003444 | Ga0207650_100034445 | 493 |
| 382 | 3300025931 | Ga0207644_10003384 | Ga0207644_100033849 | 493 |
| 383 | 3300025942 | Ga0207689_10000249 | Ga0207689_1000024939 | 493 |
| 384 | 3300025944 | Ga0207661_10077777 | Ga0207661_100777772 | 493 |
| 385 | 3300025945 | Ga0207679_10035527 | Ga0207679_100355274 | 493 |
| 386 | 3300026023 | Ga0207677_10010341 | Ga0207677_100103414 | 493 |
| 387 | 3300026067 | Ga0207678_10000437 | Ga0207678_100004376 | 493 |
| 388 | 3300026078 | Ga0207702_10017470 | Ga0207702_100174705 | 493 |
| 389 | 3300026088 | Ga0207641_10037979 | Ga0207641_100379794 | 493 |
| 390 | 3300026095 | Ga0207676_10014884 | Ga0207676_100148845 | 493 |
| 391 | 3300026116 | Ga0207674_10075803 | Ga0207674_100758032 | 493 |
| 392 | 3300026118 | Ga0207675_100079475 | Ga0207675_1000794752 | 493 |
| 393 | 3300026121 | Ga0207683_10002713 | Ga0207683_1000271313 | 493 |
| 394 | 3300027907 | Ga0207428_10010342 | Ga0207428_100103426 | 493 |
| 395 | 3300028381 | Ga0268264_10048217 | Ga0268264_100482173 | 493 |
| 396 | 3300032002 | Ga0307416_100030423 | Ga0307416_1000304232 | 493 |
| 397 | 3300047318 | Ga0495636_0006117 | Ga0495636_0006117_1469_3055 | 493 |
| 398 | 3300048903 | Ga0496100_0045981 | Ga0496100_0045981_370_1908 | 493 |
| 399 | 3300048905 | Ga0496102_0019108 | Ga0496102_0019108_2106_3644 | 493 |
| 400 | 3300048907 | Ga0496104_0000945 | Ga0496104_0000945_15777_17315 | 493 |
| 401 | 3300048908 | Ga0496105_0016680 | Ga0496105_0016680_2503_4041 | 493 |
| 402 | 3300048913 | Ga0496110_0017760 | Ga0496110_0017760_2698_4236 | 493 |
| 403 | 3300048914 | Ga0496111_0002200 | Ga0496111_0002200_6903_8441 | 493 |
| 404 | 3300049568 | Ga0501031_0078197 | Ga0501031_0078197_356_1903 | 493 |
| 405 | 3300049572 | Ga0501036_0006945 | Ga0501036_0006945_5098_6645 | 493 |
| 406 | 3300049573 | Ga0501037_0005761 | Ga0501037_0005761_1850_3397 | 493 |
| 407 | 3300049575 | Ga0501039_0009380 | Ga0501039_0009380_4121_5668 | 493 |
| 408 | 3300049577 | Ga0501041_0005227 | Ga0501041_0005227_5486_7033 | 493 |
| 409 | 3300049578 | Ga0501042_0000023 | Ga0501042_0000023_17438_18985 | 493 |
| 410 | 3300049580 | Ga0501046_0001000 | Ga0501046_0001000_82_1629 | 493 |
| 411 | 3300049582 | Ga0501048_0002635 | Ga0501048_0002635_4625_6172 | 493 |
| 412 | 3300049590 | Ga0501074_0000080 | Ga0501074_0000080_16006_17553 | 493 |
| 413 | 3300049592 | Ga0501076_0000018 | Ga0501076_0000018_64764_66311 | 493 |
| 414 | 3300049741 | Ga0501079_0000128 | Ga0501079_0000128_33147_34694 | 493 |
| 415 | 3300049743 | Ga0501081_0000388 | Ga0501081_0000388_7555_9102 | 493 |
| 416 | 3300049824 | Ga0501045_0002399 | Ga0501045_0002399_4231_5778 | 493 |
| 417 | 3300050511 | nmdc:mga08y16_25120_c1 | nmdc:mga08y16_25120_c1_4100_5638 | 493 |
| 418 | 3300050512 | nmdc:mga0n895_16542_c1 | nmdc:mga0n895_16542_c1_2801_4339 | 493 |
