F462070

General Info

Members Datasets Scaffolds Average Seq Length
547 247 1094 137

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100050871|Ga0070675_1000508713
Length 162
Sequence MINGFSSAATRRICKCLGAGRVHHYADGVSERLPAIKVMMMPKDTNAHGTIFGGVILSNIDLASAVEAFKVAPHLYVTKAMREVDFHEPVYTGDLVSFFTSTVRVGRTSVTVRVEVEAERWGLDGSRHRTGRGERVKVTEAEVILVAVDPDGHPVPVRPEPS

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 0.73
Rhizosphere 97.81
Stem 0
Stem Tuber 0
Unclassified 26.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100050871 3300005354 Bacteria 3403
2 Ga0065704_10224290 3300005289 Bacteria 1064
3 Ga0065715_10220549 3300005293 Unclassified 1263
4 Ga0065707_10124955 3300005295 Bacteria 2033
5 Ga0070676_10183986 3300005328 Unclassified 1360
6 Ga0070676_10196144 3300005328 Bacteria 1321
7 Ga0070683_100138297 3300005329 Unclassified 2307
8 Ga0070683_100400854 3300005329 Unclassified 1308
9 Ga0070690_100012663 3300005330 Unclassified 4965
10 Ga0070690_100402931 3300005330 Unclassified 1005
11 Ga0070690_100744844 3300005330 Bacteria 756
12 Ga0070670_100045775 3300005331 Bacteria 3761
13 Ga0070670_100078527 3300005331 Bacteria 2835
14 Ga0070670_100389165 3300005331 Unclassified 1229
15 Ga0070670_100425058 3300005331 Unclassified 1175
16 Ga0070670_101734791 3300005331 Unclassified 575
17 Ga0070670_101911048 3300005331 Bacteria 547
18 Ga0070677_10046965 3300005333 Bacteria 1729
19 Ga0070677_10147425 3300005333 Unclassified 1092
20 Ga0070677_10152538 3300005333 Bacteria 1077
21 Ga0068869_100089095 3300005334 Bacteria 2317
22 Ga0068869_100859266 3300005334 Bacteria 783
23 Ga0068869_100894216 3300005334 Unclassified 768
24 Ga0070666_10556090 3300005335 Unclassified 835
25 Ga0070666_10598138 3300005335 Bacteria 805
26 Ga0070680_100187144 3300005336 Bacteria 1744
27 Ga0070680_100736460 3300005336 Bacteria 849
28 Ga0070682_100606768 3300005337 Unclassified 865
29 Ga0070682_100936443 3300005337 Unclassified 714
30 Ga0070682_101242217 3300005337 Bacteria 630
31 Ga0068868_100085749 3300005338 Bacteria 2531
32 Ga0068868_100274848 3300005338 Unclassified 1424
33 Ga0070689_100226210 3300005340 Bacteria 1536
34 Ga0070689_100445053 3300005340 Bacteria 1101
35 Ga0070689_100505001 3300005340 Bacteria 1036
36 Ga0070689_101087102 3300005340 Bacteria 714
37 Ga0070689_102036369 3300005340 Unclassified 525
38 Ga0070661_100482818 3300005344 Bacteria 990
39 Ga0070692_10311186 3300005345 Bacteria 965
40 Ga0070668_100297066 3300005347 Unclassified 1354
41 Ga0070668_100924010 3300005347 Bacteria 781
42 Ga0070669_100001725 3300005353 Bacteria 15791
43 Ga0070669_100757597 3300005353 Bacteria 823
44 Ga0070669_100855051 3300005353 Unclassified 775
45 Ga0070675_100000024 3300005354 Bacteria 117191
46 Ga0070675_100003328 3300005354 Bacteria 12182
47 Ga0070675_100007696 3300005354 Bacteria 8339
48 Ga0070675_100278427 3300005354 Bacteria 1469
49 Ga0070675_100506535 3300005354 Bacteria 1088
50 Ga0070675_100603209 3300005354 Bacteria 996
51 Ga0070675_101837867 3300005354 Bacteria 559
52 Ga0070671_100016211 3300005355 Bacteria 6026
53 Ga0070671_100062767 3300005355 Bacteria 3093
54 Ga0070671_100400102 3300005355 Bacteria 1175
55 Ga0070674_100012107 3300005356 Bacteria 5285
56 Ga0070674_100495198 3300005356 Bacteria 1017
57 Ga0070674_101162274 3300005356 Bacteria 684
58 Ga0070674_101248618 3300005356 Unclassified 661
59 Ga0070673_100032100 3300005364 Bacteria 3949
60 Ga0070673_100053897 3300005364 Bacteria 3162
61 Ga0070673_100290455 3300005364 Bacteria 1437
62 Ga0070673_100838087 3300005364 Bacteria 850
63 Ga0070688_100086809 3300005365 Bacteria 2036
64 Ga0070688_100154304 3300005365 Bacteria 1572
65 Ga0070688_100336138 3300005365 Unclassified 1101
66 Ga0070659_100863136 3300005366 Unclassified 789
67 Ga0070667_100348889 3300005367 Unclassified 1339
68 Ga0070667_100498600 3300005367 Bacteria 1116
69 Ga0070667_101368474 3300005367 Unclassified 664
70 Ga0070713_100015856 3300005436 Bacteria 5649
71 Ga0070711_101397381 3300005439 Bacteria 609
72 Ga0070700_100000002 3300005441 Bacteria 261904
73 Ga0070700_100029634 3300005441 Bacteria 3265
74 Ga0070694_100067009 3300005444 Bacteria 2464
75 Ga0070694_100326322 3300005444 Bacteria 1183
76 Ga0070694_100592071 3300005444 Bacteria 892
77 Ga0070708_100558781 3300005445 Bacteria 1079
78 Ga0070708_101010751 3300005445 Bacteria 780
79 Ga0070663_100357419 3300005455 Bacteria 1184
80 Ga0070663_100645003 3300005455 Bacteria 895
81 Ga0070678_100988148 3300005456 Bacteria 773
82 Ga0070662_100028586 3300005457 Bacteria 3881
83 Ga0070662_100533429 3300005457 Bacteria 982
84 Ga0070681_10003907 3300005458 Bacteria 14046
85 Ga0070681_10388219 3300005458 Unclassified 1307
86 Ga0068867_100000757 3300005459 Bacteria 21740
87 Ga0068867_101915907 3300005459 Unclassified 559
88 Ga0070685_10061102 3300005466 Bacteria 2205
89 Ga0070706_100387019 3300005467 Bacteria 1302
90 Ga0070698_100002296 3300005471 Bacteria 21164
91 Ga0070698_100065100 3300005471 Bacteria 3671
92 Ga0070698_100082012 3300005471 Bacteria 3218
93 Ga0070698_100372702 3300005471 Bacteria 1360
94 Ga0070699_100000125 3300005518 Bacteria 70893
95 Ga0070699_100024220 3300005518 Bacteria 5230
96 Ga0070679_100006401 3300005530 Bacteria 10967
97 Ga0070684_100077519 3300005535 Bacteria 2935
