F462073

General Info

Members Datasets Scaffolds Average Seq Length
547 236 545 496

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100151973|Ga0070678_1001519732
Length 481
Sequence MPDKPNILVIWGDDIGITNLSCYSDGLMGYRTPNIDRIANEGMRFTDSYGEQSCTEDPTIAELLKNHGYATAQFGKNHLGDKNEFLPTVHGFDEFYGNLYHLNAEEDPEDPDYXEKHGFEQFRERFGPRGVLRCRATSKDDPKEHPRWGRIGKQRIEDTGPLTRKRMETCDDDFADTACDYIQRQHNRRKPFFCWVNFTHMHLRTHTKRRSLGQAGRWQSPYHDTMIDHDRNVGQLLDLLDRLGIAEDTIVLYGTDNGPHMNSWPDGAMTPFRSEKNTNWEGAFRVPQLVRWPGKIPAGVVSNEIVQLHDWLPTFLAAAGEPDVVEKLKEGHEAAGKTFKVHIDGYNLLPYLTGEESESPRKGFIYFSDDGDLVALRFDNWKLVFMEQRARGTLELWAEPFVPLRVPKLFNLRTDPFERADTTSNTYWDWYISKAYLIMAAQALVTDFLATFRDFPPRQKAASFTIDQALERMQDAAVGHH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
3 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.18
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 8.23
Rhizosphere 89.95
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2292377 2162886007 Bacteria 24756
2 SwRhRL2b_contig_773127 2162886007 Bacteria 225549
3 JGI24737J22298_10016553 3300001990 Bacteria 2380
4 JGI24743J22301_10007685 3300001991 Bacteria 1876
5 JGI24744J21845_10002141 3300002077 Bacteria 4011
6 Ga0058862_10101856 3300004803 Bacteria 1880
7 Ga0065704_10070132 3300005289 Bacteria 1955461
8 Ga0065707_10006674 3300005295 Bacteria 2708
9 Ga0065707_10095396 3300005295 Bacteria 3383
10 Ga0070683_100001559 3300005329 Bacteria 17711
11 Ga0070670_100000035 3300005331 Bacteria 157570
12 Ga0070670_100128030 3300005331 Bacteria 2191
13 Ga0070670_100189888 3300005331 Bacteria 1784
14 Ga0068869_100011023 3300005334 Bacteria 5921
15 Ga0068869_100134972 3300005334 Bacteria 1900
16 Ga0070680_100006439 3300005336 Bacteria 8922
17 Ga0070680_100023379 3300005336 Bacteria 4929
18 Ga0070680_100024773 3300005336 Bacteria 4796
19 Ga0070682_100008990 3300005337 Bacteria 5645
20 Ga0070682_100059009 3300005337 Bacteria 2421
21 Ga0068868_100020539 3300005338 Bacteria 4965
22 Ga0068868_100033147 3300005338 Bacteria 3979
23 Ga0070689_100026191 3300005340 Bacteria 4389
24 Ga0070691_10007311 3300005341 Bacteria 5056
25 Ga0070687_100014731 3300005343 Bacteria 3520
26 Ga0070661_100011619 3300005344 Bacteria 6138
27 Ga0070661_100023704 3300005344 Bacteria 4401
28 Ga0070668_100003075 3300005347 Bacteria 12336
29 Ga0070668_100073071 3300005347 Bacteria 2673
30 Ga0070668_100140924 3300005347 Bacteria 1943
31 Ga0070675_100020625 3300005354 Bacteria 5259
32 Ga0070675_100038923 3300005354 Bacteria 3878
33 Ga0070675_100050339 3300005354 Bacteria 3420
34 Ga0070671_100002658 3300005355 Bacteria 13844
35 Ga0070671_100014978 3300005355 Bacteria 6261
36 Ga0070671_100024450 3300005355 Bacteria 4945
37 Ga0070673_100039134 3300005364 Bacteria 3627
38 Ga0070673_100065309 3300005364 Bacteria 2902
39 Ga0070688_100000851 3300005365 Bacteria 15140
40 Ga0070659_100053978 3300005366 Bacteria 3164
41 Ga0070667_100001410 3300005367 Bacteria 21500
42 Ga0070714_100148428 3300005435 Bacteria 2110
43 Ga0070701_10008959 3300005438 Bacteria 4359
44 Ga0070701_10033744 3300005438 Bacteria 2559
45 Ga0070705_100013186 3300005440 Bacteria 4222
46 Ga0070705_100043317 3300005440 Bacteria 2578
47 Ga0070663_100026651 3300005455 Bacteria 3917
48 Ga0070663_100099423 3300005455 Bacteria 2169
49 Ga0070678_100023729 3300005456 Bacteria 4093
50 Ga0070678_100147925 3300005456 Bacteria 1888
51 Ga0070678_100151973 3300005456 Bacteria 1866
52 Ga0070662_100003735 3300005457 Bacteria 9529
53 Ga0070681_10000470 3300005458 Bacteria 32838
54 Ga0070681_10002312 3300005458 Bacteria 17416
55 Ga0070681_10005785 3300005458 Bacteria 11960
56 Ga0070681_10032056 3300005458 Bacteria 5275
57 Ga0070681_10045567 3300005458 Bacteria 4387
58 Ga0070681_10117690 3300005458 Bacteria 2594
59 Ga0068867_100010668 3300005459 Bacteria 6482
60 Ga0070685_10008294 3300005466 Bacteria 5334
61 Ga0070679_100003126 3300005530 Bacteria 15138
62 Ga0070679_100003849 3300005530 Bacteria 13785
63 Ga0070679_100009421 3300005530 Bacteria 9234
64 Ga0070679_100046317 3300005530 Bacteria 4334
65 Ga0070684_100010414 3300005535 Bacteria 7367
66 Ga0070684_100017772 3300005535 Bacteria 5843
67 Ga0070684_100048841 3300005535 Bacteria 3671
68 Ga0068853_100057951 3300005539 Bacteria 3343
69 Ga0070672_100067392 3300005543 Bacteria 2836
70 Ga0070696_100121238 3300005546 Bacteria 1893
71 Ga0070693_100009124 3300005547 Bacteria 4923
72 Ga0070693_100010027 3300005547 Bacteria 4728
73 Ga0070693_100023508 3300005547 Bacteria 3295
74 Ga0070665_100009895 3300005548 Bacteria 9641
75 Ga0070665_100016403 3300005548 Bacteria 7429
76 Ga0070665_100030121 3300005548 Bacteria 5460
77 Ga0070665_100219508 3300005548 Bacteria 1902
78 Ga0070664_100028869 3300005564 Bacteria 4620
79 Ga0070664_100125189 3300005564 Bacteria 2253
80 Ga0068857_100012211 3300005577 Bacteria 7472
81 Ga0068857_100097540 3300005577 Bacteria 2635
82 Ga0068852_100035821 3300005616 Bacteria 4144
83 Ga0068859_100015032 3300005617 Bacteria 7771
84 Ga0068859_100026120 3300005617 Bacteria 5858
85 Ga0068859_100102151 3300005617 Bacteria 2925
86 Ga0068859_100107117 3300005617 Bacteria 2855
87 Ga0068859_100246739 3300005617 Bacteria 1875
88 Ga0068864_100001144 3300005618 Bacteria 22133
89 Ga0068864_100224261 3300005618 Bacteria 1735
90 Ga0068866_10053487 3300005718 Bacteria 2064
91 Ga0068861_100069056 3300005719 Bacteria 2732
92 Ga0068861_100085247 3300005719 Bacteria 2481
93 Ga0068861_100096551 3300005719 Bacteria 2342
94 Ga0068861_100132345 3300005719 Bacteria 2025
95 Ga0068851_10007861 3300005834 Bacteria 4911
96 Ga0068851_10022236 3300005834 Bacteria 3086
97 Ga0068870_10007317 3300005840 Bacteria 4919
98 Ga0068870_10041983 3300005840 Bacteria 2379
99 Ga0068863_100002037 3300005841 Bacteria 20029
100 Ga0068863_100008569 3300005841 Bacteria 9993
101 Ga0068863_100064641 3300005841 Bacteria 3460
102 Ga0068858_100019078 3300005842 Bacteria 6414
103 Ga0068858_100022804 3300005842 Bacteria 5839
104 Ga0068858_100056067 3300005842 Bacteria 3643
105 Ga0068858_100088189 3300005842 Bacteria 2886
106 Ga0068860_100001374 3300005843 Bacteria 26435
107 Ga0068860_100040544 3300005843 Bacteria 4449
108 Ga0068860_100080540 3300005843 Bacteria 3096
109 Ga0068862_100000368 3300005844 Bacteria 48907
110 Ga0068862_100010849 3300005844 Bacteria 7522
111 Ga0068862_100145198 3300005844 Bacteria 2108
112 Ga0081455_10005039 3300005937 Bacteria 14596
113 Ga0081455_10026745 3300005937 Bacteria 5297
114 Ga0081540_1000597 3300005983 Bacteria 34582
115 Ga0081540_1001789 3300005983 Bacteria 18022
116 Ga0081540_1012407 3300005983 Bacteria 5615
117 Ga0081540_1034901 3300005983 Bacteria 2704
118 Ga0081539_10012088 3300005985 Bacteria 6708
119 Ga0070717_10005329 3300006028 Bacteria 9374
120 Ga0075365_10092976 3300006038 Bacteria 2056
121 Ga0075364_10013247 3300006051 Bacteria 5062
122 Ga0075432_10000128 3300006058 Bacteria 17320
123 Ga0075432_10000401 3300006058 Bacteria 12654
124 Ga0075370_10044474 3300006353 Bacteria 2510
125 Ga0068871_100072247 3300006358 Bacteria 2841
126 Ga0075428_100001080 3300006844 Bacteria 28982
127 Ga0075428_100012937 3300006844 Bacteria 9282
128 Ga0075428_100049422 3300006844 Bacteria 4614
129 Ga0075428_100151039 3300006844 Bacteria 2523
130 Ga0075430_100000100 3300006846 Bacteria 51326
131 Ga0075430_100004032 3300006846 Bacteria 12389
132 Ga0075430_100020890 3300006846 Bacteria 5567
133 Ga0075430_100077355 3300006846 Bacteria 2789
134 Ga0075431_100002899 3300006847 Bacteria 16590
135 Ga0075431_100025609 3300006847 Bacteria 6047
136 Ga0075431_100048484 3300006847 Bacteria 4381
137 Ga0075431_100091632 3300006847 Bacteria 3137
138 Ga0075431_100197330 3300006847 Bacteria 2060
139 Ga0075433_10000223 3300006852 Bacteria 32380
140 Ga0075433_10000850 3300006852 Bacteria 21451
141 Ga0075433_10163010 3300006852 Bacteria 1984
142 Ga0075433_10163761 3300006852 Bacteria 1979
143 Ga0075434_100000419 3300006871 Bacteria 31470
144 Ga0075434_100001545 3300006871 Bacteria 19487
145 Ga0075434_100002360 3300006871 Bacteria 16536
146 Ga0075434_100078755 3300006871 Bacteria 3292
147 Ga0075434_100120955 3300006871 Bacteria 2634
148 Ga0075434_100178340 3300006871 Bacteria 2144
149 Ga0075434_100207380 3300006871 Bacteria 1981
150 Ga0075434_100252333 3300006871 Bacteria 1783
151 Ga0075429_100039287 3300006880 Bacteria 4119
152 Ga0075429_100043016 3300006880 Bacteria 3930
153 Ga0075429_100145637 3300006880 Bacteria 2073
154 Ga0075436_100016001 3300006914 Bacteria 5135
155 Ga0075436_100021410 3300006914 Bacteria 4439
156 Ga0097620_100015032 3300006931 Bacteria 7771
157 Ga0097620_100026120 3300006931 Bacteria 5858
158 Ga0097620_100102151 3300006931 Bacteria 2925
159 Ga0097620_100107110 3300006931 Bacteria 2855
160 Ga0097620_100246764 3300006931 Bacteria 1875
161 Ga0075435_100001108 3300007076 Bacteria 17154
162 Ga0075435_100020797 3300007076 Bacteria 5036
163 Ga0075435_100034251 3300007076 Bacteria 4023
164 Ga0111539_10003119 3300009094 Bacteria 21952
165 Ga0111539_10016101 3300009094 Bacteria 9278
166 Ga0111539_10071752 3300009094 Bacteria 4086
167 Ga0111539_10136153 3300009094 Bacteria 2876
168 Ga0111539_10144765 3300009094 Bacteria 2782
169 Ga0111539_10161993 3300009094 Bacteria 2616
170 Ga0105245_10006615 3300009098 Bacteria 10180
