F462033

General Info

Members Datasets Scaffolds Average Seq Length
546 242 1092 169

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0005966|Ga0495672_0005966_889_1500
Length 203
Sequence MLLNKSPKVGKTGRCFHCLKRSSGLSVLLASGLHNMKIYLLGFMGSGKTHWGRELGQKLNLPFFDMDEQIINSEGMSINDIFKKYGEEYFRLKEKGILHIITESHSSFVMACGGGSPCYFNNIDYMNQSGTTVWINTPLAILFQRLLKERDMRPLLKDLSDADLTGYIIKKFSDRKIYYEQADVAIDDENISLDHFIEKIFHA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
166 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
167 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
168 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
215 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 1.1
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0005966 3300047320 Bacteria 9542
2 rootH1_10172092 3300003323 Bacteria 1435
3 Ga0065707_10254862 3300005295 Bacteria 1114
4 Ga0070676_10001325 3300005328 Bacteria 12443
5 Ga0070683_100051461 3300005329 Bacteria 3814
6 Ga0070683_100350825 3300005329 Bacteria 1405
7 Ga0070690_100011362 3300005330 Bacteria 5205
8 Ga0070670_100008754 3300005331 Bacteria 8643
9 Ga0070670_100581944 3300005331 Bacteria 1000
10 Ga0070677_10020590 3300005333 Unclassified 2406
11 Ga0070677_10184022 3300005333 Bacteria 997
12 Ga0070677_10239416 3300005333 Bacteria 895
13 Ga0070677_10359097 3300005333 Bacteria 757
14 Ga0068869_100045427 3300005334 Bacteria 3162
15 Ga0068869_100063215 3300005334 Bacteria 2719
16 Ga0068869_101834801 3300005334 Bacteria 543
17 Ga0070666_10010751 3300005335 Bacteria 5725
18 Ga0070666_10013536 3300005335 Bacteria 5178
19 Ga0070666_10027518 3300005335 Bacteria 3724
20 Ga0070666_10193953 3300005335 Unclassified 1428
21 Ga0070666_10861585 3300005335 Unclassified 669
22 Ga0068868_100011614 3300005338 Bacteria 6414
23 Ga0068868_100012807 3300005338 Bacteria 6135
24 Ga0068868_100033396 3300005338 Bacteria 3965
25 Ga0068868_100043570 3300005338 Bacteria 3505
26 Ga0068868_100212115 3300005338 Bacteria 1619
27 Ga0068868_100744459 3300005338 Unclassified 880
28 Ga0070689_100021872 3300005340 Bacteria 4767
29 Ga0070689_100048200 3300005340 Bacteria 3285
30 Ga0070689_100123509 3300005340 Bacteria 2070
31 Ga0070687_100011166 3300005343 Bacteria 3918
32 Ga0070687_100244726 3300005343 Bacteria 1111
33 Ga0070661_100068203 3300005344 Bacteria 2614
34 Ga0070661_100075745 3300005344 Unclassified 2480
35 Ga0070661_100143935 3300005344 Bacteria 1798
36 Ga0070661_100196951 3300005344 Bacteria 1538
37 Ga0070692_10232804 3300005345 Bacteria 1094
38 Ga0070668_100051009 3300005347 Bacteria 3187
39 Ga0070668_100281320 3300005347 Bacteria 1389
40 Ga0070669_100118820 3300005353 Bacteria 2014
41 Ga0070669_100144586 3300005353 Bacteria 1836
42 Ga0070669_100344963 3300005353 Bacteria 1208
43 Ga0070669_100532030 3300005353 Unclassified 978
44 Ga0070669_100550586 3300005353 Unclassified 962
45 Ga0070675_100023556 3300005354 Bacteria 4925
46 Ga0070675_100050877 3300005354 Bacteria 3403
47 Ga0070675_100173139 3300005354 Bacteria 1862
48 Ga0070675_100190058 3300005354 Bacteria 1779
49 Ga0070675_100228334 3300005354 Bacteria 1623
50 Ga0070671_100012119 3300005355 Bacteria 6938
51 Ga0070671_100086177 3300005355 Bacteria 2627
52 Ga0070671_100293817 3300005355 Bacteria 1383
53 Ga0070674_100014393 3300005356 Bacteria 4920
54 Ga0070674_100090723 3300005356 Unclassified 2205
55 Ga0070674_100349686 3300005356 Bacteria 1193
56 Ga0070673_100020383 3300005364 Bacteria 4783
57 Ga0070673_100067074 3300005364 Bacteria 2868
58 Ga0070673_100079656 3300005364 Bacteria 2653
59 Ga0070673_100131236 3300005364 Bacteria 2102
60 Ga0070673_100378944 3300005364 Bacteria 1261
61 Ga0070673_100541459 3300005364 Unclassified 1057
62 Ga0070688_100029855 3300005365 Bacteria 3268
63 Ga0070688_100057190 3300005365 Bacteria 2450
64 Ga0070688_101056757 3300005365 Bacteria 647
65 Ga0070659_100065652 3300005366 Bacteria 2874
66 Ga0070667_100093252 3300005367 Bacteria 2593
67 Ga0070667_100242470 3300005367 Bacteria 1610
68 Ga0070667_100604129 3300005367 Bacteria 1011
69 Ga0070667_100722989 3300005367 Unclassified 922
70 Ga0070701_10599351 3300005438 Bacteria 729
71 Ga0070705_100370065 3300005440 Bacteria 1051
72 Ga0070700_100184553 3300005441 Bacteria 1454
73 Ga0070663_100118602 3300005455 Bacteria 1996
74 Ga0070678_100009652 3300005456 Bacteria 5861
75 Ga0070678_100060041 3300005456 Bacteria 2797
76 Ga0070678_100072181 3300005456 Bacteria 2587
77 Ga0070678_100389458 3300005456 Bacteria 1208
78 Ga0070662_100014062 3300005457 Bacteria 5337
79 Ga0070662_100035254 3300005457 Bacteria 3533
80 Ga0070662_100050450 3300005457 Bacteria 3002
81 Ga0068867_100019530 3300005459 Bacteria 4829
82 Ga0068867_100022046 3300005459 Bacteria 4551
83 Ga0068867_100061984 3300005459 Bacteria 2778
84 Ga0068867_100193661 3300005459 Bacteria 1624
85 Ga0068867_100374629 3300005459 Bacteria 1194
86 Ga0068867_100487979 3300005459 Bacteria 1057
87 Ga0068867_101000836 3300005459 Bacteria 758
88 Ga0070685_10006017 3300005466 Bacteria 6183
89 Ga0070685_10028866 3300005466 Bacteria 3078
90 Ga0070685_10047700 3300005466 Bacteria 2464
91 Ga0070685_10113994 3300005466 Bacteria 1670
92 Ga0070685_10281151 3300005466 Unclassified 1114
93 Ga0070685_10685663 3300005466 Bacteria 746