98 Ga0070684_101960301 3300005535 Bacteria 553
99 Ga0070697_100383841 3300005536 Bacteria 1217
100 Ga0068853_100026432 3300005539 Bacteria 4873
101 Ga0068853_100072291 3300005539 Bacteria 3005
102 Ga0068853_100212326 3300005539 Bacteria 1764
103 Ga0068853_100278163 3300005539 Unclassified 1543
104 Ga0068853_100331096 3300005539 Bacteria 1413
105 Ga0070672_100068478 3300005543 Unclassified 2815
106 Ga0070672_100315505 3300005543 Bacteria 1328
107 Ga0070672_100629096 3300005543 Unclassified 936
108 Ga0070672_100775338 3300005543 Bacteria 843
109 Ga0070686_100231958 3300005544 Bacteria 1339
110 Ga0070686_100531151 3300005544 Bacteria 917
111 Ga0070695_100306552 3300005545 Unclassified 1176
112 Ga0070696_100025137 3300005546 Bacteria 4048
113 Ga0070704_100002276 3300005549 Bacteria 10729
114 Ga0070704_100055454 3300005549 Bacteria 2810
115 Ga0068855_100442093 3300005563 Unclassified 1420
116 Ga0068855_100463428 3300005563 Bacteria 1382
117 Ga0068855_101220552 3300005563 Unclassified 781
118 Ga0070664_100069640 3300005564 Unclassified 3010
119 Ga0070664_100292647 3300005564 Bacteria 1470
120 Ga0070664_100426929 3300005564 Bacteria 1215
121 Ga0070664_101007328 3300005564 Unclassified 783
122 Ga0068857_100076262 3300005577 Bacteria 2990
123 Ga0068857_100137455 3300005577 Bacteria 2207
124 Ga0068857_100168182 3300005577 Unclassified 1992
125 Ga0068857_100253294 3300005577 Bacteria 1614
126 Ga0068854_100139357 3300005578 Bacteria 1860
127 Ga0068854_100249457 3300005578 Bacteria 1417
128 Ga0068854_100269113 3300005578 Bacteria 1367
129 Ga0068854_100943656 3300005578 Bacteria 761
130 Ga0068856_100754612 3300005614 Unclassified 993
131 Ga0070702_100305421 3300005615 Bacteria 1102
132 Ga0070702_101422694 3300005615 Bacteria 568
133 Ga0068852_100033477 3300005616 Unclassified 4267
134 Ga0068852_100079806 3300005616 Unclassified 2900
135 Ga0068852_100283622 3300005616 Bacteria 1598
136 Ga0068859_100003448 3300005617 Bacteria 16077
137 Ga0068859_100018392 3300005617 Bacteria 7025
138 Ga0068859_100125035 3300005617 Bacteria 2640
139 Ga0068859_101189335 3300005617 Bacteria 839
140 Ga0068864_100014850 3300005618 Bacteria 6470
141 Ga0068864_100015076 3300005618 Bacteria 6424
142 Ga0068864_100064767 3300005618 Bacteria 3170
143 Ga0068864_100347604 3300005618 Bacteria 1398
144 Ga0068864_100436750 3300005618 Bacteria 1250
145 Ga0068861_100010794 3300005719 Bacteria 6348
146 Ga0068861_100211507 3300005719 Bacteria 1634
147 Ga0068861_100668907 3300005719 Bacteria 961
148 Ga0068861_101189691 3300005719 Unclassified 737
149 Ga0068861_101201812 3300005719 Bacteria 733
150 Ga0068851_10056642 3300005834 Bacteria 2000
151 Ga0068870_10012119 3300005840 Bacteria 4020
152 Ga0068870_10016365 3300005840 Bacteria 3541
153 Ga0068870_10298640 3300005840 Bacteria 1016
154 Ga0068870_10316988 3300005840 Bacteria 989
155 Ga0068870_10336918 3300005840 Unclassified 963
156 Ga0068870_10625045 3300005840 Bacteria 735
157 Ga0068863_100188316 3300005841 Unclassified 1983
158 Ga0068863_100462826 3300005841 Unclassified 1245
159 Ga0068858_100026280 3300005842 Bacteria 5412
160 Ga0068858_100180995 3300005842 Bacteria 1990
161 Ga0068858_100258474 3300005842 Bacteria 1655
162 Ga0068858_100277686 3300005842 Bacteria 1595
163 Ga0068858_100282972 3300005842 Bacteria 1579
164 Ga0068860_100037980 3300005843 Bacteria 4608
165 Ga0068860_100128640 3300005843 Bacteria 2428
166 Ga0068860_100244281 3300005843 Unclassified 1746
167 Ga0068860_100674486 3300005843 Bacteria 1042
168 Ga0068860_101265292 3300005843 Unclassified 758
169 Ga0068862_100001109 3300005844 Bacteria 25557
170 Ga0068862_100013812 3300005844 Bacteria 6692
171 Ga0068862_100019699 3300005844 Bacteria 5632
172 Ga0070717_10000237 3300006028 Bacteria 37986
173 Ga0097621_101765641 3300006237 Unclassified 589
174 Ga0068871_100517901 3300006358 Unclassified 1077
175 Ga0068871_100570663 3300006358 Bacteria 1026
176 Ga0075428_100804900 3300006844 Bacteria 999
177 Ga0075431_100248945 3300006847 Bacteria 1806
178 Ga0075433_10810456 3300006852 Unclassified 818
179 Ga0075434_100348575 3300006871 Bacteria 1502
180 Ga0075429_100154338 3300006880 Bacteria 2010
181 Ga0075429_100987402 3300006880 Bacteria 736
182 Ga0068865_100077992 3300006881 Bacteria 2369
183 Ga0068865_100260120 3300006881 Bacteria 1374
184 Ga0068865_100691208 3300006881 Bacteria 871
185 Ga0075436_100121191 3300006914 Bacteria 1830
186 Ga0097620_100003447 3300006931 Bacteria 16077
187 Ga0097620_100018392 3300006931 Bacteria 7025
188 Ga0097620_100125032 3300006931 Bacteria 2640
189 Ga0097620_101189381 3300006931 Bacteria 839
190 Ga0075435_100000809 3300007076 Bacteria 19486
191 Ga0105244_10152157 3300009036 Unclassified 1108
192 Ga0105240_10012687 3300009093 Bacteria 11612
193 Ga0105240_10065210 3300009093 Bacteria 4521
194 Ga0105240_10319145 3300009093 Bacteria 1771
195 Ga0111539_10006567 3300009094 Bacteria 14988
196 Ga0111539_10044074 3300009094 Bacteria 5346
197 Ga0111539_10176340 3300009094 Bacteria 2497
198 Ga0111539_10334607 3300009094 Bacteria 1762
199 Ga0111539_10690356 3300009094 Bacteria 1188
200 Ga0111539_11692745 3300009094 Bacteria 733
201 Ga0111539_12787850 3300009094 Bacteria 566
202 Ga0111539_13368252 3300009094 Bacteria 514