171 Ga0105245_10016616 3300009098 Bacteria 6423
172 Ga0105245_10034154 3300009098 Bacteria 4510
173 Ga0105245_10038926 3300009098 Bacteria 4232
174 Ga0105245_10174136 3300009098 Bacteria 2051
175 Ga0105245_10243457 3300009098 Bacteria 1744
176 Ga0105247_10003873 3300009101 Bacteria 9682
177 Ga0114129_10003344 3300009147 Bacteria 22531
178 Ga0114129_10008045 3300009147 Bacteria 15023
179 Ga0114129_10048945 3300009147 Bacteria 5941
180 Ga0114129_10111059 3300009147 Bacteria 3783
181 Ga0114129_10194162 3300009147 Bacteria 2754
182 Ga0114129_10207959 3300009147 Bacteria 2647
183 Ga0114129_10228265 3300009147 Bacteria 2508
184 Ga0105243_10033221 3300009148 Bacteria 3989
185 Ga0105243_10043700 3300009148 Bacteria 3512
186 Ga0105241_10007822 3300009174 Bacteria 7862
187 Ga0105242_10007684 3300009176 Bacteria 8297
188 Ga0105242_10041059 3300009176 Bacteria 3729
189 Ga0105248_10007747 3300009177 Bacteria 11793
190 Ga0105248_10157208 3300009177 Bacteria 2565
191 Ga0105237_10012749 3300009545 Bacteria 8841
192 Ga0105238_10015667 3300009551 Bacteria 7674
193 Ga0105238_10034047 3300009551 Bacteria 5184
194 Ga0105238_10083586 3300009551 Bacteria 3182
195 Ga0105249_10000525 3300009553 Bacteria 35250
196 Ga0105249_10009115 3300009553 Bacteria 8679
197 Ga0105249_10042752 3300009553 Bacteria 4122
198 Ga0105249_10104628 3300009553 Bacteria 2667
199 Ga0105239_10011907 3300010375 Bacteria 9703
200 Ga0105239_10071410 3300010375 Bacteria 3814
201 Ga0105246_10011537 3300011119 Bacteria 5485
202 Ga0105246_10115491 3300011119 Bacteria 1980
203 Ga0157373_10007041 3300013100 Bacteria 8379
204 Ga0157370_10003313 3300013104 Bacteria 18970
205 Ga0157370_10016021 3300013104 Bacteria 7604
206 Ga0157374_10021287 3300013296 Bacteria 5767
207 Ga0157378_10054182 3300013297 Bacteria 3571
208 Ga0157378_10069459 3300013297 Bacteria 3160
209 Ga0157378_10193385 3300013297 Bacteria 1920
210 Ga0163162_10010790 3300013306 Bacteria 8888
211 Ga0163162_10084510 3300013306 Bacteria 3249
212 Ga0163162_10208355 3300013306 Bacteria 2084
213 Ga0163162_10242808 3300013306 Bacteria 1932
214 Ga0157372_10034001 3300013307 Bacteria 5601
215 Ga0157372_10043990 3300013307 Bacteria 4947
216 Ga0157372_10070507 3300013307 Bacteria 3932
217 Ga0157375_10020699 3300013308 Bacteria 6017
218 Ga0157375_10194723 3300013308 Bacteria 2182
219 Ga0163163_10066573 3300014325 Bacteria 3578
220 Ga0163163_10086840 3300014325 Bacteria 3137
221 Ga0182008_10002548 3300014497 Bacteria 11356
222 Ga0157377_10038926 3300014745 Bacteria 2628
223 Ga0157377_10084616 3300014745 Bacteria 1861
224 Ga0157379_10003228 3300014968 Bacteria 13814
225 Ga0157379_10125602 3300014968 Bacteria 2308
226 Ga0182007_10002312 3300015262 Bacteria 9577
227 Ga0163161_10078448 3300017792 Bacteria 2427
228 Ga0163161_10116702 3300017792 Bacteria 2001
229 Ga0213875_10001707 3300021388 Bacteria 13798
230 Ga0207656_10008776 3300025321 Bacteria 3736
231 Ga0207656_10051971 3300025321 Bacteria 1773
232 Ga0207710_10002117 3300025900 Bacteria 9378
233 Ga0207710_10018775 3300025900 Bacteria 2943
234 Ga0207688_10013532 3300025901 Bacteria 4434
235 Ga0207688_10084053 3300025901 Bacteria 1821
236 Ga0207699_10028116 3300025906 Bacteria 3121
237 Ga0207645_10036558 3300025907 Bacteria 3153
238 Ga0207645_10076671 3300025907 Bacteria 2141
239 Ga0207643_10000243 3300025908 Bacteria 37871
240 Ga0207643_10028091 3300025908 Bacteria 3122
241 Ga0207654_10021804 3300025911 Bacteria 3411
242 Ga0207707_10002452 3300025912 Bacteria 16681
243 Ga0207707_10006942 3300025912 Bacteria 9874
244 Ga0207707_10015567 3300025912 Bacteria 6624
245 Ga0207707_10039645 3300025912 Bacteria 4116
246 Ga0207671_10080078 3300025914 Bacteria 2448
247 Ga0207660_10004678 3300025917 Bacteria 8914
248 Ga0207662_10012678 3300025918 Bacteria 4698
249 Ga0207657_10022648 3300025919 Bacteria 5871
250 Ga0207657_10082024 3300025919 Bacteria 2707
251 Ga0207649_10005130 3300025920 Bacteria 7078
252 Ga0207649_10029971 3300025920 Bacteria 3217
253 Ga0207652_10005044 3300025921 Bacteria 10703
254 Ga0207652_10008278 3300025921 Bacteria 8360
255 Ga0207652_10008498 3300025921 Bacteria 8263
256 Ga0207652_10061184 3300025921 Bacteria 3251
257 Ga0207681_10106805 3300025923 Bacteria 2029
258 Ga0207694_10029888 3300025924 Bacteria 4160
259 Ga0207650_10000350 3300025925 Bacteria 44409
260 Ga0207650_10003444 3300025925 Bacteria 10873
261 Ga0207659_10161303 3300025926 Bacteria 1760
262 Ga0207687_10009904 3300025927 Bacteria 6241
263 Ga0207687_10019774 3300025927 Bacteria 4464
264 Ga0207687_10054649 3300025927 Bacteria 2794
265 Ga0207687_10095691 3300025927 Bacteria 2175
266 Ga0207664_10003321 3300025929 Bacteria 10698
267 Ga0207644_10003384 3300025931 Bacteria 10293
268 Ga0207644_10008178 3300025931 Bacteria 6853
269 Ga0207644_10070229 3300025931 Bacteria 2559
270 Ga0207706_10014041 3300025933 Bacteria 7263
271 Ga0207706_10021415 3300025933 Bacteria 5806
272 Ga0207686_10028752 3300025934 Bacteria 3271
273 Ga0207709_10046626 3300025935 Bacteria 2631
274 Ga0207709_10085038 3300025935 Bacteria 2050
275 Ga0207670_10056049 3300025936 Bacteria 2666
276 Ga0207704_10004443 3300025938 Bacteria 6413
277 Ga0207691_10087492 3300025940 Bacteria 2795
278 Ga0207711_10015908 3300025941 Bacteria 6239
279 Ga0207689_10000249 3300025942 Bacteria 48288
280 Ga0207661_10023870 3300025944 Bacteria 4626
281 Ga0207661_10063855 3300025944 Bacteria 2983
282 Ga0207661_10077777 3300025944 Bacteria 2729
283 Ga0207679_10035527 3300025945 Bacteria 3527
284 Ga0207679_10074994 3300025945 Bacteria 2565
285 Ga0207679_10078021 3300025945 Bacteria 2522
286 Ga0207679_10111171 3300025945 Bacteria 2163
287 Ga0207712_10002507 3300025961 Bacteria 11815
288 Ga0207712_10012556 3300025961 Bacteria 5412
289 Ga0207712_10046959 3300025961 Bacteria 2996
290 Ga0207712_10083386 3300025961 Bacteria 2333
291 Ga0207668_10000035 3300025972 Bacteria 119182
292 Ga0207668_10038484 3300025972 Bacteria 3211
293 Ga0207640_10017095 3300025981 Bacteria 4236
294 Ga0207640_10044861 3300025981 Bacteria 2835
295 Ga0207658_10000300 3300025986 Bacteria 51413
296 Ga0207677_10010341 3300026023 Bacteria 5277
297 Ga0207677_10057890 3300026023 Bacteria 2665
298 Ga0207703_10010366 3300026035 Bacteria 7294
299 Ga0207703_10042135 3300026035 Bacteria 3661
300 Ga0207703_10059628 3300026035 Bacteria 3117
301 Ga0207639_10015825 3300026041 Bacteria 5326
302 Ga0207639_10135894 3300026041 Bacteria 2042
303 Ga0207678_10000437 3300026067 Bacteria 37849
304 Ga0207678_10030120 3300026067 Bacteria 4738
305 Ga0207708_10004965 3300026075 Bacteria 9798
306 Ga0207702_10017470 3300026078 Bacteria 5934
307 Ga0207641_10006570 3300026088 Bacteria 9773
308 Ga0207641_10015259 3300026088 Bacteria 6295
309 Ga0207641_10037979 3300026088 Bacteria 4024
310 Ga0207641_10056025 3300026088 Bacteria 3349
311 Ga0207641_10103248 3300026088 Bacteria 2515
312 Ga0207648_10029297 3300026089 Bacteria 4882
313 Ga0207648_10107449 3300026089 Bacteria 2449
314 Ga0207676_10000970 3300026095 Bacteria 22157
315 Ga0207676_10014884 3300026095 Bacteria 5602
316 Ga0207676_10199476 3300026095 Bacteria 1767
317 Ga0207674_10015718 3300026116 Bacteria 8304
318 Ga0207674_10019194 3300026116 Bacteria 7413
319 Ga0207674_10020541 3300026116 Bacteria 7132
320 Ga0207674_10075803 3300026116 Bacteria 3373
321 Ga0207675_100006521 3300026118 Bacteria 11048
322 Ga0207675_100060762 3300026118 Bacteria 3528
323 Ga0207675_100079475 3300026118 Bacteria 3073
324 Ga0207675_100093608 3300026118 Bacteria 2827
325 Ga0207675_100239113 3300026118 Bacteria 1754
326 Ga0207683_10002713 3300026121 Bacteria 15458
327 Ga0207683_10171706 3300026121 Bacteria 1964
328 Ga0207683_10183623 3300026121 Bacteria 1897
329 Ga0209974_10002211 3300027876 Bacteria 7087
330 Ga0207428_10000389 3300027907 Bacteria 54953
331 Ga0207428_10000696 3300027907 Bacteria 39096
332 Ga0207428_10002628 3300027907 Bacteria 17910
333 Ga0207428_10005573 3300027907 Bacteria 11712
334 Ga0207428_10010342 3300027907 Bacteria 8341
335 Ga0207428_10070753 3300027907 Bacteria 2742
336 Ga0268266_10004822 3300028379 Bacteria 12803
337 Ga0268266_10019025 3300028379 Bacteria 5850
338 Ga0268266_10041842 3300028379 Bacteria 3912
339 Ga0268265_10010277 3300028380 Bacteria 6321
340 Ga0268264_10000211 3300028381 Bacteria 117108
341 Ga0268264_10038616 3300028381 Bacteria 3941
342 Ga0268264_10048217 3300028381 Bacteria 3543
343 Ga0307408_100038788 3300031548 Bacteria 3363
344 Ga0307406_10051155 3300031901 Bacteria 2622
345 Ga0307412_10017289 3300031911 Bacteria 4315
346 Ga0307409_100004239 3300031995 Bacteria 8004
347 Ga0307416_100030423 3300032002 Bacteria 4050
348 Ga0307416_100073663 3300032002 Bacteria 2849
349 Ga0307416_100074693 3300032002 Bacteria 2833
350 Ga0307411_10029226 3300032005 Bacteria 3362
351 Ga0307415_100009092 3300032126 Bacteria 5547
352 Ga0307415_100045365 3300032126 Bacteria 2946
353 Ga0373939_0009081 3300035114 Bacteria 2457
354 Ga0373962_0003830 3300035242 Bacteria 3615
355 Ga0373931_0059737 3300035691 Bacteria 2051
356 Ga0373933_0050737 3300035724 Bacteria 2478
357 Ga0373937_0025872 3300036401 Bacteria 5299
358 Ga0395900_0168451 3300037418 Bacteria 2231
359 Ga0395905_0072278 3300037471 Bacteria 3234