94 Ga0070698_100055394 3300005471 Unclassified 4021
95 Ga0070684_100626631 3300005535 Bacteria 1001
96 Ga0068853_100313873 3300005539 Bacteria 1452
97 Ga0068853_100368208 3300005539 Bacteria 1340
98 Ga0070672_100012883 3300005543 Bacteria 5891
99 Ga0070672_100127375 3300005543 Bacteria 2090
100 Ga0070672_100221430 3300005543 Bacteria 1587
101 Ga0070672_100453311 3300005543 Bacteria 1105
102 Ga0070686_100002926 3300005544 Bacteria 9373
103 Ga0070686_100128048 3300005544 Bacteria 1752
104 Ga0070695_100370730 3300005545 Bacteria 1078
105 Ga0070695_100635625 3300005545 Bacteria 841
106 Ga0070695_101142172 3300005545 Bacteria 639
107 Ga0070665_100021278 3300005548 Bacteria 6522
108 Ga0068855_101730067 3300005563 Bacteria 637
109 Ga0070664_100015502 3300005564 Bacteria 6235
110 Ga0070664_100062239 3300005564 Bacteria 3181
111 Ga0070664_100083370 3300005564 Bacteria 2758
112 Ga0070664_100531634 3300005564 Unclassified 1086
113 Ga0070664_100729372 3300005564 Bacteria 924
114 Ga0068857_100820352 3300005577 Bacteria 889
115 Ga0068854_100139431 3300005578 Bacteria 1859
116 Ga0068854_100451414 3300005578 Unclassified 1074
117 Ga0070702_100144427 3300005615 Bacteria 1520
118 Ga0068852_100080157 3300005616 Bacteria 2894
119 Ga0068852_100410514 3300005616 Unclassified 1334
120 Ga0068852_100507667 3300005616 Bacteria 1201
121 Ga0068852_100508341 3300005616 Bacteria 1201
122 Ga0068859_100133499 3300005617 Bacteria 2554
123 Ga0068859_100136119 3300005617 Bacteria 2529
124 Ga0068859_100431303 3300005617 Bacteria 1414
125 Ga0068859_100725348 3300005617 Bacteria 1084
126 Ga0068864_100002925 3300005618 Bacteria 14126
127 Ga0068864_100027699 3300005618 Bacteria 4788
128 Ga0068864_100043599 3300005618 Unclassified 3841
129 Ga0068864_100047725 3300005618 Bacteria 3679
130 Ga0068864_100073640 3300005618 Bacteria 2978
131 Ga0068864_100260153 3300005618 Bacteria 1614
132 Ga0068864_100402642 3300005618 Bacteria 1301
133 Ga0068866_10032534 3300005718 Bacteria 2523
134 Ga0068866_10054052 3300005718 Bacteria 2056
135 Ga0068866_10058498 3300005718 Bacteria 1991
136 Ga0068866_10486600 3300005718 Bacteria 814
137 Ga0068861_100110671 3300005719 Bacteria 2200
138 Ga0068861_100461176 3300005719 Bacteria 1141
139 Ga0068861_101286142 3300005719 Bacteria 711
140 Ga0068861_101294027 3300005719 Bacteria 709
141 Ga0068851_10241730 3300005834 Bacteria 1021
142 Ga0068851_10543334 3300005834 Unclassified 701
143 Ga0068870_10097244 3300005840 Bacteria 1657
144 Ga0068870_10312544 3300005840 Unclassified 996
145 Ga0068870_10483644 3300005840 Bacteria 822
146 Ga0068863_100065138 3300005841 Bacteria 3447
147 Ga0068863_100118120 3300005841 Bacteria 2527
148 Ga0068863_100160098 3300005841 Bacteria 2156
149 Ga0068858_100049328 3300005842 Bacteria 3898
150 Ga0068858_100267350 3300005842 Bacteria 1626
151 Ga0068858_100339500 3300005842 Unclassified 1438
152 Ga0068858_100404333 3300005842 Unclassified 1312
153 Ga0068860_100379891 3300005843 Unclassified 1394
154 Ga0068860_100440182 3300005843 Unclassified 1295
155 Ga0068860_101646502 3300005843 Bacteria 664
156 Ga0068862_100847496 3300005844 Bacteria 896
157 Ga0070715_10016653 3300006163 Bacteria 2767
158 Ga0075366_10310037 3300006195 Bacteria 966
159 Ga0097621_100022099 3300006237 Bacteria 4934
160 Ga0097621_100122240 3300006237 Unclassified 2209
161 Ga0097621_100127129 3300006237 Bacteria 2166
162 Ga0097621_100170424 3300006237 Bacteria 1876
163 Ga0097621_100280773 3300006237 Bacteria 1466
164 Ga0097621_100324882 3300006237 Bacteria 1363
165 Ga0097621_100557966 3300006237 Bacteria 1043
166 Ga0097621_100590921 3300006237 Bacteria 1014
167 Ga0068871_100015017 3300006358 Bacteria 5790
168 Ga0068871_100033437 3300006358 Bacteria 4072
169 Ga0068871_100089876 3300006358 Bacteria 2557
170 Ga0068871_100181019 3300006358 Bacteria 1811
171 Ga0068871_100335257 3300006358 Bacteria 1335
172 Ga0068871_100500428 3300006358 Bacteria 1095
173 Ga0068871_100819055 3300006358 Bacteria 859
174 Ga0075428_100019968 3300006844 Bacteria 7419
175 Ga0075428_100157788 3300006844 Bacteria 2463
176 Ga0075430_100009129 3300006846 Bacteria 8374
177 Ga0075430_100061969 3300006846 Bacteria 3142
178 Ga0075431_100022157 3300006847 Bacteria 6496
179 Ga0075431_100035285 3300006847 Bacteria 5148
180 Ga0075434_101336307 3300006871 Unclassified 727
181 Ga0075429_100002343 3300006880 Bacteria 15928
182 Ga0068865_100025834 3300006881 Bacteria 3867
183 Ga0068865_100085792 3300006881 Bacteria 2272
184 Ga0068865_100090132 3300006881 Bacteria 2223
185 Ga0068865_101070976 3300006881 Bacteria 709
186 Ga0097620_100133498 3300006931 Bacteria 2554
187 Ga0097620_100136119 3300006931 Bacteria 2529
188 Ga0097620_100431314 3300006931 Bacteria 1414
189 Ga0097620_100725357 3300006931 Bacteria 1084
190 Ga0075435_100253876 3300007076 Bacteria 1497
191 Ga0075435_100508399 3300007076 Bacteria 1042
192 Ga0105251_10093510 3300009011 Bacteria 1379
193 Ga0105240_10000486 3300009093 Bacteria 73492
194 Ga0105240_10008759 3300009093 Bacteria 14422
195 Ga0105247_10009206 3300009101 Bacteria 6006
196 Ga0105247_10224855 3300009101 Bacteria 1272
197 Ga0105247_10581274 3300009101 Bacteria 828
198 Ga0105243_10047996 3300009148 Bacteria 3365
199 Ga0105241_10039033 3300009174 Bacteria 3581