203 Ga0105245_10001495 3300009098 Bacteria 21144
204 Ga0105245_10662746 3300009098 Unclassified 1074
205 Ga0105247_10003466 3300009101 Bacteria 10285
206 Ga0105247_10345509 3300009101 Bacteria 1045
207 Ga0114129_10003896 3300009147 Bacteria 21055
208 Ga0114129_10167465 3300009147 Bacteria 2998
209 Ga0105241_10026692 3300009174 Unclassified 4298
210 Ga0105241_10036188 3300009174 Unclassified 3715
211 Ga0105242_10005775 3300009176 Bacteria 9535
212 Ga0105242_12605676 3300009176 Bacteria 555
213 Ga0105248_11814565 3300009177 Unclassified 692
214 Ga0105248_12143420 3300009177 Bacteria 636
215 Ga0105237_10022608 3300009545 Bacteria 6450
216 Ga0105238_10541588 3300009551 Bacteria 1168
217 Ga0105249_10005649 3300009553 Bacteria 10823
218 Ga0105249_10043703 3300009553 Bacteria 4075
219 Ga0105249_10347320 3300009553 Bacteria 1502
220 Ga0105249_10549277 3300009553 Unclassified 1205
221 Ga0105249_11254625 3300009553 Bacteria 812
222 Ga0105249_12584374 3300009553 Unclassified 580
223 Ga0105239_10016940 3300010375 Bacteria 8055
224 Ga0105239_10261445 3300010375 Unclassified 1945
225 Ga0157373_10069235 3300013100 Unclassified 2495
226 Ga0157373_10196963 3300013100 Unclassified 1420
227 Ga0157373_10603369 3300013100 Bacteria 799
228 Ga0157371_10208248 3300013102 Bacteria 1403
229 Ga0157371_10911654 3300013102 Unclassified 667
230 Ga0157370_10019872 3300013104 Bacteria 6720
231 Ga0157369_10022825 3300013105 Bacteria 6977
232 Ga0157369_10159102 3300013105 Bacteria 2385
233 Ga0157374_10490955 3300013296 Bacteria 1232
234 Ga0157374_11186240 3300013296 Bacteria 785
235 Ga0157374_11472644 3300013296 Bacteria 704
236 Ga0157374_12986735 3300013296 Unclassified 500
237 Ga0157378_10502089 3300013297 Bacteria 1212
238 Ga0163162_10046216 3300013306 Bacteria 4363
239 Ga0163162_10078299 3300013306 Bacteria 3371
240 Ga0163162_10170464 3300013306 Bacteria 2301
241 Ga0163162_10479235 3300013306 Bacteria 1376
242 Ga0163162_10577851 3300013306 Bacteria 1251
243 Ga0163162_10796031 3300013306 Bacteria 1063
244 Ga0163162_10848097 3300013306 Bacteria 1029
245 Ga0163162_10878579 3300013306 Bacteria 1010
246 Ga0163162_10904214 3300013306 Unclassified 996
247 Ga0163162_11188873 3300013306 Bacteria 865
248 Ga0157372_10017804 3300013307 Bacteria 7630
249 Ga0157372_10069802 3300013307 Bacteria 3952
250 Ga0157372_10161926 3300013307 Unclassified 2586
251 Ga0157372_10609884 3300013307 Unclassified 1272
252 Ga0157372_13385300 3300013307 Bacteria 507
253 Ga0157375_10003988 3300013308 Bacteria 12806
254 Ga0157375_10090125 3300013308 Unclassified 3125
255 Ga0157375_10753872 3300013308 Unclassified 1125
256 Ga0157375_12269219 3300013308 Unclassified 647
257 Ga0163163_10181442 3300014325 Bacteria 2152
258 Ga0163163_10924919 3300014325 Bacteria 935
259 Ga0163163_11035532 3300014325 Bacteria 884
260 Ga0157380_10002784 3300014326 Bacteria 11883
261 Ga0157380_10173621 3300014326 Bacteria 1886
262 Ga0157380_10192986 3300014326 Bacteria 1800
263 Ga0157377_10000058 3300014745 Bacteria 86728
264 Ga0157377_10072935 3300014745 Bacteria 1988
265 Ga0157377_10182754 3300014745 Bacteria 1320
266 Ga0157379_10301200 3300014968 Bacteria 1461
267 Ga0157379_11184673 3300014968 Bacteria 734
268 Ga0157376_12192682 3300014969 Unclassified 591
269 Ga0163161_10320454 3300017792 Unclassified 1225
270 Ga0163161_10590567 3300017792 Unclassified 914
271 Ga0207697_10086907 3300025315 Bacteria 1322
272 Ga0207655_1088683 3300025728 Unclassified 1094
273 Ga0207653_10102537 3300025885 Bacteria 1013
274 Ga0207653_10252681 3300025885 Bacteria 676
275 Ga0207682_10045710 3300025893 Bacteria 1797
276 Ga0207682_10087853 3300025893 Bacteria 1343
277 Ga0207682_10558011 3300025893 Bacteria 541
278 Ga0207642_10402575 3300025899 Unclassified 819
279 Ga0207642_10764210 3300025899 Unclassified 613
280 Ga0207710_10008813 3300025900 Bacteria 4247
281 Ga0207710_10243844 3300025900 Unclassified 897
282 Ga0207688_10466122 3300025901 Unclassified 789
283 Ga0207680_10032763 3300025903 Bacteria 2958
284 Ga0207680_10989600 3300025903 Unclassified 602
285 Ga0207647_10188344 3300025904 Bacteria 1196
286 Ga0207647_10419408 3300025904 Viruses 753
287 Ga0207645_10020134 3300025907 Bacteria 4368
288 Ga0207645_10198421 3300025907 Bacteria 1320
289 Ga0207645_10856594 3300025907 Bacteria 618
290 Ga0207643_10005378 3300025908 Bacteria 6854
291 Ga0207643_10033602 3300025908 Bacteria 2870
292 Ga0207643_10077679 3300025908 Bacteria 1920
293 Ga0207654_10546714 3300025911 Bacteria 822
294 Ga0207707_10002236 3300025912 Bacteria 17492
295 Ga0207707_10252376 3300025912 Unclassified 1532
296 Ga0207695_10096943 3300025913 Bacteria 2950
297 Ga0207695_10268027 3300025913 Bacteria 1604
298 Ga0207671_10037863 3300025914 Bacteria 3576
299 Ga0207660_10133430 3300025917 Bacteria 1892
300 Ga0207660_10391305 3300025917 Bacteria 1118
301 Ga0207662_10007919 3300025918 Bacteria 5787
302 Ga0207662_10065318 3300025918 Bacteria 2191
303 Ga0207649_10335718 3300025920 Unclassified 1114
304 Ga0207649_10573377 3300025920 Bacteria 866
305 Ga0207652_10051095 3300025921 Bacteria 3543
306 Ga0207681_10005104 3300025923 Bacteria 8068
307 Ga0207681_10716734 3300025923 Bacteria 832
308 Ga0207681_10906167 3300025923 Unclassified 738
309 Ga0207650_10008692 3300025925 Bacteria 6934