360 Ga0436364_0520686 3300037853 Bacteria 33191
361 Ga0395901_0054966 3300038443 Bacteria 4139
362 Ga0395901_0070634 3300038443 Bacteria 3638
363 Ga0436365_1837480 3300039437 Bacteria 3359
364 Ga0439448_0018763 3300042005 Bacteria 2123
365 Ga0495653_0047162 3300046463 Bacteria 3334
366 Ga0495653_0064725 3300046463 Bacteria 2754
367 Ga0495650_0000799 3300046471 Bacteria 38407
368 Ga0495630_0059727 3300046517 Bacteria 2861
369 Ga0495636_0006117 3300047318 Bacteria 4727
370 Ga0496100_0044860 3300048903 Bacteria 2834
371 Ga0496100_0045981 3300048903 Bacteria 2804
372 Ga0496100_0108598 3300048903 Bacteria 1924
373 Ga0496101_0028579 3300048904 Bacteria 3894
374 Ga0496102_0006178 3300048905 Bacteria 10212
375 Ga0496102_0019108 3300048905 Bacteria 6033
376 Ga0496102_0031931 3300048905 Bacteria 4728
377 Ga0496102_0034834 3300048905 Bacteria 4531
378 Ga0496102_0236677 3300048905 Bacteria 1722
379 Ga0496103_0007114 3300048906 Bacteria 6683
380 Ga0496103_0047692 3300048906 Bacteria 2647
381 Ga0496104_0000945 3300048907 Bacteria 24980
382 Ga0496104_0004139 3300048907 Bacteria 12596
383 Ga0496104_0007518 3300048907 Bacteria 9630
384 Ga0496104_0123795 3300048907 Bacteria 2482
385 Ga0496105_0003345 3300048908 Bacteria 11853
386 Ga0496105_0007722 3300048908 Bacteria 8343
387 Ga0496105_0016680 3300048908 Bacteria 5867
388 Ga0496106_0052975 3300048909 Bacteria 3063
389 Ga0496106_0130260 3300048909 Bacteria 1972
390 Ga0496107_0005148 3300048910 Bacteria 8924
391 Ga0496107_0024327 3300048910 Bacteria 4285
392 Ga0496107_0075834 3300048910 Bacteria 2448
393 Ga0496108_0004591 3300048911 Bacteria 11125
394 Ga0496108_0067329 3300048911 Bacteria 3020
395 Ga0496109_0000051 3300048912 Bacteria 126695
396 Ga0496109_0007052 3300048912 Bacteria 9481
397 Ga0496109_0014891 3300048912 Bacteria 6768
398 Ga0496109_0014955 3300048912 Bacteria 6756
399 Ga0496109_0047294 3300048912 Bacteria 3911
400 Ga0496110_0017760 3300048913 Bacteria 5952
401 Ga0496110_0050667 3300048913 Bacteria 3646
402 Ga0496110_0058758 3300048913 Bacteria 3387
403 Ga0496110_0180546 3300048913 Bacteria 1916
404 Ga0496111_0002200 3300048914 Bacteria 11692
405 Ga0496111_0040935 3300048914 Bacteria 3324
406 Ga0496112_0074910 3300048915 Bacteria 3347
407 Ga0496112_0082892 3300048915 Bacteria 3171
408 Ga0496113_0068008 3300048916 Bacteria 2703
409 Ga0496114_0001139 3300048917 Bacteria 20090
410 Ga0496114_0006397 3300048917 Bacteria 9277
411 Ga0496114_0026428 3300048917 Bacteria 4752
412 Ga0496114_0038768 3300048917 Bacteria 3942
413 Ga0496115_0043343 3300048918 Bacteria 3588
414 Ga0496115_0054661 3300048918 Bacteria 3207
415 Ga0496124_0000003 3300048927 Bacteria 1300161
416 Ga0501031_0000607 3300049568 Bacteria 21131
417 Ga0501031_0009858 3300049568 Bacteria 6218
418 Ga0501031_0078197 3300049568 Bacteria 2155
419 Ga0501032_0152397 3300049569 Bacteria 1519
420 Ga0501033_0010820 3300049570 Bacteria 6996
421 Ga0501036_0000485 3300049572 Bacteria 28397
422 Ga0501036_0006945 3300049572 Bacteria 9206
423 Ga0501037_0005761 3300049573 Bacteria 9044
424 Ga0501037_0020900 3300049573 Bacteria 4833
425 Ga0501037_0047820 3300049573 Bacteria 3135
426 Ga0501038_0001862 3300049574 Bacteria 19478
427 Ga0501038_0016713 3300049574 Bacteria 6647
428 Ga0501039_0000598 3300049575 Bacteria 26078
429 Ga0501039_0009380 3300049575 Bacteria 7460
430 Ga0501040_0000088 3300049576 Bacteria 45722
431 Ga0501041_0000553 3300049577 Bacteria 19361
432 Ga0501041_0004965 3300049577 Bacteria 7739
433 Ga0501041_0005227 3300049577 Bacteria 7580
434 Ga0501042_0000023 3300049578 Bacteria 49896
435 Ga0501042_0000473 3300049578 Bacteria 20832
436 Ga0501042_0002659 3300049578 Bacteria 11000
437 Ga0501043_0002969 3300049579 Bacteria 14138
438 Ga0501043_0012800 3300049579 Bacteria 6559
439 Ga0501043_0018311 3300049579 Bacteria 5491
440 Ga0501046_0000527 3300049580 Bacteria 37914
441 Ga0501046_0001000 3300049580 Bacteria 27627
442 Ga0501046_0010607 3300049580 Bacteria 7907
443 Ga0501047_0001240 3300049581 Bacteria 25269
444 Ga0501048_0000757 3300049582 Bacteria 23666
445 Ga0501048_0002635 3300049582 Bacteria 13718
446 Ga0501067_0000268 3300049583 Bacteria 28422
447 Ga0501068_0000403 3300049584 Bacteria 21916
448 Ga0501068_0003313 3300049584 Bacteria 8634
449 Ga0501069_0001051 3300049585 Bacteria 13204
450 Ga0501072_0000021 3300049588 Bacteria 152489
451 Ga0501072_0000131 3300049588 Bacteria 55832
452 Ga0501072_0005570 3300049588 Bacteria 9578
453 Ga0501072_0008206 3300049588 Bacteria 7930
454 Ga0501073_0004234 3300049589 Bacteria 10757
455 Ga0501074_0000080 3300049590 Bacteria 47252
456 Ga0501074_0000540 3300049590 Bacteria 23262
457 Ga0501074_0020464 3300049590 Bacteria 4808
458 Ga0501074_0056191 3300049590 Bacteria 2836
459 Ga0501075_0000343 3300049591 Bacteria 26423
460 Ga0501075_0036847 3300049591 Bacteria 3651
461 Ga0501075_0155388 3300049591 Bacteria 1744
462 Ga0501076_0000018 3300049592 Bacteria 92605
463 Ga0501076_0000184 3300049592 Bacteria 37225
464 Ga0501077_0002210 3300049593 Bacteria 11731
465 Ga0501077_0011109 3300049593 Bacteria 5617
466 Ga0501077_0016678 3300049593 Bacteria 4630
467 Ga0501225_0020457 3300049705 Bacteria 1829
468 Ga0501079_0000128 3300049741 Bacteria 40662
469 Ga0501079_0002661 3300049741 Bacteria 12986
470 Ga0501079_0005318 3300049741 Bacteria 9582
471 Ga0501080_0000875 3300049742 Bacteria 24645
472 Ga0501080_0068131 3300049742 Bacteria 3311
473 Ga0501081_0000388 3300049743 Bacteria 24270
474 Ga0501081_0008441 3300049743 Bacteria 6690
475 Ga0501083_0007199 3300049744 Bacteria 7900
476 Ga0501035_0231305 3300049822 Bacteria 1575
477 Ga0501044_0081300 3300049823 Bacteria 3280
478 Ga0501045_0000642 3300049824 Bacteria 22093
479 Ga0501045_0002399 3300049824 Bacteria 12735
480 nmdc:mga0yw44_68489_c1 3300050492 Bacteria 2195
481 nmdc:mga05p37_17542_c1 3300050507 Bacteria 8642
482 nmdc:mga05p37_177174_c1 3300050507 Bacteria 2597
483 nmdc:mga05p37_3096_c1 3300050507 Bacteria 19330
484 nmdc:mga05p37_3524_c1 3300050507 Bacteria 18277
485 nmdc:mga05p37_4509_c1 3300050507 Bacteria 16276
486 nmdc:mga05p37_45124_c1 3300050507 Bacteria 5422
487 nmdc:mga05p37_5324_c1 3300050507 Bacteria 15107
488 nmdc:mga05p37_54421_c1 3300050507 Bacteria 4924
489 nmdc:mga05p37_55012_c1 3300050507 Bacteria 4896
490 nmdc:mga05p37_9378_c1 3300050507 Bacteria 11584
491 nmdc:mga05p37_9567_c1 3300050507 Bacteria 11479
492 nmdc:mga09592_123832_c1 3300050508 Bacteria 2222
493 nmdc:mga09592_29575_c1 3300050508 Bacteria 4556
494 nmdc:mga09592_52665_c1 3300050508 Bacteria 3435
495 nmdc:mga09592_54213_c1 3300050508 Bacteria 3388
496 nmdc:mga09592_65422_c1 3300050508 Bacteria 3080
497 nmdc:mga0qj67_21617_c1 3300050509 Bacteria 4936
498 nmdc:mga0qj67_362_c1 3300050509 Bacteria 31322
499 nmdc:mga0qj67_53991_c1 3300050509 Bacteria 3182
500 nmdc:mga0qj67_965_c1 3300050509 Bacteria 19791
501 nmdc:mga06r32_114822_c1 3300050510 Bacteria 2651
502 nmdc:mga06r32_170870_c1 3300050510 Bacteria 2158
503 nmdc:mga06r32_34298_c1 3300050510 Bacteria 4785
504 nmdc:mga06r32_4024_c1 3300050510 Bacteria 13176
505 nmdc:mga06r32_53883_c1 3300050510 Bacteria 3856
506 nmdc:mga06r32_99545_c1 3300050510 Bacteria 2852
507 nmdc:mga08y16_18810_c1 3300050511 Bacteria 7279
508 nmdc:mga08y16_192507_c1 3300050511 Bacteria 2115
509 nmdc:mga08y16_25120_c1 3300050511 Bacteria 6284
510 nmdc:mga08y16_278088_c1 3300050511 Bacteria 1727
511 nmdc:mga08y16_34583_c1 3300050511 Bacteria 5309
512 nmdc:mga08y16_54045_c1 3300050511 Bacteria 4198
513 nmdc:mga0n895_155955_c1 3300050512 Bacteria 2314
514 nmdc:mga0n895_16542_c1 3300050512 Bacteria 6772
515 nmdc:mga0n895_166409_c1 3300050512 Bacteria 2236
516 nmdc:mga0n895_181073_c1 3300050512 Bacteria 2139
517 nmdc:mga0n895_233326_c1 3300050512 Bacteria 1868
518 nmdc:mga0n895_239584_c1 3300050512 Bacteria 1841
519 nmdc:mga0n895_39756_c1 3300050512 Bacteria 4567
520 nmdc:mga0n895_5958_c1 3300050512 Bacteria 10258
521 nmdc:mga0n895_8418_c1 3300050512 Bacteria 8928
522 nmdc:mga0n895_8539_c1 3300050512 Bacteria 8878
523 nmdc:mga0rr50_26785_c1 3300050513 Bacteria 4029
524 nmdc:mga0rr50_28398_c1 3300050513 Bacteria 3933
525 nmdc:mga0rr50_31480_c1 3300050513 Bacteria 3768
526 nmdc:mga0rr50_5888_c1 3300050513 Bacteria 7377
527 nmdc:mga08x19_10855_c1 3300050514 Bacteria 5478
528 nmdc:mga08x19_14382_c1 3300050514 Bacteria 4799
529 nmdc:mga0a205_13740_c1 3300050515 Bacteria 7546
530 nmdc:mga0a205_13767_c1 3300050515 Bacteria 7539
531 nmdc:mga0a205_20798_c1 3300050515 Bacteria 6200
532 nmdc:mga0a205_5117_c1 3300050515 Bacteria 11790
533 nmdc:mga0a205_63025_c1 3300050515 Bacteria 3582
534 nmdc:mga0a205_64678_c1 3300050515 Bacteria 3534
535 nmdc:mga0a205_9999_c1 3300050515 Bacteria 8704
536 Ga0500635_0000002 3300053080 Bacteria 265613
537 Ga0501084_0000066 3300054114 Bacteria 81054
538 Ga0501084_0000946 3300054114 Bacteria 22472
539 Ga0501084_0002767 3300054114 Bacteria 14161
540 Ga0501082_0000096 3300060353 Bacteria 67949
541 Ga0501082_0000108 3300060353 Bacteria 64464
542 Ga0501082_0000370 3300060353 Bacteria 39717
543 Ga0530510_0001459 3300061734 Bacteria 15848
544 Ga0530510_0005350 3300061734 Bacteria 8879
545 Ga0530510_0022987 3300061734 Bacteria 4443