200 Ga0105241_10372844 3300009174 Bacteria 1245
201 Ga0105241_10537692 3300009174 Bacteria 1047
202 Ga0105242_10013883 3300009176 Bacteria 6232
203 Ga0105242_10035808 3300009176 Bacteria 3980
204 Ga0105242_10043015 3300009176 Bacteria 3652
205 Ga0105242_10076761 3300009176 Bacteria 2786
206 Ga0105242_10126189 3300009176 Bacteria 2203
207 Ga0105242_10183446 3300009176 Bacteria 1848
208 Ga0105248_10107003 3300009177 Bacteria 3153
209 Ga0105248_10982676 3300009177 Bacteria 954
210 Ga0105237_10000340 3300009545 Bacteria 65768
211 Ga0105237_10241006 3300009545 Unclassified 1809
212 Ga0105237_10780517 3300009545 Bacteria 962
213 Ga0105249_10007028 3300009553 Bacteria 9822
214 Ga0105249_10008818 3300009553 Bacteria 8806
215 Ga0105249_10798203 3300009553 Unclassified 1008
216 Ga0105249_11052875 3300009553 Bacteria 883
217 Ga0105246_10016636 3300011119 Bacteria 4660
218 Ga0105246_10234589 3300011119 Bacteria 1447
219 Ga0157373_10079830 3300013100 Bacteria 2307
220 Ga0157371_10284733 3300013102 Bacteria 1194
221 Ga0157370_10028800 3300013104 Bacteria 5460
222 Ga0157370_10444197 3300013104 Bacteria 1192
223 Ga0157370_10521944 3300013104 Bacteria 1090
224 Ga0157370_11289792 3300013104 Bacteria 658
225 Ga0157369_10578752 3300013105 Bacteria 1160
226 Ga0157374_10005863 3300013296 Bacteria 10374
227 Ga0157374_10068247 3300013296 Bacteria 3345
228 Ga0157374_10237862 3300013296 Bacteria 1790
229 Ga0157374_10354773 3300013296 Bacteria 1458
230 Ga0157378_10054774 3300013297 Bacteria 3552
231 Ga0157378_10096697 3300013297 Bacteria 2691
232 Ga0157378_10206721 3300013297 Bacteria 1859
233 Ga0157378_10206916 3300013297 Bacteria 1859
234 Ga0157378_10265145 3300013297 Bacteria 1649
235 Ga0157378_10839158 3300013297 Bacteria 947
236 Ga0163162_10002125 3300013306 Bacteria 18615
237 Ga0163162_10034572 3300013306 Bacteria 5031
238 Ga0163162_10043831 3300013306 Bacteria 4479
239 Ga0163162_10161415 3300013306 Bacteria 2363
240 Ga0163162_10173053 3300013306 Bacteria 2284
241 Ga0163162_10251045 3300013306 Bacteria 1901
242 Ga0163162_11092202 3300013306 Bacteria 904
243 Ga0163162_11153124 3300013306 Bacteria 879
244 Ga0163162_11892971 3300013306 Bacteria 683
245 Ga0157372_10028569 3300013307 Bacteria 6087
246 Ga0157372_10148740 3300013307 Bacteria 2702
247 Ga0157372_10212116 3300013307 Unclassified 2244
248 Ga0157375_10021956 3300013308 Bacteria 5867
249 Ga0157375_10082278 3300013308 Bacteria 3261
250 Ga0157375_10095621 3300013308 Bacteria 3042
251 Ga0157375_10143917 3300013308 Bacteria 2513
252 Ga0157375_10171002 3300013308 Bacteria 2320
253 Ga0157375_10213962 3300013308 Bacteria 2085
254 Ga0157375_10321163 3300013308 Bacteria 1713
255 Ga0157375_10541660 3300013308 Bacteria 1326
256 Ga0157375_10938300 3300013308 Bacteria 1008
257 Ga0163163_10020818 3300014325 Bacteria 6183
258 Ga0163163_10095827 3300014325 Bacteria 2987
259 Ga0163163_10125884 3300014325 Unclassified 2600
260 Ga0163163_10719949 3300014325 Bacteria 1061
261 Ga0163163_11331867 3300014325 Bacteria 780
262 Ga0157380_10918648 3300014326 Bacteria 903
263 Ga0157377_10044084 3300014745 Bacteria 2486
264 Ga0157377_10075725 3300014745 Bacteria 1955
265 Ga0157377_10188923 3300014745 Bacteria 1300
266 Ga0157377_10250108 3300014745 Bacteria 1148
267 Ga0157379_10027455 3300014968 Bacteria 5068
268 Ga0157379_10139607 3300014968 Bacteria 2184
269 Ga0157379_10412502 3300014968 Unclassified 1243
270 Ga0157376_10098203 3300014969 Bacteria 2552
271 Ga0157376_10125071 3300014969 Bacteria 2285
272 Ga0157376_10419305 3300014969 Bacteria 1298
273 Ga0157376_10585690 3300014969 Bacteria 1108
274 Ga0157376_10661641 3300014969 Bacteria 1046
275 Ga0163161_10009684 3300017792 Bacteria 6669
276 Ga0163161_10058550 3300017792 Bacteria 2800
277 Ga0163161_10143504 3300017792 Bacteria 1809
278 Ga0163161_10146232 3300017792 Bacteria 1793
279 Ga0163161_10319794 3300017792 Bacteria 1226
280 Ga0207697_10089789 3300025315 Bacteria 1302
281 Ga0207697_10116565 3300025315 Bacteria 1147
282 Ga0207656_10178370 3300025321 Bacteria 1018
283 Ga0207682_10005034 3300025893 Bacteria 5417
284 Ga0207682_10007909 3300025893 Bacteria 4220
285 Ga0207642_10007143 3300025899 Bacteria 3755
286 Ga0207642_10052453 3300025899 Bacteria 1850
287 Ga0207642_10058242 3300025899 Bacteria 1781
288 Ga0207642_10563330 3300025899 Unclassified 705
289 Ga0207710_10039228 3300025900 Bacteria 2095
290 Ga0207710_10170747 3300025900 Bacteria 1063
291 Ga0207688_10011580 3300025901 Bacteria 4798
292 Ga0207688_10130020 3300025901 Bacteria 1475
293 Ga0207680_10009218 3300025903 Bacteria 4882
294 Ga0207680_10242937 3300025903 Bacteria 1241
295 Ga0207680_10759489 3300025903 Bacteria 695
296 Ga0207647_10018393 3300025904 Bacteria 4728
297 Ga0207685_10046251 3300025905 Bacteria 1655
298 Ga0207685_10068704 3300025905 Bacteria 1429
299 Ga0207645_10000713 3300025907 Bacteria 27669
300 Ga0207645_10026492 3300025907 Bacteria 3746
301 Ga0207643_10002813 3300025908 Bacteria 9389
302 Ga0207643_10011143 3300025908 Bacteria 4855
303 Ga0207643_10640795 3300025908 Bacteria 685
304 Ga0207654_10170771 3300025911 Bacteria 1412
305 Ga0207654_10330118 3300025911 Bacteria 1045
306 Ga0207654_10576139 3300025911 Unclassified 801
307 Ga0207695_10000170 3300025913 Bacteria 192469