310 Ga0207650_10203410 3300025925 Unclassified 1587
311 Ga0207650_10311240 3300025925 Bacteria 1288
312 Ga0207650_11082357 3300025925 Bacteria 682
313 Ga0207650_11499463 3300025925 Unclassified 573
314 Ga0207659_10000029 3300025926 Bacteria 129487
315 Ga0207659_10000110 3300025926 Bacteria 48302
316 Ga0207659_10019499 3300025926 Bacteria 4467
317 Ga0207659_10020873 3300025926 Bacteria 4338
318 Ga0207659_10046423 3300025926 Bacteria 3067
319 Ga0207659_10268071 3300025926 Bacteria 1392
320 Ga0207659_10953808 3300025926 Bacteria 738
321 Ga0207687_10043983 3300025927 Bacteria 3079
322 Ga0207687_10202547 3300025927 Bacteria 1552
323 Ga0207700_10007354 3300025928 Bacteria 6725
324 Ga0207644_10356419 3300025931 Unclassified 1189
325 Ga0207644_11253195 3300025931 Bacteria 623
326 Ga0207690_10444539 3300025932 Bacteria 1041
327 Ga0207690_10863252 3300025932 Unclassified 750
328 Ga0207690_10994330 3300025932 Bacteria 698
329 Ga0207706_10203235 3300025933 Unclassified 1737
330 Ga0207706_11406679 3300025933 Unclassified 572
331 Ga0207709_10782226 3300025935 Unclassified 769
332 Ga0207670_10021778 3300025936 Bacteria 3959
333 Ga0207669_10220765 3300025937 Unclassified 1391
334 Ga0207669_10239874 3300025937 Unclassified 1343
335 Ga0207669_11956323 3300025937 Unclassified 501
336 Ga0207704_10008301 3300025938 Bacteria 4955
337 Ga0207704_10183679 3300025938 Bacteria 1514
338 Ga0207691_10030741 3300025940 Bacteria 5016
339 Ga0207691_10069365 3300025940 Unclassified 3184
340 Ga0207691_10473095 3300025940 Unclassified 1065
341 Ga0207711_12095061 3300025941 Bacteria 508
342 Ga0207689_10169053 3300025942 Bacteria 1802
343 Ga0207689_10489242 3300025942 Bacteria 1030
344 Ga0207689_10681610 3300025942 Bacteria 866
345 Ga0207689_10788821 3300025942 Bacteria 802
346 Ga0207689_11486465 3300025942 Unclassified 566
347 Ga0207661_10348784 3300025944 Unclassified 1335
348 Ga0207661_10557335 3300025944 Unclassified 1050
349 Ga0207679_10049112 3300025945 Unclassified 3076
350 Ga0207679_10157457 3300025945 Bacteria 1856
351 Ga0207679_10232421 3300025945 Bacteria 1558
352 Ga0207679_10862744 3300025945 Bacteria 827
353 Ga0207679_11002300 3300025945 Unclassified 766
354 Ga0207667_10329281 3300025949 Bacteria 1559
355 Ga0207651_10059691 3300025960 Bacteria 2644
356 Ga0207651_10329470 3300025960 Bacteria 1279
357 Ga0207651_10566144 3300025960 Bacteria 990
358 Ga0207712_10001590 3300025961 Bacteria 15286
359 Ga0207712_10006005 3300025961 Bacteria 7663
360 Ga0207712_10253445 3300025961 Bacteria 1424
361 Ga0207712_11118139 3300025961 Bacteria 702
362 Ga0207712_11797974 3300025961 Unclassified 549
363 Ga0207668_10265045 3300025972 Unclassified 1402
364 Ga0207668_10316577 3300025972 Bacteria 1293
365 Ga0207668_11890935 3300025972 Unclassified 538
366 Ga0207640_10087602 3300025981 Unclassified 2147
367 Ga0207640_10243138 3300025981 Bacteria 1392
368 Ga0207640_10732075 3300025981 Bacteria 851
369 Ga0207658_10030101 3300025986 Bacteria 3841
370 Ga0207658_10960446 3300025986 Bacteria 779
371 Ga0207677_10267673 3300026023 Unclassified 1396
372 Ga0207677_10721264 3300026023 Unclassified 886
373 Ga0207703_10291347 3300026035 Bacteria 1486
374 Ga0207703_10318696 3300026035 Unclassified 1423
375 Ga0207703_10444506 3300026035 Unclassified 1210
376 Ga0207639_10000024 3300026041 Bacteria 213218
377 Ga0207639_10028479 3300026041 Bacteria 4079
378 Ga0207639_10086630 3300026041 Unclassified 2494
379 Ga0207639_10158001 3300026041 Bacteria 1907
380 Ga0207639_10352037 3300026041 Bacteria 1315
381 Ga0207639_10898273 3300026041 Viruses 828
382 Ga0207639_11267444 3300026041 Unclassified 692
383 Ga0207678_10368898 3300026067 Bacteria 1240
384 Ga0207678_10578747 3300026067 Unclassified 983
385 Ga0207708_10000137 3300026075 Bacteria 57745
386 Ga0207708_10035054 3300026075 Bacteria 3819
387 Ga0207708_10944990 3300026075 Bacteria 747
388 Ga0207702_11240674 3300026078 Unclassified 740
389 Ga0207641_10284302 3300026088 Bacteria 1557
390 Ga0207641_10562322 3300026088 Bacteria 1113
391 Ga0207641_10617231 3300026088 Unclassified 1063
392 Ga0207648_10000819 3300026089 Bacteria 35169
393 Ga0207648_10292171 3300026089 Unclassified 1459
394 Ga0207648_10945672 3300026089 Bacteria 806
395 Ga0207648_12067757 3300026089 Unclassified 531
396 Ga0207676_10009856 3300026095 Bacteria 6796
397 Ga0207676_10071113 3300026095 Bacteria 2792
398 Ga0207676_10075563 3300026095 Bacteria 2719
399 Ga0207676_10086012 3300026095 Bacteria 2567
400 Ga0207676_10254451 3300026095 Bacteria 1582
401 Ga0207674_10018491 3300026116 Bacteria 7575
402 Ga0207674_10146102 3300026116 Unclassified 2323
403 Ga0207674_10193883 3300026116 Bacteria 1981
404 Ga0207674_10196385 3300026116 Bacteria 1967
405 Ga0207674_10289048 3300026116 Bacteria 1588
406 Ga0207674_10290683 3300026116 Bacteria 1583
407 Ga0207675_100015623 3300026118 Bacteria 7081
408 Ga0207675_100117919 3300026118 Unclassified 2510
409 Ga0207675_100251257 3300026118 Bacteria 1711
410 Ga0207675_100306735 3300026118 Bacteria 1547
411 Ga0207675_100530675 3300026118 Unclassified 1174
412 Ga0207675_100927567 3300026118 Bacteria 887
413 Ga0207683_10183322 3300026121 Bacteria 1899
414 Ga0207683_10343244 3300026121 Bacteria 1370
415 Ga0207698_10204625 3300026142 Bacteria 1771