| 419 | 3300050513 | nmdc:mga0rr50_31480_c1 | nmdc:mga0rr50_31480_c1_1586_3124 | 493 |
| 420 | 3300050515 | nmdc:mga0a205_9999_c1 | nmdc:mga0a205_9999_c1_2713_4251 | 493 |
| 421 | 3300054114 | Ga0501084_0002767 | Ga0501084_0002767_8393_9940 | 493 |
| 422 | 3300060353 | Ga0501082_0000096 | Ga0501082_0000096_61900_63447 | 493 |
| 423 | 3300061734 | Ga0530510_0005350 | Ga0530510_0005350_431_1978 | 493 |
| 424 | 3300001990 | JGI24737J22298_10016553 | JGI24737J22298_100165532 | 494 |
| 425 | 3300002077 | JGI24744J21845_10002141 | JGI24744J21845_100021412 | 494 |
| 426 | 3300005338 | Ga0068868_100020539 | Ga0068868_1000205393 | 494 |
| 427 | 3300005440 | Ga0070705_100013186 | Ga0070705_1000131865 | 494 |
| 428 | 3300005547 | Ga0070693_100009124 | Ga0070693_1000091244 | 494 |
| 429 | 3300005548 | Ga0070665_100009895 | Ga0070665_1000098958 | 494 |
| 430 | 3300005617 | Ga0068859_100026120 | Ga0068859_1000261205 | 494 |
| 431 | 3300005842 | Ga0068858_100022804 | Ga0068858_1000228045 | 494 |
| 432 | 3300005843 | Ga0068860_100040544 | Ga0068860_1000405442 | 494 |
| 433 | 3300006844 | Ga0075428_100012937 | Ga0075428_1000129375 | 494 |
| 434 | 3300006846 | Ga0075430_100020890 | Ga0075430_1000208902 | 494 |
| 435 | 3300006847 | Ga0075431_100025609 | Ga0075431_1000256093 | 494 |
| 436 | 3300006931 | Ga0097620_100026120 | Ga0097620_1000261202 | 494 |
| 437 | 3300009094 | Ga0111539_10071752 | Ga0111539_100717525 | 494 |
| 438 | 3300009098 | Ga0105245_10034154 | Ga0105245_100341544 | 494 |
| 439 | 3300009147 | Ga0114129_10048945 | Ga0114129_100489453 | 494 |
| 440 | 3300013308 | Ga0157375_10020699 | Ga0157375_100206992 | 494 |
| 441 | 3300021388 | Ga0213875_10001707 | Ga0213875_1000170710 | 494 |
| 442 | 3300025900 | Ga0207710_10018775 | Ga0207710_100187752 | 494 |
| 443 | 3300025901 | Ga0207688_10013532 | Ga0207688_100135324 | 494 |
| 444 | 3300025927 | Ga0207687_10019774 | Ga0207687_100197743 | 494 |
| 445 | 3300025981 | Ga0207640_10044861 | Ga0207640_100448612 | 494 |
| 446 | 3300026023 | Ga0207677_10057890 | Ga0207677_100578902 | 494 |
| 447 | 3300026035 | Ga0207703_10010366 | Ga0207703_100103665 | 494 |
| 448 | 3300026041 | Ga0207639_10015825 | Ga0207639_100158252 | 494 |
| 449 | 3300028379 | Ga0268266_10019025 | Ga0268266_100190252 | 494 |
| 450 | 3300032002 | Ga0307416_100073663 | Ga0307416_1000736632 | 494 |
| 451 | 3300037853 | Ga0436364_0520686 | Ga0436364_0520686_9752_11314 | 494 |
| 452 | 3300048911 | Ga0496108_0004591 | Ga0496108_0004591_1262_2806 | 494 |
| 453 | 3300048912 | Ga0496109_0014891 | Ga0496109_0014891_2554_4098 | 494 |
| 454 | 3300048915 | Ga0496112_0082892 | Ga0496112_0082892_1520_3064 | 494 |
| 455 | 3300048916 | Ga0496113_0068008 | Ga0496113_0068008_969_2513 | 494 |
| 456 | 3300050507 | nmdc:mga05p37_17542_c1 | nmdc:mga05p37_17542_c1_2150_3697 | 494 |
| 457 | 3300050507 | nmdc:mga05p37_3524_c1 | nmdc:mga05p37_3524_c1_11280_12821 | 494 |