308 Ga0207695_10001252 3300025913 Bacteria 43328
309 Ga0207671_10000456 3300025914 Bacteria 56238
310 Ga0207671_10207556 3300025914 Unclassified 1531
311 Ga0207662_10018783 3300025918 Bacteria 3926
312 Ga0207662_10891613 3300025918 Bacteria 629
313 Ga0207649_10036125 3300025920 Bacteria 2973
314 Ga0207649_10677310 3300025920 Bacteria 799
315 Ga0207681_10034493 3300025923 Bacteria 3328
316 Ga0207681_10563934 3300025923 Unclassified 938
317 Ga0207681_11372823 3300025923 Bacteria 593
318 Ga0207650_10242524 3300025925 Bacteria 1457
319 Ga0207650_10820168 3300025925 Bacteria 789
320 Ga0207659_10012529 3300025926 Bacteria 5398
321 Ga0207659_10049219 3300025926 Bacteria 2989
322 Ga0207659_10160337 3300025926 Bacteria 1765
323 Ga0207659_10230012 3300025926 Bacteria 1495
324 Ga0207700_10766270 3300025928 Bacteria 862
325 Ga0207644_10112780 3300025931 Bacteria 2058
326 Ga0207644_10128855 3300025931 Bacteria 1935
327 Ga0207644_10150323 3300025931 Bacteria 1801
328 Ga0207644_10158750 3300025931 Bacteria 1756
329 Ga0207706_10001885 3300025933 Bacteria 20569
330 Ga0207706_10030339 3300025933 Bacteria 4824
331 Ga0207706_10056304 3300025933 Bacteria 3467
332 Ga0207706_10417884 3300025933 Bacteria 1162
333 Ga0207686_10058008 3300025934 Bacteria 2439
334 Ga0207686_10149050 3300025934 Bacteria 1626
335 Ga0207686_10388987 3300025934 Bacteria 1059
336 Ga0207709_11087997 3300025935 Bacteria 656
337 Ga0207670_10006451 3300025936 Bacteria 6506
338 Ga0207670_10011164 3300025936 Bacteria 5204
339 Ga0207669_10015792 3300025937 Bacteria 3818
340 Ga0207669_10088904 3300025937 Bacteria 2005
341 Ga0207669_11178924 3300025937 Bacteria 648
342 Ga0207704_10088286 3300025938 Bacteria 2028
343 Ga0207704_10116678 3300025938 Bacteria 1817
344 Ga0207704_10178467 3300025938 Bacteria 1532
345 Ga0207704_10335670 3300025938 Bacteria 1171
346 Ga0207704_11363852 3300025938 Unclassified 607
347 Ga0207691_10003211 3300025940 Bacteria 15944
348 Ga0207691_10012468 3300025940 Bacteria 8150
349 Ga0207691_10023407 3300025940 Bacteria 5814
350 Ga0207691_10080341 3300025940 Bacteria 2933
351 Ga0207691_10397130 3300025940 Bacteria 1176
352 Ga0207691_10861885 3300025940 Bacteria 759
353 Ga0207711_10183483 3300025941 Bacteria 1904
354 Ga0207689_10006306 3300025942 Bacteria 10506
355 Ga0207689_10014664 3300025942 Bacteria 6656
356 Ga0207689_10092138 3300025942 Bacteria 2489
357 Ga0207689_10109954 3300025942 Bacteria 2265
358 Ga0207689_10135305 3300025942 Bacteria 2029
359 Ga0207689_10232021 3300025942 Bacteria 1525
360 Ga0207689_10349865 3300025942 Bacteria 1228
361 Ga0207661_10011551 3300025944 Bacteria 6404
362 Ga0207661_10096742 3300025944 Bacteria 2471
363 Ga0207661_10326197 3300025944 Bacteria 1381
364 Ga0207679_10007245 3300025945 Bacteria 7032
365 Ga0207679_10042619 3300025945 Unclassified 3263
366 Ga0207679_10107269 3300025945 Bacteria 2197
367 Ga0207679_10151388 3300025945 Bacteria 1888
368 Ga0207679_10704484 3300025945 Unclassified 916
369 Ga0207651_10015393 3300025960 Bacteria 4444
370 Ga0207651_10020870 3300025960 Bacteria 3966
371 Ga0207651_10029536 3300025960 Bacteria 3475
372 Ga0207651_10806901 3300025960 Bacteria 832
373 Ga0207712_10062222 3300025961 Bacteria 2652
374 Ga0207712_10310275 3300025961 Bacteria 1298
375 Ga0207712_10817870 3300025961 Bacteria 820
376 Ga0207668_10637529 3300025972 Unclassified 931
377 Ga0207668_11563294 3300025972 Bacteria 595
378 Ga0207640_10100702 3300025981 Bacteria 2025
379 Ga0207640_10215041 3300025981 Bacteria 1467
380 Ga0207640_11665266 3300025981 Bacteria 575
381 Ga0207658_10076527 3300025986 Bacteria 2550
382 Ga0207658_10349506 3300025986 Bacteria 1287
383 Ga0207658_10514355 3300025986 Bacteria 1068
384 Ga0207677_10008306 3300026023 Bacteria 5789
385 Ga0207677_10017687 3300026023 Bacteria 4259
386 Ga0207677_10031565 3300026023 Bacteria 3394
387 Ga0207677_10170271 3300026023 Bacteria 1702
388 Ga0207703_10052387 3300026035 Bacteria 3313
389 Ga0207703_10406422 3300026035 Unclassified 1264
390 Ga0207703_10549814 3300026035 Bacteria 1088
391 Ga0207639_10189493 3300026041 Bacteria 1756
392 Ga0207639_10201582 3300026041 Bacteria 1707
393 Ga0207678_10730592 3300026067 Bacteria 872
394 Ga0207708_10153513 3300026075 Bacteria 1815
395 Ga0207702_10354926 3300026078 Bacteria 1404
396 Ga0207641_10047582 3300026088 Bacteria 3617
397 Ga0207641_10068216 3300026088 Bacteria 3049
398 Ga0207641_10303340 3300026088 Bacteria 1509
399 Ga0207641_11856772 3300026088 Unclassified 604
400 Ga0207648_10002718 3300026089 Bacteria 18798
401 Ga0207648_10019651 3300026089 Bacteria 6096
402 Ga0207648_10039177 3300026089 Bacteria 4167
403 Ga0207648_10041215 3300026089 Bacteria 4055
404 Ga0207648_10186951 3300026089 Bacteria 1835
405 Ga0207676_10008260 3300026095 Bacteria 7404
406 Ga0207676_10040225 3300026095 Bacteria 3582
407 Ga0207676_10161983 3300026095 Bacteria 1939
408 Ga0207676_10178886 3300026095 Bacteria 1855
409 Ga0207676_10248759 3300026095 Bacteria 1599
410 Ga0207676_10784974 3300026095 Bacteria 928
411 Ga0207674_10034840 3300026116 Bacteria 5258
412 Ga0207674_10329098 3300026116 Bacteria 1477
413 Ga0207675_100083074 3300026118 Bacteria 3004
414 Ga0207675_100116047 3300026118 Bacteria 2530
415 Ga0207675_100159741 3300026118 Bacteria 2149