416 Ga0207698_10318228 3300026142 Bacteria 1456
417 Ga0207698_10659448 3300026142 Unclassified 1037
418 Ga0207698_11141732 3300026142 Unclassified 792
419 Ga0209974_10104923 3300027876 Bacteria 990
420 Ga0207428_10001202 3300027907 Bacteria 27748
421 Ga0207428_10005873 3300027907 Bacteria 11378
422 Ga0207428_10326567 3300027907 Bacteria 1132
423 Ga0268265_10001638 3300028380 Bacteria 18352
424 Ga0268265_10033132 3300028380 Bacteria 3753
425 Ga0268265_10128097 3300028380 Bacteria 2104
426 Ga0268265_11023866 3300028380 Bacteria 817
427 Ga0268265_11482587 3300028380 Bacteria 682
428 Ga0268264_10009034 3300028381 Bacteria 8269
429 Ga0268264_10117828 3300028381 Bacteria 2336
430 Ga0268264_11147309 3300028381 Viruses 786
431 Ga0307408_100071572 3300031548 Bacteria 2564
432 Ga0307408_100531732 3300031548 Unclassified 1034
433 Ga0307516_10571985 3300031730 Unclassified 784
434 Ga0307405_10001311 3300031731 Bacteria 10406
435 Ga0307405_10058802 3300031731 Unclassified 2421
436 Ga0307413_10067424 3300031824 Bacteria 2237
437 Ga0307413_10563181 3300031824 Unclassified 926
438 Ga0307410_10000930 3300031852 Bacteria 12532
439 Ga0307410_10004919 3300031852 Bacteria 6997
440 Ga0307410_10410774 3300031852 Bacteria 1096
441 Ga0307406_10012424 3300031901 Unclassified 4857
442 Ga0307406_10083918 3300031901 Unclassified 2126
443 Ga0307407_10000604 3300031903 Bacteria 11436
444 Ga0307407_10130277 3300031903 Unclassified 1608
445 Ga0307407_10250708 3300031903 Unclassified 1213
446 Ga0307412_10002741 3300031911 Bacteria 9803
447 Ga0307409_100121013 3300031995 Bacteria 2216
448 Ga0307409_100240459 3300031995 Bacteria 1648
449 Ga0307409_100601152 3300031995 Unclassified 1087
450 Ga0307409_101327235 3300031995 Bacteria 745
451 Ga0307409_101348849 3300031995 Unclassified 739
452 Ga0307416_100005879 3300032002 Bacteria 7613
453 Ga0307416_100011442 3300032002 Bacteria 5919
454 Ga0307416_100824363 3300032002 Bacteria 1025
455 Ga0307416_100950264 3300032002 Unclassified 961
456 Ga0307416_101835910 3300032002 Unclassified 710
457 Ga0307416_102653774 3300032002 Bacteria 598
458 Ga0307414_10124524 3300032004 Unclassified 1989
459 Ga0307414_10466077 3300032004 Bacteria 1111
460 Ga0307411_10054170 3300032005 Bacteria 2632
461 Ga0307411_10314470 3300032005 Unclassified 1262
462 Ga0307411_11067011 3300032005 Unclassified 726
463 Ga0307415_100001463 3300032126 Bacteria 11310
464 Ga0307415_100034348 3300032126 Unclassified 3301
465 Ga0307415_100077634 3300032126 Unclassified 2359
466 Ga0373948_0069201 3300034817 Bacteria 789
467 Ga0373932_0000011 3300035112 Bacteria 66192
468 Ga0373961_0149604 3300035241 Bacteria 794
469 Ga0373962_0098605 3300035242 Bacteria 909
470 Ga0373931_0168141 3300035691 Bacteria 1290
471 Ga0373937_0941035 3300036401 Unclassified 813
472 Ga0436365_0270872 3300039437 Bacteria 2315
473 Ga0436365_0739745 3300039437 Bacteria 668
474 Ga0436363_1461398 3300039450 Unclassified 951
475 Ga0451807_0294299 3300041486 Bacteria 550
476 Ga0451841_0723992 3300041498 Unclassified 542
477 Ga0451853_0127646 3300041512 Unclassified 675
478 Ga0451853_1106880 3300041512 Unclassified 564
479 Ga0439432_081472 3300042006 Bacteria 980
480 Ga0439435_0190718 3300042436 Bacteria 672
481 Ga0439464_0022081 3300042439 Bacteria 1751
482 Ga0451577_0265458 3300042876 Bacteria 1554
483 Ga0451577_0310774 3300042876 Bacteria 1429
484 Ga0453683_0641905 3300044673 Unclassified 694
485 Ga0451576_0348172 3300045051 Bacteria 1551
486 Ga0495603_0008402 3300046455 Bacteria 6236
487 Ga0495629_0010393 3300046459 Bacteria 6774
488 Ga0495582_0213961 3300046473 Bacteria 1102
489 Ga0495639_0269388 3300046475 Bacteria 845
490 Ga0495594_0059557 3300046499 Bacteria 2112
491 Ga0495663_0013513 3300046525 Bacteria 2283
492 Ga0495598_0157205 3300046537 Bacteria 797
493 Ga0495598_0157773 3300046537 Bacteria 796
494 Ga0495621_0047107 3300046539 Bacteria 1532
495 Ga0495621_0347902 3300046539 Unclassified 621
496 Ga0495645_0831167 3300046543 Unclassified 552
497 Ga0495633_0181953 3300046558 Bacteria 967
498 Ga0495659_0020559 3300046664 Bacteria 2218
499 Ga0495659_0525625 3300046664 Bacteria 520
500 Ga0495647_0316379 3300046681 Bacteria 706
501 Ga0495658_0063894 3300046683 Bacteria 2119
502 Ga0495658_0791257 3300046683 Unclassified 607
503 Ga0495670_0166479 3300046691 Unclassified 1160
504 Ga0495581_0552743 3300047315 Bacteria 668
505 Ga0495636_0033231 3300047318 Bacteria 2118
506 Ga0495676_0047320 3300047321 Bacteria 3479
507 Ga0495677_0009001 3300047445 Bacteria 3692
508 Ga0495681_0317751 3300047470 Bacteria 599
509 Ga0495593_0309473 3300047673 Bacteria 790
510 Ga0495614_0113003 3300048089 Bacteria 1193
511 Ga0495615_0308244 3300048090 Bacteria 514
512 Ga0496104_0337973 3300048907 Bacteria 1419
513 Ga0496109_1604530 3300048912 Unclassified 585
514 Ga0496110_0459569 3300048913 Bacteria 1160
515 Ga0501036_0499228 3300049572 Bacteria 1012
516 Ga0501037_0218182 3300049573 Bacteria 1343
517 Ga0501039_0143032 3300049575 Bacteria 1879
518 Ga0501040_0015269 3300049576 Bacteria 5076
519 Ga0501041_0017411 3300049577 Bacteria 4277
520 Ga0501042_0033219 3300049578 Bacteria 3657
521 Ga0501048_0042772 3300049582 Bacteria 3243
522 Ga0501068_0854909 3300049584 Unclassified 598
523 Ga0501072_0023208 3300049588 Bacteria 4817