| 458 | 3300050509 | nmdc:mga0qj67_21617_c1 | nmdc:mga0qj67_21617_c1_2089_3636 | 494 |
| 459 | 3300050510 | nmdc:mga06r32_34298_c1 | nmdc:mga06r32_34298_c1_1713_3260 | 494 |
| 460 | 3300039437 | Ga0436365_1837480 | Ga0436365_1837480_1124_2668 | 495 |
| 461 | 3300046463 | Ga0495653_0064725 | Ga0495653_0064725_1125_2669 | 495 |
| 462 | 3300048905 | Ga0496102_0031931 | Ga0496102_0031931_1322_2866 | 495 |
| 463 | 3300048906 | Ga0496103_0047692 | Ga0496103_0047692_562_2106 | 495 |
| 464 | 3300048908 | Ga0496105_0007722 | Ga0496105_0007722_2598_4142 | 495 |
| 465 | 3300048909 | Ga0496106_0052975 | Ga0496106_0052975_322_1866 | 495 |
| 466 | 3300048910 | Ga0496107_0024327 | Ga0496107_0024327_242_1786 | 495 |
| 467 | 3300048912 | Ga0496109_0007052 | Ga0496109_0007052_1066_2610 | 495 |
| 468 | 3300048913 | Ga0496110_0180546 | Ga0496110_0180546_178_1722 | 495 |
| 469 | 3300048918 | Ga0496115_0043343 | Ga0496115_0043343_2019_3563 | 495 |
| 470 | 3300050507 | nmdc:mga05p37_4509_c1 | nmdc:mga05p37_4509_c1_144_1688 | 495 |
| 471 | 3300050507 | nmdc:mga05p37_54421_c1 | nmdc:mga05p37_54421_c1_167_1711 | 495 |
| 472 | 3300050508 | nmdc:mga09592_54213_c1 | nmdc:mga09592_54213_c1_167_1711 | 495 |
| 473 | 3300050509 | nmdc:mga0qj67_53991_c1 | nmdc:mga0qj67_53991_c1_1342_2886 | 495 |
| 474 | 3300050510 | nmdc:mga06r32_53883_c1 | nmdc:mga06r32_53883_c1_2146_3690 | 495 |
| 475 | 3300050511 | nmdc:mga08y16_54045_c1 | nmdc:mga08y16_54045_c1_2503_4047 | 495 |
| 476 | 3300050512 | nmdc:mga0n895_239584_c1 | nmdc:mga0n895_239584_c1_203_1747 | 495 |
| 477 | 3300050512 | nmdc:mga0n895_5958_c1 | nmdc:mga0n895_5958_c1_5614_7158 | 495 |
| 478 | 3300050515 | nmdc:mga0a205_13740_c1 | nmdc:mga0a205_13740_c1_5822_7366 | 495 |
| 479 | 3300013297 | Ga0157378_10193385 | Ga0157378_101933851 | 496 |
| 480 | 3300025981 | Ga0207640_10017095 | Ga0207640_100170953 | 496 |
| 481 | 3300005331 | Ga0070670_100128030 | Ga0070670_1001280301 | 497 |
| 482 | 3300005347 | Ga0070668_100073071 | Ga0070668_1000730712 | 497 |
| 483 | 3300005617 | Ga0068859_100107117 | Ga0068859_1001071172 | 497 |
| 484 | 3300005834 | Ga0068851_10007861 | Ga0068851_100078613 | 497 |
| 485 | 3300006871 | Ga0075434_100207380 | Ga0075434_1002073802 | 497 |
| 486 | 3300006880 | Ga0075429_100039287 | Ga0075429_1000392872 | 497 |
| 487 | 3300006931 | Ga0097620_100107110 | Ga0097620_1001071102 | 497 |
| 488 | 3300009094 | Ga0111539_10144765 | Ga0111539_101447651 | 497 |
| 489 | 3300009098 | Ga0105245_10038926 | Ga0105245_100389262 | 497 |
| 490 | 3300009176 | Ga0105242_10007684 | Ga0105242_100076845 | 497 |
| 491 | 3300013297 | Ga0157378_10069459 | Ga0157378_100694592 | 497 |
| 492 | 3300013306 | Ga0163162_10208355 | Ga0163162_102083552 | 497 |
| 493 | 3300014325 | Ga0163163_10086840 | Ga0163163_100868402 | 497 |