416 Ga0207675_100518640 3300026118 Bacteria 1188
417 Ga0207683_10022465 3300026121 Bacteria 5416
418 Ga0207683_10056314 3300026121 Bacteria 3448
419 Ga0207683_10079691 3300026121 Bacteria 2904
420 Ga0207683_10232263 3300026121 Bacteria 1682
421 Ga0207683_10430407 3300026121 Bacteria 1216
422 Ga0207698_10101004 3300026142 Bacteria 2391
423 Ga0207698_11381792 3300026142 Bacteria 719
424 Ga0268266_10299322 3300028379 Bacteria 1500
425 Ga0268265_10283747 3300028380 Bacteria 1483
426 Ga0268265_11430654 3300028380 Bacteria 694
427 Ga0268264_10045112 3300028381 Bacteria 3660
428 Ga0268264_10346239 3300028381 Unclassified 1413
429 Ga0268264_12065968 3300028381 Unclassified 579
430 Ga0316177_1127418 3300030731 Unclassified 1172
431 Ga0307509_10569093 3300031507 Bacteria 809
432 Ga0307414_11143442 3300032004 Bacteria 720
433 Ga0307510_10006849 3300033180 Bacteria 13591
434 Ga0373944_0086352 3300035089 Bacteria 1043
435 Ga0373955_0023552 3300035172 Bacteria 3138
436 Ga0373955_0403254 3300035172 Bacteria 831
437 Ga0373924_0159008 3300035410 Bacteria 990
438 Ga0373935_0214503 3300035692 Bacteria 1335
439 Ga0373933_0097470 3300035724 Bacteria 1821
440 Ga0373947_0170942 3300035725 Bacteria 1410
441 Ga0373937_0005153 3300036401 Bacteria 11144
442 Ga0373937_0726503 3300036401 Unclassified 940
443 Ga0395900_0129236 3300037418 Bacteria 2590
444 Ga0395900_0133636 3300037418 Bacteria 2542
445 Ga0395898_0159004 3300037466 Bacteria 2161
446 Ga0395905_0003724 3300037471 Bacteria 16154
447 Ga0395901_0549156 3300038443 Bacteria 1171
448 Ga0439439_0014464 3300041406 Bacteria 1922
449 Ga0439453_0012094 3300041408 Bacteria 1449
450 Ga0451798_1034197 3300041458 Bacteria 892
451 Ga0439431_0058357 3300041997 Bacteria 1011
452 Ga0439457_076057 3300042014 Bacteria 769
453 Ga0439462_0122479 3300042015 Unclassified 724
454 Ga0450897_005140 3300042128 Unclassified 1124
455 Ga0450894_013488 3300042131 Unclassified 1074
456 Ga0439434_0036360 3300042435 Bacteria 1506
457 Ga0439464_0141172 3300042439 Bacteria 750
458 Ga0451577_0003916 3300042876 Bacteria 16080
459 Ga0466966_0340143 3300044684 Unclassified 902
460 Ga0466964_0214980 3300044706 Unclassified 930
461 Ga0466959_0390437 3300045049 Unclassified 947
462 Ga0495592_0057524 3300046454 Bacteria 2870
463 Ga0495629_0242461 3300046459 Unclassified 1241
464 Ga0495650_0010414 3300046471 Bacteria 5188
465 Ga0495608_0013835 3300046511 Bacteria 5599
466 Ga0495618_0092032 3300046514 Bacteria 1939
467 Ga0495628_0070255 3300046516 Bacteria 2730
468 Ga0495630_0014340 3300046517 Bacteria 5772
469 Ga0495652_0128588 3300046529 Bacteria 2009
470 Ga0495587_0005622 3300046536 Bacteria 8180
471 Ga0495634_0033188 3300046642 Bacteria 3547
472 Ga0495658_0185673 3300046683 Bacteria 1291
473 Ga0495613_0101594 3300046689 Bacteria 2077
474 Ga0495600_0233468 3300046809 Bacteria 1174
475 Ga0495674_0447471 3300047319 Bacteria 1038
476 Ga0495684_0151936 3300047471 Bacteria 1731
477 Ga0495684_0430910 3300047471 Bacteria 920
478 Ga0495686_0020731 3300047472 Bacteria 4381
479 Ga0496104_1410031 3300048907 Bacteria 600
480 Ga0496108_0397647 3300048911 Bacteria 1203
481 Ga0496109_0757484 3300048912 Bacteria 909
482 Ga0496110_0184558 3300048913 Bacteria 1894
483 Ga0496111_0059905 3300048914 Bacteria 2759
484 Ga0501298_039029 3300049521 Bacteria 958
485 Ga0501031_0029119 3300049568 Bacteria 3602
486 Ga0501032_0006824 3300049569 Bacteria 8377
487 Ga0501032_0021185 3300049569 Bacteria 4522
488 Ga0501034_0053130 3300049571 Bacteria 4081
489 Ga0501036_0018762 3300049572 Bacteria 5801
490 Ga0501036_0148602 3300049572 Bacteria 1976
491 Ga0501037_0101182 3300049573 Bacteria 2080
492 Ga0501038_0068805 3300049574 Bacteria 3009
493 Ga0501038_0115765 3300049574 Bacteria 2216
494 Ga0501039_0069217 3300049575 Bacteria 2740
495 Ga0501043_0022148 3300049579 Bacteria 4985
496 Ga0501046_0035053 3300049580 Bacteria 4045
497 Ga0501046_0706530 3300049580 Bacteria 710
498 Ga0501047_0042705 3300049581 Bacteria 4380
499 Ga0501047_0472573 3300049581 Bacteria 1082
500 Ga0501047_0525165 3300049581 Unclassified 1009
501 Ga0501047_1009818 3300049581 Unclassified 645
502 Ga0501048_0020640 3300049582 Bacteria 4829
503 Ga0501070_0049573 3300049586 Bacteria 3487
504 Ga0501072_0257745 3300049588 Bacteria 1389
505 Ga0501072_0263207 3300049588 Bacteria 1373
506 Ga0501073_0110936 3300049589 Bacteria 1903
507 Ga0501074_0001080 3300049590 Bacteria 17807
508 Ga0501201_001679 3300049651 Unclassified 2061
509 Ga0501202_003064 3300049652 Bacteria 2844
510 Ga0501206_010748 3300049653 Unclassified 1229
511 Ga0501207_014629 3300049654 Unclassified 1200
512 Ga0501217_010919 3300049661 Bacteria 2000
513 Ga0501223_028354 3300049663 Bacteria 1090
514 Ga0501227_122542 3300049665 Bacteria 703
515 Ga0501233_006095 3300049668 Bacteria 2256
516 Ga0501257_019559 3300049686 Bacteria 1585
517 Ga0501259_019014 3300049688 Bacteria 1205
518 Ga0501261_025306 3300049690 Bacteria 873
519 Ga0501225_0003837 3300049705 Bacteria 4514
520 Ga0501079_0429715 3300049741 Bacteria 1037
521 Ga0501083_0058576 3300049744 Bacteria 2577
522 Ga0501083_0083138 3300049744 Bacteria 2121
523 Ga0501266_003463 3300049763 Bacteria 1957
524 Ga0501268_029669 3300049765 Bacteria 984
525 Ga0501035_0012008 3300049822 Bacteria 8012