524 Ga0501075_0016285 3300049591 Bacteria 5353
525 Ga0501076_0190076 3300049592 Bacteria 1675
526 Ga0501208_142666 3300049655 Unclassified 540
527 Ga0501223_065626 3300049663 Bacteria 712
528 Ga0501235_056484 3300049669 Bacteria 915
529 Ga0501079_0092695 3300049741 Bacteria 2340
530 Ga0501081_0003565 3300049743 Bacteria 9950
531 Ga0501268_049627 3300049765 Bacteria 810
532 Ga0501035_0246053 3300049822 Bacteria 1520
533 Ga0501045_0041752 3300049824 Bacteria 3338
534 nmdc:mga03n38_89191_c1 3300050490 Bacteria 1464
535 nmdc:mga05p37_886783_c1 3300050507 Bacteria 964
536 nmdc:mga05p37_89212_c1 3300050507 Bacteria 3800
537 nmdc:mga09592_450889_c1 3300050508 Bacteria 1110
538 nmdc:mga09592_54351_c1 3300050508 Bacteria 3383
539 nmdc:mga08y16_16506_c1 3300050511 Bacteria 7768
540 nmdc:mga08y16_1905_c1 3300050511 Bacteria 21266
541 nmdc:mga0n895_510246_c1 3300050512 Bacteria 1211
542 nmdc:mga0rr50_29482_c1 3300050513 Bacteria 3871
543 nmdc:mga0rr50_400_c1 3300050513 Bacteria 23598
544 nmdc:mga08x19_126160_c1 3300050514 Bacteria 1719
545 Ga0495655_0000040 3300053083 Bacteria 26303
546 Ga0501084_0325847 3300054114 Unclassified 1297
547 Ga0530510_0134519 3300061734 Bacteria 1820
548 Ga0070675_100050871
549 Ga0065704_10224290
550 Ga0065715_10220549
551 Ga0065707_10124955
552 Ga0070676_10183986
553 Ga0070676_10196144
554 Ga0070683_100138297
555 Ga0070683_100400854
556 Ga0070690_100012663
557 Ga0070690_100402931
558 Ga0070690_100744844
559 Ga0070670_100045775
560 Ga0070670_100078527
561 Ga0070670_100389165
562 Ga0070670_100425058
563 Ga0070670_101734791
564 Ga0070670_101911048
565 Ga0070677_10046965
566 Ga0070677_10147425
567 Ga0070677_10152538
568 Ga0068869_100089095
569 Ga0068869_100859266
570 Ga0068869_100894216
571 Ga0070666_10556090
572 Ga0070666_10598138
573 Ga0070680_100187144
574 Ga0070680_100736460
575 Ga0070682_100606768
576 Ga0070682_100936443
577 Ga0070682_101242217
578 Ga0068868_100085749
579 Ga0068868_100274848
580 Ga0070689_100226210
581 Ga0070689_100445053
582 Ga0070689_100505001
583 Ga0070689_101087102
584 Ga0070689_102036369
585 Ga0070661_100482818
586 Ga0070692_10311186
587 Ga0070668_100297066
588 Ga0070668_100924010
589 Ga0070669_100001725
590 Ga0070669_100757597
591 Ga0070669_100855051
592 Ga0070675_100000024
593 Ga0070675_100003328
594 Ga0070675_100007696
595 Ga0070675_100278427
596 Ga0070675_100506535
597 Ga0070675_100603209
598 Ga0070675_101837867
599 Ga0070671_100016211
600 Ga0070671_100062767
601 Ga0070671_100400102
602 Ga0070674_100012107
603 Ga0070674_100495198
604 Ga0070674_101162274
605 Ga0070674_101248618
606 Ga0070673_100032100
607 Ga0070673_100053897
608 Ga0070673_100290455
609 Ga0070673_100838087
610 Ga0070688_100086809
611 Ga0070688_100154304
612 Ga0070688_100336138
613 Ga0070659_100863136
614 Ga0070667_100348889
615 Ga0070667_100498600
616 Ga0070667_101368474
617 Ga0070713_100015856
618 Ga0070711_101397381
619 Ga0070700_100000002
620 Ga0070700_100029634
621 Ga0070694_100067009
622 Ga0070694_100326322
623 Ga0070694_100592071
624 Ga0070708_100558781
625 Ga0070708_101010751
626 Ga0070663_100357419
627 Ga0070663_100645003
628 Ga0070678_100988148
629 Ga0070662_100028586
630 Ga0070662_100533429
631 Ga0070681_10003907
632 Ga0070681_10388219
633 Ga0068867_100000757
634 Ga0068867_101915907
635 Ga0070685_10061102
636 Ga0070706_100387019
637 Ga0070698_100002296
638 Ga0070698_100065100
639 Ga0070698_100082012
640 Ga0070698_100372702
641 Ga0070699_100000125
642 Ga0070699_100024220
643 Ga0070679_100006401
644 Ga0070684_100077519
645 Ga0070684_101960301
646 Ga0070697_100383841
647 Ga0068853_100026432
648 Ga0068853_100072291
649 Ga0068853_100212326
650 Ga0068853_100278163
651 Ga0068853_100331096
652 Ga0070672_100068478
653 Ga0070672_100315505
654 Ga0070672_100629096
655 Ga0070672_100775338
656 Ga0070686_100231958
657 Ga0070686_100531151
658 Ga0070695_100306552
659 Ga0070696_100025137
660 Ga0070704_100002276
661 Ga0070704_100055454
662 Ga0068855_100442093
663 Ga0068855_100463428
664 Ga0068855_101220552
665 Ga0070664_100069640
666 Ga0070664_100292647
667 Ga0070664_100426929
668 Ga0070664_101007328
669 Ga0068857_100076262
670 Ga0068857_100137455
671 Ga0068857_100168182
672 Ga0068857_100253294
673 Ga0068854_100139357
674 Ga0068854_100249457
675 Ga0068854_100269113
676 Ga0068854_100943656
677 Ga0068856_100754612
678 Ga0070702_100305421
679 Ga0070702_101422694
680 Ga0068852_100033477
681 Ga0068852_100079806
682 Ga0068852_100283622
683 Ga0068859_100003448
684 Ga0068859_100018392
685 Ga0068859_100125035
686 Ga0068859_101189335
687 Ga0068864_100014850
688 Ga0068864_100015076
689 Ga0068864_100064767
690 Ga0068864_100347604
691 Ga0068864_100436750
692 Ga0068861_100010794
693 Ga0068861_100211507
694 Ga0068861_100668907
695 Ga0068861_101189691
696 Ga0068861_101201812
697 Ga0068851_10056642
698 Ga0068870_10012119
699 Ga0068870_10016365
700 Ga0068870_10298640
701 Ga0068870_10316988
702 Ga0068870_10336918
703 Ga0068870_10625045
704 Ga0068863_100188316
705 Ga0068863_100462826
706 Ga0068858_100026280
707 Ga0068858_100180995
708 Ga0068858_100258474
709 Ga0068858_100277686
710 Ga0068858_100282972
711 Ga0068860_100037980
712 Ga0068860_100128640
713 Ga0068860_100244281
714 Ga0068860_100674486
715 Ga0068860_101265292