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100197330 Ga0075431_1001973303 443
2 3300050510 nmdc:mga06r32_170870_c1 nmdc:mga06r32_170870_c1_296_1693 443
3 3300050508 nmdc:mga09592_52665_c1 nmdc:mga09592_52665_c1_51_1460 450
4 3300050515 nmdc:mga0a205_64678_c1 nmdc:mga0a205_64678_c1_54_1463 450
5 3300004803 Ga0058862_10101856 Ga0058862_101018562 452
6 3300005336 Ga0070680_100023379 Ga0070680_1000233794 452
7 3300005458 Ga0070681_10005785 Ga0070681_100057859 452
8 3300005530 Ga0070679_100003849 Ga0070679_10000384911 452
9 3300025912 Ga0207707_10006942 Ga0207707_100069422 452
10 3300025917 Ga0207660_10004678 Ga0207660_100046783 452
11 3300025921 Ga0207652_10008498 Ga0207652_100084983 452
12 3300050492 nmdc:mga0yw44_68489_c1 nmdc:mga0yw44_68489_c1_611_2068 454
13 3300050511 nmdc:mga08y16_192507_c1 nmdc:mga08y16_192507_c1_601_2058 454
14 3300049569 Ga0501032_0152397 Ga0501032_0152397_20_1480 459
15 3300048912 Ga0496109_0000051 Ga0496109_0000051_44780_46252 464
16 3300049822 Ga0501035_0231305 Ga0501035_0231305_91_1548 464
17 3300050507 nmdc:mga05p37_9567_c1 nmdc:mga05p37_9567_c1_10008_11465 464
18 3300005435 Ga0070714_100148428 Ga0070714_1001484282 470
19 3300006028 Ga0070717_10005329 Ga0070717_100053295 470
20 3300006871 Ga0075434_100120955 Ga0075434_1001209552 470
21 3300025906 Ga0207699_10028116 Ga0207699_100281161 470
22 3300025929 Ga0207664_10003321 Ga0207664_1000332111 470
23 3300026118 Ga0207675_100093608 Ga0207675_1000936082 470
24 3300017792 Ga0163161_10116702 Ga0163161_101167021 473
25 3300006051 Ga0075364_10013247 Ga0075364_100132474 474
26 3300027907 Ga0207428_10070753 Ga0207428_100707532 474
27 3300050508 nmdc:mga09592_29575_c1 nmdc:mga09592_29575_c1_2122_3663 474
28 3300005983 Ga0081540_1000597 Ga0081540_100059713 475
29 3300006852 Ga0075433_10163761 Ga0075433_101637611 476
30 3300006871 Ga0075434_100178340 Ga0075434_1001783402 476
31 3300006880 Ga0075429_100145637 Ga0075429_1001456371 476
32 3300009147 Ga0114129_10111059 Ga0114129_101110592 476
33 3300009147 Ga0114129_10207959 Ga0114129_102079591 476
34 3300050507 nmdc:mga05p37_177174_c1 nmdc:mga05p37_177174_c1_692_2245 476
35 3300050507 nmdc:mga05p37_55012_c1 nmdc:mga05p37_55012_c1_1482_3029 476
36 3300050508 nmdc:mga09592_123832_c1 nmdc:mga09592_123832_c1_29_1582 476
37 3300050512 nmdc:mga0n895_181073_c1 nmdc:mga0n895_181073_c1_256_1809 476
38 3300006846 Ga0075430_100004032 Ga0075430_10000403213 477
39 3300050509 nmdc:mga0qj67_362_c1 nmdc:mga0qj67_362_c1_15334_16878 477
40 3300005456 Ga0070678_100151973 Ga0070678_1001519732 478
41 3300035724 Ga0373933_0050737 Ga0373933_0050737_843_2390 478
42 3300036401 Ga0373937_0025872 Ga0373937_0025872_1953_3500 478
43 3300046517 Ga0495630_0059727 Ga0495630_0059727_908_2452 478
44 3300005937 Ga0081455_10026745 Ga0081455_100267451 480
45 3300005983 Ga0081540_1001789 Ga0081540_100178910 480
46 3300005983 Ga0081540_1034901 Ga0081540_10349013 480
47 3300006846 Ga0075430_100000100 Ga0075430_10000010019 480
48 3300006871 Ga0075434_100078755 Ga0075434_1000787552 480
49 3300009094 Ga0111539_10161993 Ga0111539_101619932 480
50 3300009147 Ga0114129_10003344 Ga0114129_1000334419 480
51 3300009147 Ga0114129_10228265 Ga0114129_102282652 480
52 3300037418 Ga0395900_0168451 Ga0395900_0168451_56_1603 480
53 3300049588 Ga0501072_0005570 Ga0501072_0005570_5792_7372 480
54 3300050507 nmdc:mga05p37_3096_c1 nmdc:mga05p37_3096_c1_17700_19259 480
55 3300050509 nmdc:mga0qj67_965_c1 nmdc:mga0qj67_965_c1_17549_19108 480
56 3300050511 nmdc:mga08y16_278088_c1 nmdc:mga08y16_278088_c1_117_1661 480
57 3300005295 Ga0065707_10006674 Ga0065707_100066742 481
58 3300005355 Ga0070671_100024450 Ga0070671_1000244502 481
59 3300005438 Ga0070701_10008959 Ga0070701_100089593 481
60 3300005546 Ga0070696_100121238 Ga0070696_1001212382 481
61 3300005617 Ga0068859_100015032 Ga0068859_1000150323 481
62 3300006931 Ga0097620_100015032 Ga0097620_1000150325 481
63 3300009101 Ga0105247_10003873 Ga0105247_100038732 481
64 3300009148 Ga0105243_10043700 Ga0105243_100437005 481
65 3300013297 Ga0157378_10054182 Ga0157378_100541825 481
66 3300025900 Ga0207710_10002117 Ga0207710_100021172 481
67 3300025931 Ga0207644_10070229 Ga0207644_100702292 481
68 3300032002 Ga0307416_100074693 Ga0307416_1000746933 481
69 3300032126 Ga0307415_100009092 Ga0307415_1000090922 481
70 3300005456 Ga0070678_100023729 Ga0070678_1000237293 482
71 3300005458 Ga0070681_10002312 Ga0070681_100023128 482
72 3300005530 Ga0070679_100009421 Ga0070679_1000094218 482
73 3300005535 Ga0070684_100010414 Ga0070684_1000104142 482
74 3300005547 Ga0070693_100023508 Ga0070693_1000235082 482
75 3300005564 Ga0070664_100028869 Ga0070664_1000288692 482
76 3300005719 Ga0068861_100132345 Ga0068861_1001323452 482
77 3300005985 Ga0081539_10012088 Ga0081539_100120888 482
78 3300009098 Ga0105245_10016616 Ga0105245_100166164 482
79 3300025921 Ga0207652_10008278 Ga0207652_100082784 482
80 3300025927 Ga0207687_10054649 Ga0207687_100546493 482
81 3300025935 Ga0207709_10085038 Ga0207709_100850382 482
82 3300025944 Ga0207661_10023870 Ga0207661_100238703 482
83 3300025945 Ga0207679_10078021 Ga0207679_100780212 482
84 3300026118 Ga0207675_100239113 Ga0207675_1002391131 482
85 3300026121 Ga0207683_10171706 Ga0207683_101717062 482
86 3300031548 Ga0307408_100038788 Ga0307408_1000387882 482
87 3300031901 Ga0307406_10051155 Ga0307406_100511551 482
88 3300031911 Ga0307412_10017289 Ga0307412_100172894 482
89 3300031995 Ga0307409_100004239 Ga0307409_1000042393 482
90 3300032005 Ga0307411_10029226 Ga0307411_100292263 482
91 3300032126 Ga0307415_100045365 Ga0307415_1000453652 482
92 3300038443 Ga0395901_0070634 Ga0395901_0070634_491_2038 482
93 3300046471 Ga0495650_0000799 Ga0495650_0000799_12645_14189 482
94 3300048905 Ga0496102_0006178 Ga0496102_0006178_5671_7209 482
95 3300048906 Ga0496103_0007114 Ga0496103_0007114_5040_6578 482
96 3300048907 Ga0496104_0004139 Ga0496104_0004139_6998_8536 482
97 3300048917 Ga0496114_0001139 Ga0496114_0001139_16078_17616 482
98 3300049568 Ga0501031_0000607 Ga0501031_0000607_6006_7583 482
99 3300049570 Ga0501033_0010820 Ga0501033_0010820_2538_4115 482
100 3300049572 Ga0501036_0000485 Ga0501036_0000485_4529_6106 482
101 3300049573 Ga0501037_0020900 Ga0501037_0020900_699_2276 482
102 3300049574 Ga0501038_0001862 Ga0501038_0001862_10393_11970 482
103 3300049575 Ga0501039_0000598 Ga0501039_0000598_7276_8853 482
104 3300049576 Ga0501040_0000088 Ga0501040_0000088_30823_32400 482
105 3300049577 Ga0501041_0000553 Ga0501041_0000553_10935_12512 482
106 3300049578 Ga0501042_0000473 Ga0501042_0000473_5923_7500 482
107 3300049579 Ga0501043_0012800 Ga0501043_0012800_2356_3933 482
108 3300049580 Ga0501046_0000527 Ga0501046_0000527_33273_34850 482
109 3300049582 Ga0501048_0000757 Ga0501048_0000757_15372_16949 482
110 3300049588 Ga0501072_0000131 Ga0501072_0000131_16832_18409 482
111 3300049590 Ga0501074_0020464 Ga0501074_0020464_635_2212 482
112 3300049591 Ga0501075_0000343 Ga0501075_0000343_14419_15996 482
113 3300049592 Ga0501076_0000184 Ga0501076_0000184_30898_32475 482
114 3300049593 Ga0501077_0002210 Ga0501077_0002210_4893_6470 482
115 3300049705 Ga0501225_0020457 Ga0501225_0020457_265_1806 482
116 3300049741 Ga0501079_0005318 Ga0501079_0005318_5299_6876 482
117 3300049742 Ga0501080_0068131 Ga0501080_0068131_925_2502 482
118 3300049743 Ga0501081_0008441 Ga0501081_0008441_2827_4404 482
119 3300049824 Ga0501045_0000642 Ga0501045_0000642_9671_11248 482
120 3300054114 Ga0501084_0000946 Ga0501084_0000946_9961_11538 482
121 3300060353 Ga0501082_0000108 Ga0501082_0000108_48350_49927 482
122 3300061734 Ga0530510_0001459 Ga0530510_0001459_10932_12509 482
123 3300005347 Ga0070668_100140924 Ga0070668_1001409241 483
124 3300005719 Ga0068861_100096551 Ga0068861_1000965512 483
125 3300005983 Ga0081540_1012407 Ga0081540_10124073 483
126 3300006038 Ga0075365_10092976 Ga0075365_100929761 483
127 3300009553 Ga0105249_10104628 Ga0105249_101046282 483
128 3300013306 Ga0163162_10084510 Ga0163162_100845102 483
129 3300025933 Ga0207706_10021415 Ga0207706_100214155 483
130 3300025945 Ga0207679_10111171 Ga0207679_101111712 483
131 3300025961 Ga0207712_10046959 Ga0207712_100469591 483
132 3300026118 Ga0207675_100006521 Ga0207675_1000065212 483
133 3300037471 Ga0395905_0072278 Ga0395905_0072278_669_2213 483
134 3300038443 Ga0395901_0054966 Ga0395901_0054966_1913_3457 483
135 3300009147 Ga0114129_10194162 Ga0114129_101941622 484
136 3300005937 Ga0081455_10005039 Ga0081455_100050392 485
137 3300001991 JGI24743J22301_10007685 JGI24743J22301_100076851 486