526 Ga0501035_0031943 3300049822 Bacteria 4795
527 Ga0501044_0035422 3300049823 Bacteria 5227
528 Ga0501044_0043726 3300049823 Bacteria 4652
529 Ga0501045_1023126 3300049824 Bacteria 605
530 Ga0501212_081277 3300049851 Bacteria 587
531 nmdc:mga0k408_694868_c1 3300050493 Unclassified 596
532 nmdc:mga09592_181167_c1 3300050508 Bacteria 1823
533 nmdc:mga09592_3240_c1 3300050508 Bacteria 13165
534 nmdc:mga09592_330279_c1 3300050508 Bacteria 1320
535 nmdc:mga09592_70513_c1 3300050508 Bacteria 2965
536 nmdc:mga0qj67_186507_c1 3300050509 Bacteria 1685
537 nmdc:mga06r32_190246_c1 3300050510 Bacteria 2040
538 nmdc:mga06r32_749042_c1 3300050510 Bacteria 940
539 nmdc:mga08y16_299641_c1 3300050511 Bacteria 1657
540 nmdc:mga0n895_1148697_c1 3300050512 Unclassified 752
541 nmdc:mga0n895_287819_c1 3300050512 Unclassified 1666
542 nmdc:mga0rr50_523928_c1 3300050513 Bacteria 1008
543 Ga0500641_0218268 3300053096 Bacteria 809
544 Ga0500568_0000789 3300053139 Bacteria 22357
545 Ga0501084_0243208 3300054114 Bacteria 1519
546 Ga0501082_0412955 3300060353 Bacteria 1178
547 Ga0495672_0005966
548 rootH1_10172092
549 Ga0065707_10254862
550 Ga0070676_10001325
551 Ga0070683_100051461
552 Ga0070683_100350825
553 Ga0070690_100011362
554 Ga0070670_100008754
555 Ga0070670_100581944
556 Ga0070677_10020590
557 Ga0070677_10184022
558 Ga0070677_10239416
559 Ga0070677_10359097
560 Ga0068869_100045427
561 Ga0068869_100063215
562 Ga0068869_101834801
563 Ga0070666_10010751
564 Ga0070666_10013536
565 Ga0070666_10027518
566 Ga0070666_10193953
567 Ga0070666_10861585
568 Ga0068868_100011614
569 Ga0068868_100012807
570 Ga0068868_100033396
571 Ga0068868_100043570
572 Ga0068868_100212115
573 Ga0068868_100744459
574 Ga0070689_100021872
575 Ga0070689_100048200
576 Ga0070689_100123509
577 Ga0070687_100011166
578 Ga0070687_100244726
579 Ga0070661_100068203
580 Ga0070661_100075745
581 Ga0070661_100143935
582 Ga0070661_100196951
583 Ga0070692_10232804
584 Ga0070668_100051009
585 Ga0070668_100281320
586 Ga0070669_100118820
587 Ga0070669_100144586
588 Ga0070669_100344963
589 Ga0070669_100532030
590 Ga0070669_100550586
591 Ga0070675_100023556
592 Ga0070675_100050877
593 Ga0070675_100173139
594 Ga0070675_100190058
595 Ga0070675_100228334
596 Ga0070671_100012119
597 Ga0070671_100086177
598 Ga0070671_100293817
599 Ga0070674_100014393
600 Ga0070674_100090723
601 Ga0070674_100349686
602 Ga0070673_100020383
603 Ga0070673_100067074
604 Ga0070673_100079656
605 Ga0070673_100131236
606 Ga0070673_100378944
607 Ga0070673_100541459
608 Ga0070688_100029855
609 Ga0070688_100057190
610 Ga0070688_101056757
611 Ga0070659_100065652
612 Ga0070667_100093252
613 Ga0070667_100242470
614 Ga0070667_100604129
615 Ga0070667_100722989
616 Ga0070701_10599351
617 Ga0070705_100370065
618 Ga0070700_100184553
619 Ga0070663_100118602
620 Ga0070678_100009652
621 Ga0070678_100060041
622 Ga0070678_100072181
623 Ga0070678_100389458
624 Ga0070662_100014062
625 Ga0070662_100035254
626 Ga0070662_100050450
627 Ga0068867_100019530
628 Ga0068867_100022046
629 Ga0068867_100061984
630 Ga0068867_100193661
631 Ga0068867_100374629
632 Ga0068867_100487979
633 Ga0068867_101000836
634 Ga0070685_10006017
635 Ga0070685_10028866
636 Ga0070685_10047700
637 Ga0070685_10113994
638 Ga0070685_10281151
639 Ga0070685_10685663
640 Ga0070698_100055394
641 Ga0070684_100626631
642 Ga0068853_100313873
643 Ga0068853_100368208
644 Ga0070672_100012883
645 Ga0070672_100127375
646 Ga0070672_100221430
647 Ga0070672_100453311
648 Ga0070686_100002926
649 Ga0070686_100128048
650 Ga0070695_100370730
651 Ga0070695_100635625
652 Ga0070695_101142172
653 Ga0070665_100021278
654 Ga0068855_101730067
655 Ga0070664_100015502
656 Ga0070664_100062239
657 Ga0070664_100083370
658 Ga0070664_100531634
659 Ga0070664_100729372
660 Ga0068857_100820352
661 Ga0068854_100139431
662 Ga0068854_100451414
663 Ga0070702_100144427
664 Ga0068852_100080157
665 Ga0068852_100410514
666 Ga0068852_100507667
667 Ga0068852_100508341
668 Ga0068859_100133499
669 Ga0068859_100136119
670 Ga0068859_100431303
671 Ga0068859_100725348
672 Ga0068864_100002925
673 Ga0068864_100027699
674 Ga0068864_100043599
675 Ga0068864_100047725
676 Ga0068864_100073640
677 Ga0068864_100260153
678 Ga0068864_100402642
679 Ga0068866_10032534
680 Ga0068866_10054052
681 Ga0068866_10058498
682 Ga0068866_10486600
683 Ga0068861_100110671
684 Ga0068861_100461176
685 Ga0068861_101286142
686 Ga0068861_101294027
687 Ga0068851_10241730
688 Ga0068851_10543334
689 Ga0068870_10097244
690 Ga0068870_10312544
691 Ga0068870_10483644
692 Ga0068863_100065138
693 Ga0068863_100118120
694 Ga0068863_100160098
695 Ga0068858_100049328
696 Ga0068858_100267350
697 Ga0068858_100339500
698 Ga0068858_100404333
699 Ga0068860_100379891
700 Ga0068860_100440182
701 Ga0068860_101646502
702 Ga0068862_100847496
703 Ga0070715_10016653
704 Ga0075366_10310037
705 Ga0097621_100022099
706 Ga0097621_100122240
707 Ga0097621_100127129
708 Ga0097621_100170424
709 Ga0097621_100280773
710 Ga0097621_100324882
711 Ga0097621_100557966
712 Ga0097621_100590921
713 Ga0068871_100015017
714 Ga0068871_100033437
715 Ga0068871_100089876
716 Ga0068871_100181019
717 Ga0068871_100335257
718 Ga0068871_100500428
719 Ga0068871_100819055