716 Ga0068862_100001109
717 Ga0068862_100013812
718 Ga0068862_100019699
719 Ga0070717_10000237
720 Ga0097621_101765641
721 Ga0068871_100517901
722 Ga0068871_100570663
723 Ga0075428_100804900
724 Ga0075431_100248945
725 Ga0075433_10810456
726 Ga0075434_100348575
727 Ga0075429_100154338
728 Ga0075429_100987402
729 Ga0068865_100077992
730 Ga0068865_100260120
731 Ga0068865_100691208
732 Ga0075436_100121191
733 Ga0097620_100003447
734 Ga0097620_100018392
735 Ga0097620_100125032
736 Ga0097620_101189381
737 Ga0075435_100000809
738 Ga0105244_10152157
739 Ga0105240_10012687
740 Ga0105240_10065210
741 Ga0105240_10319145
742 Ga0111539_10006567
743 Ga0111539_10044074
744 Ga0111539_10176340
745 Ga0111539_10334607
746 Ga0111539_10690356
747 Ga0111539_11692745
748 Ga0111539_12787850
749 Ga0111539_13368252
750 Ga0105245_10001495
751 Ga0105245_10662746
752 Ga0105247_10003466
753 Ga0105247_10345509
754 Ga0114129_10003896
755 Ga0114129_10167465
756 Ga0105241_10026692
757 Ga0105241_10036188
758 Ga0105242_10005775
759 Ga0105242_12605676
760 Ga0105248_11814565
761 Ga0105248_12143420
762 Ga0105237_10022608
763 Ga0105238_10541588
764 Ga0105249_10005649
765 Ga0105249_10043703
766 Ga0105249_10347320
767 Ga0105249_10549277
768 Ga0105249_11254625
769 Ga0105249_12584374
770 Ga0105239_10016940
771 Ga0105239_10261445
772 Ga0157373_10069235
773 Ga0157373_10196963
774 Ga0157373_10603369
775 Ga0157371_10208248
776 Ga0157371_10911654
777 Ga0157370_10019872
778 Ga0157369_10022825
779 Ga0157369_10159102
780 Ga0157374_10490955
781 Ga0157374_11186240
782 Ga0157374_11472644
783 Ga0157374_12986735
784 Ga0157378_10502089
785 Ga0163162_10046216
786 Ga0163162_10078299
787 Ga0163162_10170464
788 Ga0163162_10479235
789 Ga0163162_10577851
790 Ga0163162_10796031
791 Ga0163162_10848097
792 Ga0163162_10878579
793 Ga0163162_10904214
794 Ga0163162_11188873
795 Ga0157372_10017804
796 Ga0157372_10069802
797 Ga0157372_10161926
798 Ga0157372_10609884
799 Ga0157372_13385300
800 Ga0157375_10003988
801 Ga0157375_10090125
802 Ga0157375_10753872
803 Ga0157375_12269219
804 Ga0163163_10181442
805 Ga0163163_10924919
806 Ga0163163_11035532
807 Ga0157380_10002784
808 Ga0157380_10173621
809 Ga0157380_10192986
810 Ga0157377_10000058
811 Ga0157377_10072935
812 Ga0157377_10182754
813 Ga0157379_10301200
814 Ga0157379_11184673
815 Ga0157376_12192682
816 Ga0163161_10320454
817 Ga0163161_10590567
818 Ga0207697_10086907
819 Ga0207655_1088683
820 Ga0207653_10102537
821 Ga0207653_10252681
822 Ga0207682_10045710
823 Ga0207682_10087853
824 Ga0207682_10558011
825 Ga0207642_10402575
826 Ga0207642_10764210
827 Ga0207710_10008813
828 Ga0207710_10243844
829 Ga0207688_10466122
830 Ga0207680_10032763
831 Ga0207680_10989600
832 Ga0207647_10188344
833 Ga0207647_10419408
834 Ga0207645_10020134
835 Ga0207645_10198421
836 Ga0207645_10856594
837 Ga0207643_10005378
838 Ga0207643_10033602
839 Ga0207643_10077679
840 Ga0207654_10546714
841 Ga0207707_10002236
842 Ga0207707_10252376
843 Ga0207695_10096943
844 Ga0207695_10268027
845 Ga0207671_10037863
846 Ga0207660_10133430
847 Ga0207660_10391305
848 Ga0207662_10007919
849 Ga0207662_10065318
850 Ga0207649_10335718
851 Ga0207649_10573377
852 Ga0207652_10051095
853 Ga0207681_10005104
854 Ga0207681_10716734
855 Ga0207681_10906167
856 Ga0207650_10008692
857 Ga0207650_10203410
858 Ga0207650_10311240
859 Ga0207650_11082357
860 Ga0207650_11499463
861 Ga0207659_10000029
862 Ga0207659_10000110
863 Ga0207659_10019499
864 Ga0207659_10020873
865 Ga0207659_10046423
866 Ga0207659_10268071
867 Ga0207659_10953808
868 Ga0207687_10043983
869 Ga0207687_10202547
870 Ga0207700_10007354
871 Ga0207644_10356419
872 Ga0207644_11253195
873 Ga0207690_10444539
874 Ga0207690_10863252
875 Ga0207690_10994330
876 Ga0207706_10203235
877 Ga0207706_11406679
878 Ga0207709_10782226
879 Ga0207670_10021778
880 Ga0207669_10220765
881 Ga0207669_10239874
882 Ga0207669_11956323
883 Ga0207704_10008301
884 Ga0207704_10183679
885 Ga0207691_10030741
886 Ga0207691_10069365
887 Ga0207691_10473095
888 Ga0207711_12095061
889 Ga0207689_10169053
890 Ga0207689_10489242
891 Ga0207689_10681610
892 Ga0207689_10788821
893 Ga0207689_11486465
894 Ga0207661_10348784
895 Ga0207661_10557335
896 Ga0207679_10049112
897 Ga0207679_10157457
898 Ga0207679_10232421
899 Ga0207679_10862744
900 Ga0207679_11002300
901 Ga0207667_10329281
902 Ga0207651_10059691
903 Ga0207651_10329470
904 Ga0207651_10566144
905 Ga0207712_10001590
906 Ga0207712_10006005
907 Ga0207712_10253445
908 Ga0207712_11118139
909 Ga0207712_11797974
910 Ga0207668_10265045
911 Ga0207668_10316577
912 Ga0207668_11890935
913 Ga0207640_10087602
914 Ga0207640_10243138
915 Ga0207640_10732075
916 Ga0207658_10030101
917 Ga0207658_10960446
918 Ga0207677_10267673
919 Ga0207677_10721264
920 Ga0207703_10291347
921 Ga0207703_10318696
922 Ga0207703_10444506
923 Ga0207639_10000024
924 Ga0207639_10028479
925 Ga0207639_10086630
926 Ga0207639_10158001
927 Ga0207639_10352037
928 Ga0207639_10898273
929 Ga0207639_11267444
930 Ga0207678_10368898
931 Ga0207678_10578747
932 Ga0207708_10000137
933 Ga0207708_10035054
934 Ga0207708_10944990
935 Ga0207702_11240674
936 Ga0207641_10284302
937 Ga0207641_10562322
938 Ga0207641_10617231
939 Ga0207648_10000819
940 Ga0207648_10292171
941 Ga0207648_10945672