138 3300005331 Ga0070670_100189888 Ga0070670_1001898881 486
139 3300005334 Ga0068869_100134972 Ga0068869_1001349722 486
140 3300005336 Ga0070680_100024773 Ga0070680_1000247735 486
141 3300005340 Ga0070689_100026191 Ga0070689_1000261912 486
142 3300005343 Ga0070687_100014731 Ga0070687_1000147313 486
143 3300005354 Ga0070675_100020625 Ga0070675_1000206255 486
144 3300005355 Ga0070671_100014978 Ga0070671_1000149786 486
145 3300005364 Ga0070673_100039134 Ga0070673_1000391343 486
146 3300005365 Ga0070688_100000851 Ga0070688_10000085127 486
147 3300005366 Ga0070659_100053978 Ga0070659_1000539783 486
148 3300005438 Ga0070701_10033744 Ga0070701_100337442 486
149 3300005440 Ga0070705_100043317 Ga0070705_1000433172 486
150 3300005455 Ga0070663_100099423 Ga0070663_1000994232 486
151 3300005456 Ga0070678_100147925 Ga0070678_1001479251 486
152 3300005459 Ga0068867_100010668 Ga0068867_1000106686 486
153 3300005466 Ga0070685_10008294 Ga0070685_100082944 486
154 3300005535 Ga0070684_100048841 Ga0070684_1000488413 486
155 3300005543 Ga0070672_100067392 Ga0070672_1000673923 486
156 3300005548 Ga0070665_100219508 Ga0070665_1002195082 486
157 3300005616 Ga0068852_100035821 Ga0068852_1000358213 486
158 3300005617 Ga0068859_100246739 Ga0068859_1002467392 486
159 3300005618 Ga0068864_100224261 Ga0068864_1002242612 486
160 3300005718 Ga0068866_10053487 Ga0068866_100534872 486
161 3300005834 Ga0068851_10022236 Ga0068851_100222362 486
162 3300005840 Ga0068870_10041983 Ga0068870_100419831 486
163 3300005841 Ga0068863_100064641 Ga0068863_1000646412 486
164 3300005842 Ga0068858_100088189 Ga0068858_1000881892 486
165 3300005843 Ga0068860_100080540 Ga0068860_1000805404 486
166 3300005844 Ga0068862_100145198 Ga0068862_1001451982 486
167 3300006358 Ga0068871_100072247 Ga0068871_1000722472 486
168 3300006852 Ga0075433_10000850 Ga0075433_100008503 486
169 3300006871 Ga0075434_100001545 Ga0075434_10000154518 486
170 3300006931 Ga0097620_100246764 Ga0097620_1002467642 486
171 3300007076 Ga0075435_100034251 Ga0075435_1000342511 486
172 3300009098 Ga0105245_10174136 Ga0105245_101741362 486
173 3300009098 Ga0105245_10243457 Ga0105245_102434572 486
174 3300009176 Ga0105242_10041059 Ga0105242_100410593 486
175 3300009177 Ga0105248_10157208 Ga0105248_101572081 486
176 3300011119 Ga0105246_10115491 Ga0105246_101154912 486
177 3300013308 Ga0157375_10194723 Ga0157375_101947232 486
178 3300014325 Ga0163163_10066573 Ga0163163_100665732 486
179 3300014745 Ga0157377_10084616 Ga0157377_100846161 486
180 3300014968 Ga0157379_10125602 Ga0157379_101256022 486
181 3300025908 Ga0207643_10028091 Ga0207643_100280911 486
182 3300025918 Ga0207662_10012678 Ga0207662_100126785 486
183 3300025926 Ga0207659_10161303 Ga0207659_101613031 486
184 3300025931 Ga0207644_10008178 Ga0207644_100081782 486
185 3300025934 Ga0207686_10028752 Ga0207686_100287523 486
186 3300025935 Ga0207709_10046626 Ga0207709_100466262 486
187 3300025936 Ga0207670_10056049 Ga0207670_100560492 486
188 3300025940 Ga0207691_10087492 Ga0207691_100874924 486
189 3300026035 Ga0207703_10059628 Ga0207703_100596284 486
190 3300026067 Ga0207678_10030120 Ga0207678_100301202 486
191 3300026075 Ga0207708_10004965 Ga0207708_100049652 486
192 3300026088 Ga0207641_10056025 Ga0207641_100560252 486
193 3300026089 Ga0207648_10107449 Ga0207648_101074492 486
194 3300026121 Ga0207683_10183623 Ga0207683_101836232 486
195 3300028379 Ga0268266_10041842 Ga0268266_100418422 486
196 3300028381 Ga0268264_10038616 Ga0268264_100386163 486
197 3300035114 Ga0373939_0009081 Ga0373939_0009081_176_1717 486
198 3300035242 Ga0373962_0003830 Ga0373962_0003830_560_2101 486
199 3300035691 Ga0373931_0059737 Ga0373931_0059737_469_2010 486
200 3300048903 Ga0496100_0108598 Ga0496100_0108598_186_1727 486
201 3300048905 Ga0496102_0236677 Ga0496102_0236677_136_1677 486
202 3300048907 Ga0496104_0123795 Ga0496104_0123795_766_2307 486
203 3300048909 Ga0496106_0130260 Ga0496106_0130260_43_1584 486
204 3300048910 Ga0496107_0075834 Ga0496107_0075834_859_2400 486
205 3300048911 Ga0496108_0067329 Ga0496108_0067329_367_1908 486
206 3300048912 Ga0496109_0047294 Ga0496109_0047294_879_2420 486
207 3300048913 Ga0496110_0050667 Ga0496110_0050667_94_1635 486
208 3300048914 Ga0496111_0040935 Ga0496111_0040935_902_2443 486
209 3300048917 Ga0496114_0038768 Ga0496114_0038768_1173_2714 486
210 3300050512 nmdc:mga0n895_8418_c1 nmdc:mga0n895_8418_c1_369_1913 486
211 3300050513 nmdc:mga0rr50_26785_c1 nmdc:mga0rr50_26785_c1_970_2514 486
212 3300050515 nmdc:mga0a205_13767_c1 nmdc:mga0a205_13767_c1_49_1593 486
213 3300005458 Ga0070681_10117690 Ga0070681_101176902 487
214 3300005535 Ga0070684_100017772 Ga0070684_1000177724 487
215 3300009551 Ga0105238_10015667 Ga0105238_100156673 487
216 3300013307 Ga0157372_10043990 Ga0157372_100439903 487
217 3300025924 Ga0207694_10029888 Ga0207694_100298883 487
218 3300049568 Ga0501031_0009858 Ga0501031_0009858_4276_5820 487
219 3300049573 Ga0501037_0047820 Ga0501037_0047820_89_1633 487
220 3300049577 Ga0501041_0004965 Ga0501041_0004965_5950_7494 487
221 3300049578 Ga0501042_0002659 Ga0501042_0002659_621_2165 487
222 3300049579 Ga0501043_0018311 Ga0501043_0018311_134_1678 487
223 3300049580 Ga0501046_0010607 Ga0501046_0010607_246_1790 487
224 3300049584 Ga0501068_0003313 Ga0501068_0003313_6472_8016 487
225 3300049590 Ga0501074_0056191 Ga0501074_0056191_610_2154 487
226 3300049593 Ga0501077_0011109 Ga0501077_0011109_1647_3191 487
227 3300049744 Ga0501083_0007199 Ga0501083_0007199_4467_6011 487
228 3300006844 Ga0075428_100151039 Ga0075428_1001510392 488
229 3300006914 Ga0075436_100016001 Ga0075436_1000160014 488
230 3300027907 Ga0207428_10005573 Ga0207428_100055733 488
231 3300042005 Ga0439448_0018763 Ga0439448_0018763_112_1656 488
232 3300049574 Ga0501038_0016713 Ga0501038_0016713_3039_4586 488
233 3300049579 Ga0501043_0002969 Ga0501043_0002969_3967_5514 488
234 3300049581 Ga0501047_0001240 Ga0501047_0001240_14817_16364 488
235 3300049583 Ga0501067_0000268 Ga0501067_0000268_23659_25206 488
236 3300049584 Ga0501068_0000403 Ga0501068_0000403_15777_17324 488
237 3300049585 Ga0501069_0001051 Ga0501069_0001051_7725_9272 488
238 3300049588 Ga0501072_0000021 Ga0501072_0000021_89075_90622 488
239 3300049589 Ga0501073_0004234 Ga0501073_0004234_2062_3609 488
240 3300049590 Ga0501074_0000540 Ga0501074_0000540_13798_15345 488
241 3300049593 Ga0501077_0016678 Ga0501077_0016678_2257_3804 488
242 3300049741 Ga0501079_0002661 Ga0501079_0002661_7626_9173 488
243 3300049742 Ga0501080_0000875 Ga0501080_0000875_18895_20442 488
244 3300049823 Ga0501044_0081300 Ga0501044_0081300_930_2477 488
245 3300050512 nmdc:mga0n895_39756_c1 nmdc:mga0n895_39756_c1_486_2030 488
246 3300050514 nmdc:mga08x19_10855_c1 nmdc:mga08x19_10855_c1_3588_5132 488
247 3300050515 nmdc:mga0a205_5117_c1 nmdc:mga0a205_5117_c1_6591_8135 488
248 3300054114 Ga0501084_0000066 Ga0501084_0000066_18685_20232 488
249 3300060353 Ga0501082_0000370 Ga0501082_0000370_31028_32575 488
250 3300061734 Ga0530510_0022987 Ga0530510_0022987_323_1870 488
251 3300005337 Ga0070682_100008990 Ga0070682_1000089902 489
252 3300006058 Ga0075432_10000128 Ga0075432_100001289 489
253 3300006852 Ga0075433_10000223 Ga0075433_1000022327 489
254 3300006871 Ga0075434_100000419 Ga0075434_10000041926 489
255 3300007076 Ga0075435_100001108 Ga0075435_10000110817 489
256 3300009094 Ga0111539_10003119 Ga0111539_1000311917 489
257 3300027907 Ga0207428_10000696 Ga0207428_1000069640 489
258 3300049588 Ga0501072_0008206 Ga0501072_0008206_294_1829 489
259 3300050511 nmdc:mga08y16_34583_c1 nmdc:mga08y16_34583_c1_2962_4500 489
260 3300050513 nmdc:mga0rr50_5888_c1 nmdc:mga0rr50_5888_c1_2854_4392 489
261 3300005719 Ga0068861_100069056 Ga0068861_1000690563 490
262 3300006058 Ga0075432_10000401 Ga0075432_100004018 490
263 3300006353 Ga0075370_10044474 Ga0075370_100444742 490
264 3300006847 Ga0075431_100048484 Ga0075431_1000484843 490
265 3300006852 Ga0075433_10163010 Ga0075433_101630102 490
266 3300006871 Ga0075434_100252333 Ga0075434_1002523332 490
267 3300006880 Ga0075429_100043016 Ga0075429_1000430164 490
268 3300009094 Ga0111539_10016101 Ga0111539_100161013 490
269 3300009147 Ga0114129_10008045 Ga0114129_1000804512 490
270 3300009553 Ga0105249_10042752 Ga0105249_100427523 490
271 3300013306 Ga0163162_10242808 Ga0163162_102428081 490
272 3300013307 Ga0157372_10070507 Ga0157372_100705072 490
273 3300017792 Ga0163161_10078448 Ga0163161_100784482 490
274 3300025927 Ga0207687_10095691 Ga0207687_100956912 490