720 Ga0075428_100019968
721 Ga0075428_100157788
722 Ga0075430_100009129
723 Ga0075430_100061969
724 Ga0075431_100022157
725 Ga0075431_100035285
726 Ga0075434_101336307
727 Ga0075429_100002343
728 Ga0068865_100025834
729 Ga0068865_100085792
730 Ga0068865_100090132
731 Ga0068865_101070976
732 Ga0097620_100133498
733 Ga0097620_100136119
734 Ga0097620_100431314
735 Ga0097620_100725357
736 Ga0075435_100253876
737 Ga0075435_100508399
738 Ga0105251_10093510
739 Ga0105240_10000486
740 Ga0105240_10008759
741 Ga0105247_10009206
742 Ga0105247_10224855
743 Ga0105247_10581274
744 Ga0105243_10047996
745 Ga0105241_10039033
746 Ga0105241_10372844
747 Ga0105241_10537692
748 Ga0105242_10013883
749 Ga0105242_10035808
750 Ga0105242_10043015
751 Ga0105242_10076761
752 Ga0105242_10126189
753 Ga0105242_10183446
754 Ga0105248_10107003
755 Ga0105248_10982676
756 Ga0105237_10000340
757 Ga0105237_10241006
758 Ga0105237_10780517
759 Ga0105249_10007028
760 Ga0105249_10008818
761 Ga0105249_10798203
762 Ga0105249_11052875
763 Ga0105246_10016636
764 Ga0105246_10234589
765 Ga0157373_10079830
766 Ga0157371_10284733
767 Ga0157370_10028800
768 Ga0157370_10444197
769 Ga0157370_10521944
770 Ga0157370_11289792
771 Ga0157369_10578752
772 Ga0157374_10005863
773 Ga0157374_10068247
774 Ga0157374_10237862
775 Ga0157374_10354773
776 Ga0157378_10054774
777 Ga0157378_10096697
778 Ga0157378_10206721
779 Ga0157378_10206916
780 Ga0157378_10265145
781 Ga0157378_10839158
782 Ga0163162_10002125
783 Ga0163162_10034572
784 Ga0163162_10043831
785 Ga0163162_10161415
786 Ga0163162_10173053
787 Ga0163162_10251045
788 Ga0163162_11092202
789 Ga0163162_11153124
790 Ga0163162_11892971
791 Ga0157372_10028569
792 Ga0157372_10148740
793 Ga0157372_10212116
794 Ga0157375_10021956
795 Ga0157375_10082278
796 Ga0157375_10095621
797 Ga0157375_10143917
798 Ga0157375_10171002
799 Ga0157375_10213962
800 Ga0157375_10321163
801 Ga0157375_10541660
802 Ga0157375_10938300
803 Ga0163163_10020818
804 Ga0163163_10095827
805 Ga0163163_10125884
806 Ga0163163_10719949
807 Ga0163163_11331867
808 Ga0157380_10918648
809 Ga0157377_10044084
810 Ga0157377_10075725
811 Ga0157377_10188923
812 Ga0157377_10250108
813 Ga0157379_10027455
814 Ga0157379_10139607
815 Ga0157379_10412502
816 Ga0157376_10098203
817 Ga0157376_10125071
818 Ga0157376_10419305
819 Ga0157376_10585690
820 Ga0157376_10661641
821 Ga0163161_10009684
822 Ga0163161_10058550
823 Ga0163161_10143504
824 Ga0163161_10146232
825 Ga0163161_10319794
826 Ga0207697_10089789
827 Ga0207697_10116565
828 Ga0207656_10178370
829 Ga0207682_10005034
830 Ga0207682_10007909
831 Ga0207642_10007143
832 Ga0207642_10052453
833 Ga0207642_10058242
834 Ga0207642_10563330
835 Ga0207710_10039228
836 Ga0207710_10170747
837 Ga0207688_10011580
838 Ga0207688_10130020
839 Ga0207680_10009218
840 Ga0207680_10242937
841 Ga0207680_10759489
842 Ga0207647_10018393
843 Ga0207685_10046251
844 Ga0207685_10068704
845 Ga0207645_10000713
846 Ga0207645_10026492
847 Ga0207643_10002813
848 Ga0207643_10011143
849 Ga0207643_10640795
850 Ga0207654_10170771
851 Ga0207654_10330118
852 Ga0207654_10576139
853 Ga0207695_10000170
854 Ga0207695_10001252
855 Ga0207671_10000456
856 Ga0207671_10207556
857 Ga0207662_10018783
858 Ga0207662_10891613
859 Ga0207649_10036125
860 Ga0207649_10677310
861 Ga0207681_10034493
862 Ga0207681_10563934
863 Ga0207681_11372823
864 Ga0207650_10242524
865 Ga0207650_10820168
866 Ga0207659_10012529
867 Ga0207659_10049219
868 Ga0207659_10160337
869 Ga0207659_10230012
870 Ga0207700_10766270
871 Ga0207644_10112780
872 Ga0207644_10128855
873 Ga0207644_10150323
874 Ga0207644_10158750
875 Ga0207706_10001885
876 Ga0207706_10030339
877 Ga0207706_10056304
878 Ga0207706_10417884
879 Ga0207686_10058008
880 Ga0207686_10149050
881 Ga0207686_10388987
882 Ga0207709_11087997
883 Ga0207670_10006451
884 Ga0207670_10011164
885 Ga0207669_10015792
886 Ga0207669_10088904
887 Ga0207669_11178924
888 Ga0207704_10088286
889 Ga0207704_10116678
890 Ga0207704_10178467
891 Ga0207704_10335670
892 Ga0207704_11363852
893 Ga0207691_10003211
894 Ga0207691_10012468
895 Ga0207691_10023407
896 Ga0207691_10080341
897 Ga0207691_10397130
898 Ga0207691_10861885
899 Ga0207711_10183483
900 Ga0207689_10006306
901 Ga0207689_10014664
902 Ga0207689_10092138
903 Ga0207689_10109954
904 Ga0207689_10135305
905 Ga0207689_10232021
906 Ga0207689_10349865
907 Ga0207661_10011551
908 Ga0207661_10096742
909 Ga0207661_10326197
910 Ga0207679_10007245
911 Ga0207679_10042619
912 Ga0207679_10107269
913 Ga0207679_10151388
914 Ga0207679_10704484
915 Ga0207651_10015393
916 Ga0207651_10020870
917 Ga0207651_10029536
918 Ga0207651_10806901
919 Ga0207712_10062222
920 Ga0207712_10310275
921 Ga0207712_10817870
922 Ga0207668_10637529
923 Ga0207668_11563294
924 Ga0207640_10100702
925 Ga0207640_10215041
926 Ga0207640_11665266
927 Ga0207658_10076527
928 Ga0207658_10349506
929 Ga0207658_10514355
930 Ga0207677_10008306
931 Ga0207677_10017687
932 Ga0207677_10031565
933 Ga0207677_10170271
934 Ga0207703_10052387
935 Ga0207703_10406422
936 Ga0207703_10549814
937 Ga0207639_10189493
938 Ga0207639_10201582
939 Ga0207678_10730592
940 Ga0207708_10153513
941 Ga0207702_10354926
942 Ga0207641_10047582
943 Ga0207641_10068216
944 Ga0207641_10303340