| 494 | 3300025321 | Ga0207656_10051971 | Ga0207656_100519711 | 497 |
| 495 | 3300025907 | Ga0207645_10036558 | Ga0207645_100365582 | 497 |
| 496 | 3300025912 | Ga0207707_10015567 | Ga0207707_100155675 | 497 |
| 497 | 3300025921 | Ga0207652_10061184 | Ga0207652_100611843 | 497 |
| 498 | 3300025944 | Ga0207661_10063855 | Ga0207661_100638553 | 497 |
| 499 | 3300026089 | Ga0207648_10029297 | Ga0207648_100292976 | 497 |
| 500 | 3300026095 | Ga0207676_10199476 | Ga0207676_101994761 | 497 |
| 501 | 3300026116 | Ga0207674_10019194 | Ga0207674_100191942 | 497 |
| 502 | 3300050507 | nmdc:mga05p37_45124_c1 | nmdc:mga05p37_45124_c1_926_2521 | 497 |
| 503 | 3300050508 | nmdc:mga09592_65422_c1 | nmdc:mga09592_65422_c1_589_2184 | 497 |
| 504 | 3300050512 | nmdc:mga0n895_155955_c1 | nmdc:mga0n895_155955_c1_387_1982 | 497 |
| 505 | 3300050512 | nmdc:mga0n895_166409_c1 | nmdc:mga0n895_166409_c1_490_2088 | 497 |
| 506 | 3300050515 | nmdc:mga0a205_63025_c1 | nmdc:mga0a205_63025_c1_492_2087 | 497 |
| 507 | 3300005295 | Ga0065707_10095396 | Ga0065707_100953963 | 498 |
| 508 | 3300005344 | Ga0070661_100011619 | Ga0070661_1000116196 | 498 |
| 509 | 3300005354 | Ga0070675_100038923 | Ga0070675_1000389233 | 498 |
| 510 | 3300005457 | Ga0070662_100003735 | Ga0070662_1000037353 | 498 |
| 511 | 3300005564 | Ga0070664_100125189 | Ga0070664_1001251892 | 498 |
| 512 | 3300005577 | Ga0068857_100097540 | Ga0068857_1000975402 | 498 |
| 513 | 3300005719 | Ga0068861_100085247 | Ga0068861_1000852471 | 498 |
| 514 | 3300005844 | Ga0068862_100010849 | Ga0068862_1000108492 | 498 |
| 515 | 3300009553 | Ga0105249_10009115 | Ga0105249_100091158 | 498 |
| 516 | 3300013306 | Ga0163162_10010790 | Ga0163162_100107903 | 498 |
| 517 | 3300025923 | Ga0207681_10106805 | Ga0207681_101068051 | 498 |
| 518 | 3300025933 | Ga0207706_10014041 | Ga0207706_100140413 | 498 |
| 519 | 3300025945 | Ga0207679_10074994 | Ga0207679_100749942 | 498 |
| 520 | 3300025961 | Ga0207712_10083386 | Ga0207712_100833862 | 498 |
| 521 | 3300026088 | Ga0207641_10103248 | Ga0207641_101032482 | 498 |
| 522 | 3300026116 | Ga0207674_10015718 | Ga0207674_100157183 | 498 |
| 523 | 3300014497 | Ga0182008_10002548 | Ga0182008_100025489 | 499 |
| 524 | 3300015262 | Ga0182007_10002312 | Ga0182007_1000231210 | 499 |
| 525 | 3300027876 | Ga0209974_10002211 | Ga0209974_100022116 | 501 |
| 526 | 3300005577 | Ga0068857_100012211 | Ga0068857_1000122114 | 503 |
| 527 | 3300005841 | Ga0068863_100008569 | Ga0068863_1000085692 | 503 |
| 528 | 3300010375 | Ga0105239_10071410 | Ga0105239_100714103 | 503 |
| 529 | 3300026088 | Ga0207641_10015259 | Ga0207641_100152594 | 503 |
| 530 | 3300026116 | Ga0207674_10020541 | Ga0207674_100205414 | 503 |
| 531 | 3300048912 | Ga0496109_0014955 | Ga0496109_0014955_622_2187 | 503 |
| 532 | 3300048915 | Ga0496112_0074910 | Ga0496112_0074910_1762_3327 | 503 |