275 3300025961 Ga0207712_10012556 Ga0207712_100125564 490
276 3300025972 Ga0207668_10038484 Ga0207668_100384842 490
277 3300026041 Ga0207639_10135894 Ga0207639_101358942 490
278 3300026118 Ga0207675_100060762 Ga0207675_1000607622 490
279 3300027907 Ga0207428_10002628 Ga0207428_100026289 490
280 3300050507 nmdc:mga05p37_9378_c1 nmdc:mga05p37_9378_c1_6310_7848 490
281 3300050510 nmdc:mga06r32_114822_c1 nmdc:mga06r32_114822_c1_288_1826 490
282 3300050511 nmdc:mga08y16_18810_c1 nmdc:mga08y16_18810_c1_21_1559 490
283 3300050512 nmdc:mga0n895_8539_c1 nmdc:mga0n895_8539_c1_376_1914 490
284 3300050515 nmdc:mga0a205_20798_c1 nmdc:mga0a205_20798_c1_4637_6175 490
285 3300005329 Ga0070683_100001559 Ga0070683_10000155918 491
286 3300005336 Ga0070680_100006439 Ga0070680_1000064393 491
287 3300005458 Ga0070681_10045567 Ga0070681_100455673 491
288 3300006844 Ga0075428_100001080 Ga0075428_10000108021 491
289 3300006844 Ga0075428_100049422 Ga0075428_1000494223 491
290 3300006847 Ga0075431_100091632 Ga0075431_1000916323 491
291 3300009098 Ga0105245_10006615 Ga0105245_100066153 491
292 3300009148 Ga0105243_10033221 Ga0105243_100332212 491
293 3300010375 Ga0105239_10011907 Ga0105239_100119078 491
294 3300014745 Ga0157377_10038926 Ga0157377_100389262 491
295 3300025919 Ga0207657_10082024 Ga0207657_100820242 491
296 3300025927 Ga0207687_10009904 Ga0207687_100099042 491
297 3300025938 Ga0207704_10004443 Ga0207704_100044432 491
298 3300027907 Ga0207428_10000389 Ga0207428_1000038912 491
299 3300048907 Ga0496104_0007518 Ga0496104_0007518_8066_9595 491
300 3300048908 Ga0496105_0003345 Ga0496105_0003345_2018_3547 491
301 3300048917 Ga0496114_0006397 Ga0496114_0006397_7439_8968 491
302 3300049591 Ga0501075_0155388 Ga0501075_0155388_160_1695 491
303 3300050510 nmdc:mga06r32_99545_c1 nmdc:mga06r32_99545_c1_822_2363 491
304 iso_pu_bacteria 2816332119 2816421731 491
305 3300005331 Ga0070670_100000035 Ga0070670_100000035146 492
306 3300005347 Ga0070668_100003075 Ga0070668_1000030757 492
307 3300005367 Ga0070667_100001410 Ga0070667_1000014107 492
308 3300005548 Ga0070665_100016403 Ga0070665_1000164033 492
309 3300005618 Ga0068864_100001144 Ga0068864_10000114412 492
310 3300005841 Ga0068863_100002037 Ga0068863_10000203718 492
311 3300005842 Ga0068858_100056067 Ga0068858_1000560672 492
312 3300005843 Ga0068860_100001374 Ga0068860_10000137418 492
313 3300005844 Ga0068862_100000368 Ga0068862_10000036841 492
314 3300006847 Ga0075431_100002899 Ga0075431_1000028993 492
315 3300009177 Ga0105248_10007747 Ga0105248_1000774715 492
316 3300009553 Ga0105249_10000525 Ga0105249_1000052539 492
317 3300014968 Ga0157379_10003228 Ga0157379_1000322810 492
318 3300025901 Ga0207688_10084053 Ga0207688_100840531 492
319 3300025925 Ga0207650_10000350 Ga0207650_1000035022 492
320 3300025941 Ga0207711_10015908 Ga0207711_100159084 492
321 3300025961 Ga0207712_10002507 Ga0207712_100025074 492
322 3300025972 Ga0207668_10000035 Ga0207668_10000035105 492
323 3300025986 Ga0207658_10000300 Ga0207658_1000030019 492
324 3300026035 Ga0207703_10042135 Ga0207703_100421353 492
325 3300026088 Ga0207641_10006570 Ga0207641_1000657014 492
326 3300026095 Ga0207676_10000970 Ga0207676_1000097018 492
327 3300028379 Ga0268266_10004822 Ga0268266_100048228 492
328 3300028380 Ga0268265_10010277 Ga0268265_100102775 492
329 3300028381 Ga0268264_10000211 Ga0268264_1000021118 492
330 3300046463 Ga0495653_0047162 Ga0495653_0047162_1210_2748 492
331 3300048903 Ga0496100_0044860 Ga0496100_0044860_1105_2649 492
332 3300048904 Ga0496101_0028579 Ga0496101_0028579_1272_2816 492
333 3300048905 Ga0496102_0034834 Ga0496102_0034834_1675_3219 492
334 3300048910 Ga0496107_0005148 Ga0496107_0005148_4448_5992 492
335 3300048917 Ga0496114_0026428 Ga0496114_0026428_1695_3239 492
336 3300049591 Ga0501075_0036847 Ga0501075_0036847_198_1733 492
337 3300050507 nmdc:mga05p37_5324_c1 nmdc:mga05p37_5324_c1_6573_8153 492
338 3300050510 nmdc:mga06r32_4024_c1 nmdc:mga06r32_4024_c1_10149_11729 492
339 3300050512 nmdc:mga0n895_233326_c1 nmdc:mga0n895_233326_c1_276_1832 492
340 3300050513 nmdc:mga0rr50_28398_c1 nmdc:mga0rr50_28398_c1_2072_3628 492
341 3300050514 nmdc:mga08x19_14382_c1 nmdc:mga08x19_14382_c1_1862_3418 492
342 3300053080 Ga0500635_0000002 Ga0500635_0000002_148588_150129 492
343 iso_pu_bacteria 2791355123 2792750431 492
344 3300005334 Ga0068869_100011023 Ga0068869_1000110235 493
345 3300005337 Ga0070682_100059009 Ga0070682_1000590092 493
346 3300005338 Ga0068868_100033147 Ga0068868_1000331472 493
347 3300005341 Ga0070691_10007311 Ga0070691_100073113 493
348 3300005344 Ga0070661_100023704 Ga0070661_1000237045 493
349 3300005354 Ga0070675_100050339 Ga0070675_1000503394 493
350 3300005355 Ga0070671_100002658 Ga0070671_1000026585 493
351 3300005364 Ga0070673_100065309 Ga0070673_1000653093 493
352 3300005455 Ga0070663_100026651 Ga0070663_1000266512 493
353 3300005458 Ga0070681_10032056 Ga0070681_100320565 493
354 3300005530 Ga0070679_100046317 Ga0070679_1000463172 493
355 3300005539 Ga0068853_100057951 Ga0068853_1000579514 493
356 3300005547 Ga0070693_100010027 Ga0070693_1000100273 493
357 3300005548 Ga0070665_100030121 Ga0070665_1000301214 493
358 3300005617 Ga0068859_100102151 Ga0068859_1001021512 493
359 3300005840 Ga0068870_10007317 Ga0068870_100073173 493
360 3300005842 Ga0068858_100019078 Ga0068858_1000190786 493
361 3300006871 Ga0075434_100002360 Ga0075434_10000236016 493
362 3300006914 Ga0075436_100021410 Ga0075436_1000214103 493
363 3300006931 Ga0097620_100102151 Ga0097620_1001021512 493
364 3300007076 Ga0075435_100020797 Ga0075435_1000207974 493
365 3300009094 Ga0111539_10136153 Ga0111539_101361532 493
366 3300009174 Ga0105241_10007822 Ga0105241_100078225 493
367 3300009545 Ga0105237_10012749 Ga0105237_100127495 493
368 3300009551 Ga0105238_10034047 Ga0105238_100340473 493
369 3300011119 Ga0105246_10011537 Ga0105246_100115375 493
370 3300013104 Ga0157370_10016021 Ga0157370_100160215 493
371 3300013296 Ga0157374_10021287 Ga0157374_100212874 493
372 3300013307 Ga0157372_10034001 Ga0157372_100340014 493
373 3300025321 Ga0207656_10008776 Ga0207656_100087764 493
374 3300025907 Ga0207645_10076671 Ga0207645_100766712 493
375 3300025908 Ga0207643_10000243 Ga0207643_1000024329 493
376 3300025911 Ga0207654_10021804 Ga0207654_100218044 493
377 3300025912 Ga0207707_10039645 Ga0207707_100396455 493
378 3300025914 Ga0207671_10080078 Ga0207671_100800782 493
379 3300025919 Ga0207657_10022648 Ga0207657_100226484 493
380 3300025920 Ga0207649_10029971 Ga0207649_100299713 493
381 3300025925 Ga0207650_10003444 Ga0207650_100034445 493
382 3300025931 Ga0207644_10003384 Ga0207644_100033849 493
383 3300025942 Ga0207689_10000249 Ga0207689_1000024939 493
384 3300025944 Ga0207661_10077777 Ga0207661_100777772 493
385 3300025945 Ga0207679_10035527 Ga0207679_100355274 493
386 3300026023 Ga0207677_10010341 Ga0207677_100103414 493
387 3300026067 Ga0207678_10000437 Ga0207678_100004376 493
388 3300026078 Ga0207702_10017470 Ga0207702_100174705 493
389 3300026088 Ga0207641_10037979 Ga0207641_100379794 493
390 3300026095 Ga0207676_10014884 Ga0207676_100148845 493
391 3300026116 Ga0207674_10075803 Ga0207674_100758032 493
392 3300026118 Ga0207675_100079475 Ga0207675_1000794752 493
393 3300026121 Ga0207683_10002713 Ga0207683_1000271313 493
394 3300027907 Ga0207428_10010342 Ga0207428_100103426 493
395 3300028381 Ga0268264_10048217 Ga0268264_100482173 493
396 3300032002 Ga0307416_100030423 Ga0307416_1000304232 493
397 3300047318 Ga0495636_0006117 Ga0495636_0006117_1469_3055 493
398 3300048903 Ga0496100_0045981 Ga0496100_0045981_370_1908 493
399 3300048905 Ga0496102_0019108 Ga0496102_0019108_2106_3644 493
400 3300048907 Ga0496104_0000945 Ga0496104_0000945_15777_17315 493
401 3300048908 Ga0496105_0016680 Ga0496105_0016680_2503_4041 493
402 3300048913 Ga0496110_0017760 Ga0496110_0017760_2698_4236 493
403 3300048914 Ga0496111_0002200 Ga0496111_0002200_6903_8441 493
404 3300049568 Ga0501031_0078197 Ga0501031_0078197_356_1903 493
405 3300049572 Ga0501036_0006945 Ga0501036_0006945_5098_6645 493
406 3300049573 Ga0501037_0005761 Ga0501037_0005761_1850_3397 493
407 3300049575 Ga0501039_0009380 Ga0501039_0009380_4121_5668 493
408 3300049577 Ga0501041_0005227 Ga0501041_0005227_5486_7033 493
409 3300049578 Ga0501042_0000023 Ga0501042_0000023_17438_18985 493
410 3300049580 Ga0501046_0001000 Ga0501046_0001000_82_1629 493
411 3300049582 Ga0501048_0002635 Ga0501048_0002635_4625_6172 493
412 3300049590 Ga0501074_0000080 Ga0501074_0000080_16006_17553 493
413 3300049592 Ga0501076_0000018 Ga0501076_0000018_64764_66311 493
414 3300049741 Ga0501079_0000128 Ga0501079_0000128_33147_34694 493
415 3300049743 Ga0501081_0000388 Ga0501081_0000388_7555_9102 493
416 3300049824 Ga0501045_0002399 Ga0501045_0002399_4231_5778 493
417 3300050511 nmdc:mga08y16_25120_c1 nmdc:mga08y16_25120_c1_4100_5638 493
418 3300050512 nmdc:mga0n895_16542_c1 nmdc:mga0n895_16542_c1_2801_4339 493
419 3300050513 nmdc:mga0rr50_31480_c1 nmdc:mga0rr50_31480_c1_1586_3124 493
420 3300050515 nmdc:mga0a205_9999_c1 nmdc:mga0a205_9999_c1_2713_4251 493
421 3300054114 Ga0501084_0002767 Ga0501084_0002767_8393_9940 493
422 3300060353 Ga0501082_0000096 Ga0501082_0000096_61900_63447 493
423 3300061734 Ga0530510_0005350 Ga0530510_0005350_431_1978 493
424 3300001990 JGI24737J22298_10016553 JGI24737J22298_100165532 494
425 3300002077 JGI24744J21845_10002141 JGI24744J21845_100021412 494
426 3300005338 Ga0068868_100020539 Ga0068868_1000205393 494
427 3300005440 Ga0070705_100013186 Ga0070705_1000131865 494
428 3300005547 Ga0070693_100009124 Ga0070693_1000091244 494
429 3300005548 Ga0070665_100009895 Ga0070665_1000098958 494
430 3300005617 Ga0068859_100026120 Ga0068859_1000261205 494
431 3300005842 Ga0068858_100022804 Ga0068858_1000228045 494
432 3300005843 Ga0068860_100040544 Ga0068860_1000405442 494
433 3300006844 Ga0075428_100012937 Ga0075428_1000129375 494
434 3300006846 Ga0075430_100020890 Ga0075430_1000208902 494
435 3300006847 Ga0075431_100025609 Ga0075431_1000256093 494
436 3300006931 Ga0097620_100026120 Ga0097620_1000261202 494
437 3300009094 Ga0111539_10071752 Ga0111539_100717525 494
438 3300009098 Ga0105245_10034154 Ga0105245_100341544 494
439 3300009147 Ga0114129_10048945 Ga0114129_100489453 494
440 3300013308 Ga0157375_10020699 Ga0157375_100206992 494
441 3300021388 Ga0213875_10001707 Ga0213875_1000170710 494
442 3300025900 Ga0207710_10018775 Ga0207710_100187752 494
443 3300025901 Ga0207688_10013532 Ga0207688_100135324 494
444 3300025927 Ga0207687_10019774 Ga0207687_100197743 494
445 3300025981 Ga0207640_10044861 Ga0207640_100448612 494
446 3300026023 Ga0207677_10057890 Ga0207677_100578902 494
447 3300026035 Ga0207703_10010366 Ga0207703_100103665 494
448 3300026041 Ga0207639_10015825 Ga0207639_100158252 494
449 3300028379 Ga0268266_10019025 Ga0268266_100190252 494
450 3300032002 Ga0307416_100073663 Ga0307416_1000736632 494
451 3300037853 Ga0436364_0520686 Ga0436364_0520686_9752_11314 494
452 3300048911 Ga0496108_0004591 Ga0496108_0004591_1262_2806 494
453 3300048912 Ga0496109_0014891 Ga0496109_0014891_2554_4098 494
454 3300048915 Ga0496112_0082892 Ga0496112_0082892_1520_3064 494
455 3300048916 Ga0496113_0068008 Ga0496113_0068008_969_2513 494
456 3300050507 nmdc:mga05p37_17542_c1 nmdc:mga05p37_17542_c1_2150_3697 494
457 3300050507 nmdc:mga05p37_3524_c1 nmdc:mga05p37_3524_c1_11280_12821 494
458 3300050509 nmdc:mga0qj67_21617_c1 nmdc:mga0qj67_21617_c1_2089_3636 494
459 3300050510 nmdc:mga06r32_34298_c1 nmdc:mga06r32_34298_c1_1713_3260 494
460 3300039437 Ga0436365_1837480 Ga0436365_1837480_1124_2668 495
461 3300046463 Ga0495653_0064725 Ga0495653_0064725_1125_2669 495
462 3300048905 Ga0496102_0031931 Ga0496102_0031931_1322_2866 495
463 3300048906 Ga0496103_0047692 Ga0496103_0047692_562_2106 495
464 3300048908 Ga0496105_0007722 Ga0496105_0007722_2598_4142 495
465 3300048909 Ga0496106_0052975 Ga0496106_0052975_322_1866 495
466 3300048910 Ga0496107_0024327 Ga0496107_0024327_242_1786 495
467 3300048912 Ga0496109_0007052 Ga0496109_0007052_1066_2610 495
468 3300048913 Ga0496110_0180546 Ga0496110_0180546_178_1722 495
469 3300048918 Ga0496115_0043343 Ga0496115_0043343_2019_3563 495
470 3300050507 nmdc:mga05p37_4509_c1 nmdc:mga05p37_4509_c1_144_1688 495
471 3300050507 nmdc:mga05p37_54421_c1 nmdc:mga05p37_54421_c1_167_1711 495
472 3300050508 nmdc:mga09592_54213_c1 nmdc:mga09592_54213_c1_167_1711 495
473 3300050509 nmdc:mga0qj67_53991_c1 nmdc:mga0qj67_53991_c1_1342_2886 495
474 3300050510 nmdc:mga06r32_53883_c1 nmdc:mga06r32_53883_c1_2146_3690 495
475 3300050511 nmdc:mga08y16_54045_c1 nmdc:mga08y16_54045_c1_2503_4047 495
476 3300050512 nmdc:mga0n895_239584_c1 nmdc:mga0n895_239584_c1_203_1747 495
477 3300050512 nmdc:mga0n895_5958_c1 nmdc:mga0n895_5958_c1_5614_7158 495
478 3300050515 nmdc:mga0a205_13740_c1 nmdc:mga0a205_13740_c1_5822_7366 495
479 3300013297 Ga0157378_10193385 Ga0157378_101933851 496
480 3300025981 Ga0207640_10017095 Ga0207640_100170953 496
481 3300005331 Ga0070670_100128030 Ga0070670_1001280301 497
482 3300005347 Ga0070668_100073071 Ga0070668_1000730712 497
483 3300005617 Ga0068859_100107117 Ga0068859_1001071172 497
484 3300005834 Ga0068851_10007861 Ga0068851_100078613 497
485 3300006871 Ga0075434_100207380 Ga0075434_1002073802 497
486 3300006880 Ga0075429_100039287 Ga0075429_1000392872 497
487 3300006931 Ga0097620_100107110 Ga0097620_1001071102 497
488 3300009094 Ga0111539_10144765 Ga0111539_101447651 497
489 3300009098 Ga0105245_10038926 Ga0105245_100389262 497
490 3300009176 Ga0105242_10007684 Ga0105242_100076845 497
491 3300013297 Ga0157378_10069459 Ga0157378_100694592 497
492 3300013306 Ga0163162_10208355 Ga0163162_102083552 497
493 3300014325 Ga0163163_10086840 Ga0163163_100868402 497
494 3300025321 Ga0207656_10051971 Ga0207656_100519711 497
495 3300025907 Ga0207645_10036558 Ga0207645_100365582 497
496 3300025912 Ga0207707_10015567 Ga0207707_100155675 497
497 3300025921 Ga0207652_10061184 Ga0207652_100611843 497
498 3300025944 Ga0207661_10063855 Ga0207661_100638553 497
499 3300026089 Ga0207648_10029297 Ga0207648_100292976 497
500 3300026095 Ga0207676_10199476 Ga0207676_101994761 497
501 3300026116 Ga0207674_10019194 Ga0207674_100191942 497
502 3300050507 nmdc:mga05p37_45124_c1 nmdc:mga05p37_45124_c1_926_2521 497
503 3300050508 nmdc:mga09592_65422_c1 nmdc:mga09592_65422_c1_589_2184 497
504 3300050512 nmdc:mga0n895_155955_c1 nmdc:mga0n895_155955_c1_387_1982 497
505 3300050512 nmdc:mga0n895_166409_c1 nmdc:mga0n895_166409_c1_490_2088 497
506 3300050515 nmdc:mga0a205_63025_c1 nmdc:mga0a205_63025_c1_492_2087 497
507 3300005295 Ga0065707_10095396 Ga0065707_100953963 498
508 3300005344 Ga0070661_100011619 Ga0070661_1000116196 498
509 3300005354 Ga0070675_100038923 Ga0070675_1000389233 498
510 3300005457 Ga0070662_100003735 Ga0070662_1000037353 498
511 3300005564 Ga0070664_100125189 Ga0070664_1001251892 498
512 3300005577 Ga0068857_100097540 Ga0068857_1000975402 498
513 3300005719 Ga0068861_100085247 Ga0068861_1000852471 498
514 3300005844 Ga0068862_100010849 Ga0068862_1000108492 498
515 3300009553 Ga0105249_10009115 Ga0105249_100091158 498
516 3300013306 Ga0163162_10010790 Ga0163162_100107903 498
517 3300025923 Ga0207681_10106805 Ga0207681_101068051 498
518 3300025933 Ga0207706_10014041 Ga0207706_100140413 498
519 3300025945 Ga0207679_10074994 Ga0207679_100749942 498
520 3300025961 Ga0207712_10083386 Ga0207712_100833862 498
521 3300026088 Ga0207641_10103248 Ga0207641_101032482 498
522 3300026116 Ga0207674_10015718 Ga0207674_100157183 498
523 3300014497 Ga0182008_10002548 Ga0182008_100025489 499
524 3300015262 Ga0182007_10002312 Ga0182007_1000231210 499
525 3300027876 Ga0209974_10002211 Ga0209974_100022116 501
526 3300005577 Ga0068857_100012211 Ga0068857_1000122114 503
527 3300005841 Ga0068863_100008569 Ga0068863_1000085692 503
528 3300010375 Ga0105239_10071410 Ga0105239_100714103 503
529 3300026088 Ga0207641_10015259 Ga0207641_100152594 503
530 3300026116 Ga0207674_10020541 Ga0207674_100205414 503
531 3300048912 Ga0496109_0014955 Ga0496109_0014955_622_2187 503
532 3300048915 Ga0496112_0074910 Ga0496112_0074910_1762_3327 503
533 3300048918 Ga0496115_0054661 Ga0496115_0054661_740_2305 503
534 3300005458 Ga0070681_10000470 Ga0070681_1000047010 508
535 3300005530 Ga0070679_100003126 Ga0070679_1000031263 508
536 3300009551 Ga0105238_10083586 Ga0105238_100835862 508
537 3300013100 Ga0157373_10007041 Ga0157373_100070413 508
538 3300013104 Ga0157370_10003313 Ga0157370_1000331314 508
539 3300025912 Ga0207707_10002452 Ga0207707_1000245212 508
540 3300025920 Ga0207649_10005130 Ga0207649_100051305 508
541 3300025921 Ga0207652_10005044 Ga0207652_100050442 508
542 3300006846 Ga0075430_100077355 Ga0075430_1000773553 510
543 3300048913 Ga0496110_0058758 Ga0496110_0058758_339_2024 545
544 3300048927 Ga0496124_0000003 Ga0496124_0000003_679865_681550 545
545 2162886007 SwRhRL2b_contig_2292377 SwRhRL2b_0677.00001940 556
546 2162886007 SwRhRL2b_contig_773127 SwRhRL2b_0863.00006830 556
547 3300005289 Ga0065704_10070132 Ga0065704_100701321108 556

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00884

Sulfatase

Sulfatase

5

57

0.92

PF00884

Sulfatase

Sulfatase

55

321

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aj0-assembly1.cif.gz_F crystal structure of psfucs1 sulfatase from pseudoalteromonas sp. 0.7701 23 487
1e3c-assembly1.cif.gz_P-2 crystal structure of an arylsulfatase a mutant c69s soaked in synthetic substrate 0.7602 23 447
1n2l-assembly1.cif.gz_A-2 crystal structure of a covalent intermediate of endogenous human arylsulfatase a 0.7572 23 447
1n2k-assembly1.cif.gz_A crystal structure of a covalent intermediate of endogenous human arylsulfatase a 0.7547 23 447
1p49-assembly1.cif.gz_A structure of human placental estrone/dhea sulfatase 0.7393 22 495
ID Description Score Start End Superfamily
af_P25549_453_517_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.741 393 449 3.40.720.10
1e1zP01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7314 23 392 3.40.720.10
af_A0A0G2KLG3_35_301_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7199 24 284 3.40.720.10
af_A0A286Y802_23_363_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7113 24 387 3.40.720.10
af_A0A286Y802_23_363_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7073 24 387 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A6J4YUP1-F1-model_v4 Arylsulfatase (EC) (EC 3.1.6.1) 0.9549 327 416 GO:0004065
AF-A0A550GM52-F1-model_v4 Arylsulfatase 0.9413 21 286
AF-A0A3N5WUI1-F1-model_v4 Arylsulfatase 0.9261 20 217
AF-A0A6J4YUP1-F1-model_v4 Arylsulfatase (EC) (EC 3.1.6.1) 0.9253 327 416 GO:0004065
AF-A0A7W8CK73-F1-model_v4 Arylsulfatase A-like enzyme 0.9213 20 244

Feature Viewer

pLDDT pTM Quality
74.07 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map