945 Ga0207641_11856772
946 Ga0207648_10002718
947 Ga0207648_10019651
948 Ga0207648_10039177
949 Ga0207648_10041215
950 Ga0207648_10186951
951 Ga0207676_10008260
952 Ga0207676_10040225
953 Ga0207676_10161983
954 Ga0207676_10178886
955 Ga0207676_10248759
956 Ga0207676_10784974
957 Ga0207674_10034840
958 Ga0207674_10329098
959 Ga0207675_100083074
960 Ga0207675_100116047
961 Ga0207675_100159741
962 Ga0207675_100518640
963 Ga0207683_10022465
964 Ga0207683_10056314
965 Ga0207683_10079691
966 Ga0207683_10232263
967 Ga0207683_10430407
968 Ga0207698_10101004
969 Ga0207698_11381792
970 Ga0268266_10299322
971 Ga0268265_10283747
972 Ga0268265_11430654
973 Ga0268264_10045112
974 Ga0268264_10346239
975 Ga0268264_12065968
976 Ga0316177_1127418
977 Ga0307509_10569093
978 Ga0307414_11143442
979 Ga0307510_10006849
980 Ga0373944_0086352
981 Ga0373955_0023552
982 Ga0373955_0403254
983 Ga0373924_0159008
984 Ga0373935_0214503
985 Ga0373933_0097470
986 Ga0373947_0170942
987 Ga0373937_0005153
988 Ga0373937_0726503
989 Ga0395900_0129236
990 Ga0395900_0133636
991 Ga0395898_0159004
992 Ga0395905_0003724
993 Ga0395901_0549156
994 Ga0439439_0014464
995 Ga0439453_0012094
996 Ga0451798_1034197
997 Ga0439431_0058357
998 Ga0439457_076057
999 Ga0439462_0122479
1000 Ga0450897_005140
1001 Ga0450894_013488
1002 Ga0439434_0036360
1003 Ga0439464_0141172
1004 Ga0451577_0003916
1005 Ga0466966_0340143
1006 Ga0466964_0214980
1007 Ga0466959_0390437
1008 Ga0495592_0057524
1009 Ga0495629_0242461
1010 Ga0495650_0010414
1011 Ga0495608_0013835
1012 Ga0495618_0092032
1013 Ga0495628_0070255
1014 Ga0495630_0014340
1015 Ga0495652_0128588
1016 Ga0495587_0005622
1017 Ga0495634_0033188
1018 Ga0495658_0185673
1019 Ga0495613_0101594
1020 Ga0495600_0233468
1021 Ga0495674_0447471
1022 Ga0495684_0151936
1023 Ga0495684_0430910
1024 Ga0495686_0020731
1025 Ga0496104_1410031
1026 Ga0496108_0397647
1027 Ga0496109_0757484
1028 Ga0496110_0184558
1029 Ga0496111_0059905
1030 Ga0501298_039029
1031 Ga0501031_0029119
1032 Ga0501032_0006824
1033 Ga0501032_0021185
1034 Ga0501034_0053130
1035 Ga0501036_0018762
1036 Ga0501036_0148602
1037 Ga0501037_0101182
1038 Ga0501038_0068805
1039 Ga0501038_0115765
1040 Ga0501039_0069217
1041 Ga0501043_0022148
1042 Ga0501046_0035053
1043 Ga0501046_0706530
1044 Ga0501047_0042705
1045 Ga0501047_0472573
1046 Ga0501047_0525165
1047 Ga0501047_1009818
1048 Ga0501048_0020640
1049 Ga0501070_0049573
1050 Ga0501072_0257745
1051 Ga0501072_0263207
1052 Ga0501073_0110936
1053 Ga0501074_0001080
1054 Ga0501201_001679
1055 Ga0501202_003064
1056 Ga0501206_010748
1057 Ga0501207_014629
1058 Ga0501217_010919
1059 Ga0501223_028354
1060 Ga0501227_122542
1061 Ga0501233_006095
1062 Ga0501257_019559
1063 Ga0501259_019014
1064 Ga0501261_025306
1065 Ga0501225_0003837
1066 Ga0501079_0429715
1067 Ga0501083_0058576
1068 Ga0501083_0083138
1069 Ga0501266_003463
1070 Ga0501268_029669
1071 Ga0501035_0012008
1072 Ga0501035_0031943
1073 Ga0501044_0035422
1074 Ga0501044_0043726
1075 Ga0501045_1023126
1076 Ga0501212_081277
1077 nmdc:mga0k408_694868_c1
1078 nmdc:mga09592_181167_c1
1079 nmdc:mga09592_3240_c1
1080 nmdc:mga09592_330279_c1
1081 nmdc:mga09592_70513_c1
1082 nmdc:mga0qj67_186507_c1
1083 nmdc:mga06r32_190246_c1
1084 nmdc:mga06r32_749042_c1
1085 nmdc:mga08y16_299641_c1
1086 nmdc:mga0n895_1148697_c1
1087 nmdc:mga0n895_287819_c1
1088 nmdc:mga0rr50_523928_c1
1089 Ga0500641_0218268
1090 Ga0500568_0000789
1091 Ga0501084_0243208
1092 Ga0501082_0412955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01202

SKI

Shikimate kinase

44

203

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kag-assembly2.cif.gz_B crystal structure of the escherichia coli shikimate kinase i (arok) 0.9142 2 164
3vaa-assembly2.cif.gz_B 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.8946 1 168
3vaa-assembly3.cif.gz_C 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.8906 1 168
2pt5-assembly4.cif.gz_D crystal structure of shikimate kinase (aq_2177) from aquifex aeolicus vf5 0.8858 1 168
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.8853 2 168
ID Description Score Start End Superfamily
3vaaC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8907 1 168 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8853 2 168 3.40.50.300
af_I1JY85_1_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8818 8 168 3.40.50.300
af_Q9SJ05_86_302_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8787 2 168 3.40.50.300
af_Q2FY32_1_173_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8736 2 168 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4R1BJI3-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9883 2 169 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7C3C815-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9831 1 153 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A1M5HH94-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9829 2 169 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A1Q6ILD2-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9816 1 151 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423
AF-A0A7C4Y9M8-F1-model_v4 Shikimate kinase (SK) (EC 2.7.1.71) 0.9799 1 169 GO:0000287
GO:0004765
GO:0005524
GO:0005829
GO:0008652
GO:0009073
GO:0009423

Map