942 Ga0207648_12067757
943 Ga0207676_10009856
944 Ga0207676_10071113
945 Ga0207676_10075563
946 Ga0207676_10086012
947 Ga0207676_10254451
948 Ga0207674_10018491
949 Ga0207674_10146102
950 Ga0207674_10193883
951 Ga0207674_10196385
952 Ga0207674_10289048
953 Ga0207674_10290683
954 Ga0207675_100015623
955 Ga0207675_100117919
956 Ga0207675_100251257
957 Ga0207675_100306735
958 Ga0207675_100530675
959 Ga0207675_100927567
960 Ga0207683_10183322
961 Ga0207683_10343244
962 Ga0207698_10204625
963 Ga0207698_10318228
964 Ga0207698_10659448
965 Ga0207698_11141732
966 Ga0209974_10104923
967 Ga0207428_10001202
968 Ga0207428_10005873
969 Ga0207428_10326567
970 Ga0268265_10001638
971 Ga0268265_10033132
972 Ga0268265_10128097
973 Ga0268265_11023866
974 Ga0268265_11482587
975 Ga0268264_10009034
976 Ga0268264_10117828
977 Ga0268264_11147309
978 Ga0307408_100071572
979 Ga0307408_100531732
980 Ga0307516_10571985
981 Ga0307405_10001311
982 Ga0307405_10058802
983 Ga0307413_10067424
984 Ga0307413_10563181
985 Ga0307410_10000930
986 Ga0307410_10004919
987 Ga0307410_10410774
988 Ga0307406_10012424
989 Ga0307406_10083918
990 Ga0307407_10000604
991 Ga0307407_10130277
992 Ga0307407_10250708
993 Ga0307412_10002741
994 Ga0307409_100121013
995 Ga0307409_100240459
996 Ga0307409_100601152
997 Ga0307409_101327235
998 Ga0307409_101348849
999 Ga0307416_100005879
1000 Ga0307416_100011442
1001 Ga0307416_100824363
1002 Ga0307416_100950264
1003 Ga0307416_101835910
1004 Ga0307416_102653774
1005 Ga0307414_10124524
1006 Ga0307414_10466077
1007 Ga0307411_10054170
1008 Ga0307411_10314470
1009 Ga0307411_11067011
1010 Ga0307415_100001463
1011 Ga0307415_100034348
1012 Ga0307415_100077634
1013 Ga0373948_0069201
1014 Ga0373932_0000011
1015 Ga0373961_0149604
1016 Ga0373962_0098605
1017 Ga0373931_0168141
1018 Ga0373937_0941035
1019 Ga0436365_0270872
1020 Ga0436365_0739745
1021 Ga0436363_1461398
1022 Ga0451807_0294299
1023 Ga0451841_0723992
1024 Ga0451853_0127646
1025 Ga0451853_1106880
1026 Ga0439432_081472
1027 Ga0439435_0190718
1028 Ga0439464_0022081
1029 Ga0451577_0265458
1030 Ga0451577_0310774
1031 Ga0453683_0641905
1032 Ga0451576_0348172
1033 Ga0495603_0008402
1034 Ga0495629_0010393
1035 Ga0495582_0213961
1036 Ga0495639_0269388
1037 Ga0495594_0059557
1038 Ga0495663_0013513
1039 Ga0495598_0157205
1040 Ga0495598_0157773
1041 Ga0495621_0047107
1042 Ga0495621_0347902
1043 Ga0495645_0831167
1044 Ga0495633_0181953
1045 Ga0495659_0020559
1046 Ga0495659_0525625
1047 Ga0495647_0316379
1048 Ga0495658_0063894
1049 Ga0495658_0791257
1050 Ga0495670_0166479
1051 Ga0495581_0552743
1052 Ga0495636_0033231
1053 Ga0495676_0047320
1054 Ga0495677_0009001
1055 Ga0495681_0317751
1056 Ga0495593_0309473
1057 Ga0495614_0113003
1058 Ga0495615_0308244
1059 Ga0496104_0337973
1060 Ga0496109_1604530
1061 Ga0496110_0459569
1062 Ga0501036_0499228
1063 Ga0501037_0218182
1064 Ga0501039_0143032
1065 Ga0501040_0015269
1066 Ga0501041_0017411
1067 Ga0501042_0033219
1068 Ga0501048_0042772
1069 Ga0501068_0854909
1070 Ga0501072_0023208
1071 Ga0501075_0016285
1072 Ga0501076_0190076
1073 Ga0501208_142666
1074 Ga0501223_065626
1075 Ga0501235_056484
1076 Ga0501079_0092695
1077 Ga0501081_0003565
1078 Ga0501268_049627
1079 Ga0501035_0246053
1080 Ga0501045_0041752
1081 nmdc:mga03n38_89191_c1
1082 nmdc:mga05p37_886783_c1
1083 nmdc:mga05p37_89212_c1
1084 nmdc:mga09592_450889_c1
1085 nmdc:mga09592_54351_c1
1086 nmdc:mga08y16_16506_c1
1087 nmdc:mga08y16_1905_c1
1088 nmdc:mga0n895_510246_c1
1089 nmdc:mga0rr50_29482_c1
1090 nmdc:mga0rr50_400_c1
1091 nmdc:mga08x19_126160_c1
1092 Ga0495655_0000040
1093 Ga0501084_0325847
1094 Ga0530510_0134519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

48

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq2-assembly2.cif.gz_H crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9571 13 127
2qq2-assembly1.cif.gz_A crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9518 13 127
2q2b-assembly1.cif.gz_B crystal structure of the c-terminal domain of mouse acyl-coa thioesterase 7 0.9471 13 129
2q2b-assembly1.cif.gz_A crystal structure of the c-terminal domain of mouse acyl-coa thioesterase 7 0.947 13 129
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9469 13 129
ID Description Score Start End Superfamily
2q2bB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9471 13 129 3.10.129.10
4ienA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.943 13 128 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9421 13 117 3.10.129.10
af_A4I4M9_176_344_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9406 13 127 3.10.129.10
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9345 13 129 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Q7NGN4-F1-model_v4 Acyl-CoA thioesterase 0.9872 10 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A2V8MHY2-F1-model_v4 Acyl-CoA thioesterase 0.9863 10 128 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A2V8P137-F1-model_v4 Acyl-CoA thioesterase 0.9851 17 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A534NCG9-F1-model_v4 Acyl-CoA thioesterase 0.9801 10 128 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7V8YZG3-F1-model_v4 Acyl-CoA thioesterase 0.9759 1 129 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Map