| 533 | 3300048918 | Ga0496115_0054661 | Ga0496115_0054661_740_2305 | 503 |
| 534 | 3300005458 | Ga0070681_10000470 | Ga0070681_1000047010 | 508 |
| 535 | 3300005530 | Ga0070679_100003126 | Ga0070679_1000031263 | 508 |
| 536 | 3300009551 | Ga0105238_10083586 | Ga0105238_100835862 | 508 |
| 537 | 3300013100 | Ga0157373_10007041 | Ga0157373_100070413 | 508 |
| 538 | 3300013104 | Ga0157370_10003313 | Ga0157370_1000331314 | 508 |
| 539 | 3300025912 | Ga0207707_10002452 | Ga0207707_1000245212 | 508 |
| 540 | 3300025920 | Ga0207649_10005130 | Ga0207649_100051305 | 508 |
| 541 | 3300025921 | Ga0207652_10005044 | Ga0207652_100050442 | 508 |
| 542 | 3300006846 | Ga0075430_100077355 | Ga0075430_1000773553 | 510 |
| 543 | 3300048913 | Ga0496110_0058758 | Ga0496110_0058758_339_2024 | 545 |
| 544 | 3300048927 | Ga0496124_0000003 | Ga0496124_0000003_679865_681550 | 545 |
| 545 | 2162886007 | SwRhRL2b_contig_2292377 | SwRhRL2b_0677.00001940 | 556 |
| 546 | 2162886007 | SwRhRL2b_contig_773127 | SwRhRL2b_0863.00006830 | 556 |
| 547 | 3300005289 | Ga0065704_10070132 | Ga0065704_100701321108 | 556 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7aj0-assembly1.cif.gz_F | crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. | 0.7701 | 23 | 487 |
| 1e3c-assembly1.cif.gz_P-2 | crystal structure of an arylsulfatase a mutant c69s soaked in synthetic substrate | 0.7602 | 23 | 447 |
| 1n2l-assembly1.cif.gz_A-2 | crystal structure of a covalent intermediate of endogenous human arylsulfatase a | 0.7572 | 23 | 447 |
| 1n2k-assembly1.cif.gz_A | crystal structure of a covalent intermediate of endogenous human arylsulfatase a | 0.7547 | 23 | 447 |
| 1p49-assembly1.cif.gz_A | structure of human placental estrone/dhea sulfatase | 0.7393 | 22 | 495 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25549_453_517_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.741 | 393 | 449 | 3.40.720.10 |
| 1e1zP01 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7314 | 23 | 392 | 3.40.720.10 |
| af_A0A0G2KLG3_35_301_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7199 | 24 | 284 | 3.40.720.10 |
| af_A0A286Y802_23_363_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7113 | 24 | 387 | 3.40.720.10 |
| af_A0A286Y802_23_363_3.40.720.10 | Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A | 0.7073 | 24 | 387 | 3.40.720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4YUP1-F1-model_v4 | Arylsulfatase (EC) (EC 3.1.6.1) | 0.9549 | 327 | 416 |
GO:0004065
|
| AF-A0A550GM52-F1-model_v4 | Arylsulfatase | 0.9413 | 21 | 286 |
|
| AF-A0A3N5WUI1-F1-model_v4 | Arylsulfatase | 0.9261 | 20 | 217 |
|
| AF-A0A6J4YUP1-F1-model_v4 | Arylsulfatase (EC) (EC 3.1.6.1) | 0.9253 | 327 | 416 |
GO:0004065
|
| AF-A0A7W8CK73-F1-model_v4 | Arylsulfatase A-like enzyme | 0.9213 | 20 | 244 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar