F461977

General Info

Members Datasets Scaffolds Average Seq Length
546 255 1092 119

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10022050|Ga0075433_100220503
Length 144
Sequence MLARRPGGVNETPHEIEVFQQRMLEFPTVAPASPLETFPNPRPEREFEIAINCPEFTSVCPKTGLPDFGEIHITYVPGDRCIELKSLKYYMIEFRNRGIFYEAVTNQILDDLVAACQPRRMTVVGDFSVRGGIKTVVTASYTRP

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
180 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
181 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
182 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
235 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.65
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10022050 3300006852 Bacteria 5345
2 LJQas_1022215 3300000549 Bacteria 737
3 JGI24751J29686_10125297 3300002459 Bacteria 541
4 JGI25406J46586_10000816 3300003203 Bacteria 14613
5 Ga0065714_10009532 3300005288 Bacteria 2742
6 Ga0065712_10010200 3300005290 Bacteria 2295
7 Ga0065712_10069509 3300005290 Bacteria 7167
8 Ga0065712_10089173 3300005290 Bacteria 2483
9 Ga0065712_10172095 3300005290 Bacteria 1235
10 Ga0065715_10124339 3300005293 Bacteria 2156
11 Ga0065715_10268911 3300005293 Bacteria 1116
12 Ga0065715_10452196 3300005293 Unclassified 817
13 Ga0065715_10548719 3300005293 Bacteria 742
14 Ga0065715_10618179 3300005293 Unclassified 693
15 Ga0070658_10064061 3300005327 Bacteria 2998
16 Ga0070658_10228765 3300005327 Bacteria 1574
17 Ga0070658_10742048 3300005327 Bacteria 853
18 Ga0070676_10911910 3300005328 Bacteria 655
19 Ga0070683_100018512 3300005329 Bacteria 6171
20 Ga0070683_100360285 3300005329 Bacteria 1385
21 Ga0070690_100022364 3300005330 Bacteria 3868
22 Ga0070690_100446475 3300005330 Bacteria 958
23 Ga0070690_100591989 3300005330 Bacteria 841
24 Ga0070670_100001833 3300005331 Bacteria 17306
25 Ga0070670_100007405 3300005331 Bacteria 9320
26 Ga0070670_101285394 3300005331 Bacteria 670
27 Ga0070677_10023896 3300005333 Bacteria 2267
28 Ga0070677_10250080 3300005333 Unclassified 879
29 Ga0070677_10268001 3300005333 Bacteria 855
30 Ga0070677_10373564 3300005333 Unclassified 744
31 Ga0068869_100021807 3300005334 Bacteria 4409
32 Ga0068869_100179303 3300005334 Bacteria 1660
33 Ga0068869_101848872 3300005334 Unclassified 540
34 Ga0070666_10239075 3300005335 Bacteria 1284
35 Ga0070680_100162547 3300005336 Bacteria 1877
36 Ga0070680_100498489 3300005336 Bacteria 1042
37 Ga0070682_101516361 3300005337 Bacteria 577
38 Ga0068868_100049653 3300005338 Bacteria 3293
39 Ga0068868_100238070 3300005338 Bacteria 1528
40 Ga0070660_100013121 3300005339 Bacteria 5934
41 Ga0070689_100072754 3300005340 Bacteria 2687
42 Ga0070687_100337243 3300005343 Bacteria 968
43 Ga0070661_101615350 3300005344 Bacteria 548
44 Ga0070692_10069967 3300005345 Bacteria 1868
45 Ga0070669_100519612 3300005353 Bacteria 990
46 Ga0070669_101107336 3300005353 Unclassified 682
47 Ga0070675_100028999 3300005354 Bacteria 4460
48 Ga0070675_100317189 3300005354 Bacteria 1376
49 Ga0070675_101150827 3300005354 Bacteria 714
50 Ga0070675_101206224 3300005354 Bacteria 697
51 Ga0070675_102035195 3300005354 Bacteria 529
52 Ga0070671_100148295 3300005355 Bacteria 1980
53 Ga0070671_100562813 3300005355 Bacteria 984
54 Ga0070674_100000622 3300005356 Bacteria 17859
55 Ga0070674_100114878 3300005356 Bacteria 1983
56 Ga0070674_101443531 3300005356 Bacteria 617
57 Ga0070674_101730247 3300005356 Unclassified 566
58 Ga0070674_102063682 3300005356 Bacteria 520
59 Ga0070673_100025371 3300005364 Bacteria 4362
60 Ga0070673_100141101 3300005364 Bacteria 2032
61 Ga0070673_100951384 3300005364 Unclassified 798
62 Ga0070688_100002444 3300005365 Bacteria 9395
63 Ga0070659_100149624 3300005366 Unclassified 1904
64 Ga0070667_100703870 3300005367 Bacteria 935
65 Ga0070667_101199007 3300005367 Unclassified 710
66 Ga0070709_10636951 3300005434 Bacteria 824
67 Ga0070713_100428040 3300005436 Bacteria 1240
68 Ga0070701_10143973 3300005438 Bacteria 1366
69 Ga0070701_10219227 3300005438 Bacteria 1134
70 Ga0070711_100755478 3300005439 Bacteria 822
71 Ga0070705_100003171 3300005440 Bacteria 8075
72 Ga0070705_100077369 3300005440 Bacteria 2032
73 Ga0070705_100233671 3300005440 Bacteria 1281
74 Ga0070705_100438249 3300005440 Bacteria 977
75 Ga0070700_100139125 3300005441 Bacteria 1648
76 Ga0070694_100001815 3300005444 Bacteria 12642
77 Ga0070694_100104512 3300005444 Bacteria 2009
78 Ga0070694_100571017 3300005444 Bacteria 908
79 Ga0070708_101987398 3300005445 Bacteria 538
80 Ga0070663_100357198 3300005455 Bacteria 1184
81 Ga0070663_100590507 3300005455 Bacteria 933
82 Ga0070663_101875369 3300005455 Unclassified 538
83 Ga0070678_100368512 3300005456 Bacteria 1240
84 Ga0070678_100505916 3300005456 Bacteria 1066
85 Ga0070678_100929785 3300005456 Unclassified 796
86 Ga0070678_101769353 3300005456 Unclassified 582
87 Ga0070662_101198595 3300005457 Bacteria 653
88 Ga0070681_10054824 3300005458 Bacteria 3972
89 Ga0070681_10426256 3300005458 Bacteria 1239
90 Ga0070681_11088970 3300005458 Bacteria 720
91 Ga0070685_10005183 3300005466 Bacteria 6610
92 Ga0070685_11397646 3300005466 Unclassified 537
93 Ga0070706_100239580 3300005467 Bacteria 1694
94 Ga0070706_100466665 3300005467 Bacteria 1175
95 Ga0070707_100165428 3300005468 Unclassified 2155
96 Ga0070707_100214089 3300005468 Bacteria 1878
97 Ga0070707_100572169 3300005468 Unclassified 1092
98 Ga0070698_100002047 3300005471 Bacteria 22406
99 Ga0070698_100003530 3300005471 Bacteria 17209
100 Ga0070698_100028774 3300005471 Bacteria 5767
101 Ga0070698_100462261 3300005471 Bacteria 1205
102 Ga0070698_100999543 3300005471 Unclassified 784
103 Ga0070698_101222173 3300005471 Bacteria 701
104 Ga0070699_100002695 3300005518 Bacteria 15865
105 Ga0070699_100005175 3300005518 Bacteria 11477
106 Ga0070699_100011830 3300005518 Bacteria 7530
107 Ga0070699_100029759 3300005518 Bacteria 4710
108 Ga0070699_100069732 3300005518 Bacteria 3055
109 Ga0070699_100510388 3300005518 Bacteria 1092
110 Ga0070699_101094345 3300005518 Bacteria 731
111 Ga0070679_100073428 3300005530 Bacteria 3412
112 Ga0070684_100037676 3300005535 Bacteria 4150
113 Ga0070684_100763586 3300005535 Bacteria 903
114 Ga0070697_100285033 3300005536 Bacteria 1418
115 Ga0070697_101031127 3300005536 Bacteria 732
116 Ga0070672_100035513 3300005543 Bacteria 3790
117 Ga0070672_100415786 3300005543 Bacteria 1154
118 Ga0070672_101926971 3300005543 Unclassified 532
119 Ga0070686_101236336 3300005544 Unclassified 622
120 Ga0070686_101236622 3300005544 Unclassified 622
121 Ga0070695_100108256 3300005545 Bacteria 1882
122 Ga0070695_100248080 3300005545 Bacteria 1294
123 Ga0070695_100283273 3300005545 Bacteria 1219
124 Ga0070696_100001831 3300005546 Bacteria 13958
125 Ga0070696_100006617 3300005546 Bacteria 7740
126 Ga0070696_101279919 3300005546 Bacteria 622
127 Ga0070665_100823819 3300005548 Unclassified 941
128 Ga0070704_100000764 3300005549 Bacteria 15840
129 Ga0070704_100042985 3300005549 Bacteria 3130
130 Ga0070704_100425029 3300005549 Bacteria 1139
131 Ga0070704_100959574 3300005549 Unclassified 772
132 Ga0068855_100031521 3300005563 Bacteria 6330
133 Ga0070664_100025836 3300005564 Bacteria 4869
134 Ga0068857_100316006 3300005577 Bacteria 1442
135 Ga0068857_100319317 3300005577 Bacteria 1434
136 Ga0068854_100410681 3300005578 Bacteria 1122
137 Ga0068856_100394426 3300005614 Bacteria 1404
138 Ga0070702_100272700 3300005615 Bacteria 1157
139 Ga0068852_102060166 3300005616 Bacteria 593
140 Ga0068859_100051075 3300005617 Bacteria 4155
141 Ga0068859_100886049 3300005617 Bacteria 977
142 Ga0068859_101547954 3300005617 Unclassified 732
143 Ga0068859_102032339 3300005617 Bacteria 634
144 Ga0068864_100036454 3300005618 Bacteria 4192
145 Ga0068864_102040979 3300005618 Unclassified 580
146 Ga0068866_11087066 3300005718 Unclassified 572
147 Ga0068858_100278065 3300005842 Bacteria 1594
148 Ga0081538_10134092 3300005981 Bacteria 1157
149 Ga0081539_10000093 3300005985 Bacteria 207314
150 Ga0075364_10550634 3300006051 Unclassified 788
151 Ga0070712_100048976 3300006175 Bacteria 2932
152 Ga0097621_100996251 3300006237 Bacteria 784
153 Ga0068871_100494173 3300006358 Bacteria 1102
154 Ga0068871_101460104 3300006358 Bacteria 646
155 Ga0075428_100000007 3300006844 Bacteria 273226
156 Ga0075428_100112905 3300006844 Bacteria 2960
157 Ga0075428_100122349 3300006844 Bacteria 2833
158 Ga0075428_100231055 3300006844 Bacteria 1996
159 Ga0075428_100287901 3300006844 Bacteria 1767
160 Ga0075428_100996594 3300006844 Bacteria 887
161 Ga0075430_100139765 3300006846 Bacteria 2017
162 Ga0075430_100711341 3300006846 Bacteria 828
163 Ga0075430_101016389 3300006846 Bacteria 683
164 Ga0075431_100019425 3300006847 Bacteria 6928
165 Ga0075431_100034867 3300006847 Bacteria 5183
166 Ga0075431_101086582 3300006847 Unclassified 765
167 Ga0075433_10121204 3300006852 Bacteria 2322
168 Ga0075433_10173185 3300006852 Unclassified 1920
169 Ga0075433_10191229 3300006852 Bacteria 1821
170 Ga0075433_11044854 3300006852 Bacteria 711
171 Ga0075434_100000452 3300006871 Bacteria 30586
172 Ga0075434_100031729 3300006871 Bacteria 5209
173 Ga0075434_100305307 3300006871 Bacteria 1612
174 Ga0075434_100370843 3300006871 Bacteria 1452
175 Ga0075429_100020383 3300006880 Bacteria 5751
176 Ga0075429_100024367 3300006880 Bacteria 5250
177 Ga0075429_100296348 3300006880 Bacteria 1416
178 Ga0068865_100817300 3300006881 Bacteria 805
179 Ga0068865_101210400 3300006881 Unclassified 669
180 Ga0097620_100051072 3300006931 Bacteria 4155
181 Ga0097620_100886052 3300006931 Bacteria 977
182 Ga0097620_101547810 3300006931 Unclassified 732
183 Ga0097620_102032288 3300006931 Bacteria 634
184 Ga0075435_100024637 3300007076 Bacteria 4672
185 Ga0075435_100042630 3300007076 Bacteria 3631
186 Ga0075435_100792921 3300007076 Bacteria 825
187 Ga0111539_10000209 3300009094 Bacteria 69503
188 Ga0111539_10133039 3300009094 Bacteria 2912
189 Ga0111539_10220778 3300009094 Bacteria 2207
190 Ga0111539_10572816 3300009094 Bacteria 1315
191 Ga0111539_11209123 3300009094 Bacteria 878
192 Ga0111539_12487920 3300009094 Bacteria 600
193 Ga0105245_10311005 3300009098 Bacteria 1549
194 Ga0105245_10828410 3300009098 Bacteria 964
195 Ga0114129_10000309 3300009147 Bacteria 56974
196 Ga0114129_10005556 3300009147 Bacteria 17834
197 Ga0114129_10013363 3300009147 Bacteria 11697
198 Ga0114129_10146578 3300009147 Bacteria 3233
199 Ga0114129_10278129 3300009147 Bacteria 2237
200 Ga0114129_11534824 3300009147 Unclassified 817
201 Ga0114129_11965804 3300009147 Bacteria 708
202 Ga0114129_13138258 3300009147 Unclassified 539
203 Ga0105243_10176821 3300009148 Bacteria 1853
204 Ga0105243_10431394 3300009148 Bacteria 1232
205 Ga0105243_11905539 3300009148 Unclassified 627
206 Ga0105242_10314216 3300009176 Bacteria 1435
207 Ga0105242_10531224 3300009176 Bacteria 1124
208 Ga0105242_10604252 3300009176 Unclassified 1060
209 Ga0105242_10913541 3300009176 Bacteria 879
210 Ga0105242_11834106 3300009176 Bacteria 645
211 Ga0105242_12784708 3300009176 Bacteria 539
212 Ga0105248_10003756 3300009177 Bacteria 16830
213 Ga0105248_10082834 3300009177 Bacteria 3609
214 Ga0105248_10547948 3300009177 Bacteria 1305
215 Ga0105248_12814146 3300009177 Unclassified 555
216 Ga0105248_13319248 3300009177 Unclassified 512
217 Ga0105237_11362994 3300009545 Bacteria 716
218 Ga0105238_10129790 3300009551 Bacteria 2498
219 Ga0105238_11467725 3300009551 Unclassified 710
220 Ga0105238_12515443 3300009551 Unclassified 551
221 Ga0105249_10008788 3300009553 Bacteria 8817
222 Ga0105249_10468512 3300009553 Unclassified 1301
223 Ga0105239_11010887 3300010375 Bacteria 956
224 Ga0105246_10051087 3300011119 Bacteria 2837
225 Ga0105246_10939510 3300011119 Unclassified 778
226 Ga0105246_11280621 3300011119 Bacteria 678
227 Ga0157324_1034415 3300012506 Bacteria 591
228 Ga0157370_12142705 3300013104 Unclassified 501
229 Ga0157374_10443511 3300013296 Bacteria 1299
230 Ga0157374_10519350 3300013296 Bacteria 1197
231 Ga0157374_10641525 3300013296 Bacteria 1073
232 Ga0157378_10228480 3300013297 Bacteria 1772
233 Ga0157378_13094726 3300013297 Bacteria 516
234 Ga0163162_10092589 3300013306 Bacteria 3107
235 Ga0163162_11026202 3300013306 Bacteria 933
236 Ga0157375_10061068 3300013308 Bacteria 3741
237 Ga0157375_11653797 3300013308 Bacteria 758
238 Ga0157375_12250160 3300013308 Bacteria 650
239 Ga0157375_13078297 3300013308 Bacteria 556
240 Ga0163163_10055848 3300014325 Bacteria 3903
241 Ga0163163_10061434 3300014325 Bacteria 3723
242 Ga0163163_12375255 3300014325 Bacteria 589
243 Ga0157380_10044094 3300014326 Bacteria 3493
244 Ga0157380_10339154 3300014326 Bacteria 1401
245 Ga0157380_10342310 3300014326 Bacteria 1395
246 Ga0157380_11172330 3300014326 Bacteria 811
247 Ga0157380_11391044 3300014326 Bacteria 752
248 Ga0157380_12335874 3300014326 Bacteria 599
249 Ga0157380_12547624 3300014326 Unclassified 577
250 Ga0157380_13020281 3300014326 Unclassified 536
251 Ga0157380_13499475 3300014326 Unclassified 503
252 Ga0157377_10035827 3300014745 Bacteria 2725
253 Ga0157377_10353312 3300014745 Bacteria 987
254 Ga0157377_10586201 3300014745 Unclassified 793
255 Ga0157377_11605667 3300014745 Unclassified 521
256 Ga0157376_10059217 3300014969 Bacteria 3211
257 Ga0157376_10137518 3300014969 Bacteria 2188
258 Ga0157376_13008597 3300014969 Unclassified 510
259 Ga0163161_10148554 3300017792 Bacteria 1780
260 Ga0207697_10192942 3300025315 Bacteria 895
261 Ga0207653_10047384 3300025885 Bacteria 1423
262 Ga0207682_10055482 3300025893 Bacteria 1648
263 Ga0207682_10094685 3300025893 Bacteria 1299
264 Ga0207688_10373234 3300025901 Bacteria 882
265 Ga0207685_10167632 3300025905 Bacteria 1008
266 Ga0207699_10299815 3300025906 Bacteria 1122
267 Ga0207699_10319737 3300025906 Bacteria 1088
268 Ga0207643_10482407 3300025908 Bacteria 791
269 Ga0207705_10421323 3300025909 Bacteria 1034
270 Ga0207684_10374679 3300025910 Bacteria 1225
271 Ga0207684_11047517 3300025910 Bacteria 681
272 Ga0207707_10739016 3300025912 Bacteria 824
273 Ga0207662_10062235 3300025918 Unclassified 2242
274 Ga0207662_10113928 3300025918 Bacteria 1689
275 Ga0207662_10426289 3300025918 Bacteria 903
276 Ga0207649_10201168 3300025920 Bacteria 1407
277 Ga0207646_10190081 3300025922 Unclassified 1854
278 Ga0207681_10424128 3300025923 Bacteria 1078
279 Ga0207650_10024341 3300025925 Bacteria 4302
280 Ga0207650_10632432 3300025925 Bacteria 901
281 Ga0207659_10042765 3300025926 Bacteria 3178
282 Ga0207659_10145056 3300025926 Unclassified 1847
283 Ga0207659_10151666 3300025926 Bacteria 1810
284 Ga0207659_10852800 3300025926 Bacteria 783
285 Ga0207700_10147799 3300025928 Bacteria 1939
286 Ga0207644_10050667 3300025931 Bacteria 2977
287 Ga0207644_10124149 3300025931 Bacteria 1969
288 Ga0207644_11203499 3300025931 Bacteria 637
289 Ga0207690_11140140 3300025932 Bacteria 650
290 Ga0207706_10262877 3300025933 Bacteria 1506
291 Ga0207706_11013544 3300025933 Bacteria 697
292 Ga0207686_10608749 3300025934 Bacteria 860
293 Ga0207686_10629333 3300025934 Unclassified 847
294 Ga0207686_11027538 3300025934 Unclassified 670
295 Ga0207670_10007104 3300025936 Bacteria 6235
296 Ga0207670_10090955 3300025936 Bacteria 2157
297 Ga0207670_11923712 3300025936 Bacteria 503
298 Ga0207669_11122931 3300025937 Unclassified 664
299 Ga0207669_11518028 3300025937 Bacteria 571
300 Ga0207669_11881352 3300025937 Bacteria 511
301 Ga0207704_10401799 3300025938 Bacteria 1081
302 Ga0207704_10411406 3300025938 Bacteria 1070
303 Ga0207691_10126045 3300025940 Bacteria 2266
304 Ga0207691_10159765 3300025940 Bacteria 1978
305 Ga0207691_10546750 3300025940 Bacteria 982
306 Ga0207691_10569700 3300025940 Unclassified 960
307 Ga0207691_10691068 3300025940 Bacteria 861
308 Ga0207711_10101039 3300025941 Unclassified 2552
309 Ga0207661_10046312 3300025944 Bacteria 3449
310 Ga0207661_10621678 3300025944 Bacteria 992
311 Ga0207679_10276525 3300025945 Bacteria 1438
312 Ga0207679_10310318 3300025945 Bacteria 1362
313 Ga0207651_10014093 3300025960 Bacteria 4604
314 Ga0207651_10548598 3300025960 Bacteria 1005
315 Ga0207640_10956201 3300025981 Bacteria 751
316 Ga0207658_10398096 3300025986 Bacteria 1210
317 Ga0207677_10456780 3300026023 Bacteria 1095
318 Ga0207703_10278418 3300026035 Bacteria 1518
319 Ga0207703_11083198 3300026035 Unclassified 770
320 Ga0207703_11169995 3300026035 Bacteria 739
321 Ga0207703_11516526 3300026035 Unclassified 645
322 Ga0207639_10651216 3300026041 Unclassified 975
323 Ga0207641_10095383 3300026088 Bacteria 2611
324 Ga0207641_10164541 3300026088 Bacteria 2019
325 Ga0207648_11877199 3300026089 Bacteria 561
326 Ga0207676_11142830 3300026095 Unclassified 771
327 Ga0207676_11301890 3300026095 Bacteria 721
328 Ga0207674_10190804 3300026116 Bacteria 1999
329 Ga0207674_10482478 3300026116 Bacteria 1198
330 Ga0207683_11229037 3300026121 Bacteria 694
331 Ga0207698_10394291 3300026142 Bacteria 1321
332 Ga0207698_11486495 3300026142 Bacteria 693
333 Ga0209971_1057204 3300027682 Bacteria 943
334 Ga0209971_1171237 3300027682 Unclassified 535
335 Ga0207428_10000022 3300027907 Bacteria 273333
336 Ga0268266_10434676 3300028379 Bacteria 1246
337 Ga0268264_10015786 3300028381 Bacteria 6183
338 Ga0268264_10909479 3300028381 Unclassified 883
339 Ga0265331_10136601 3300031250 Bacteria 1116
340 Ga0307408_100006008 3300031548 Bacteria 8079
341 Ga0307408_100014610 3300031548 Bacteria 5217
342 Ga0307408_100270549 3300031548 Bacteria 1410
343 Ga0307408_100400475 3300031548 Bacteria 1178
344 Ga0307408_100448697 3300031548 Bacteria 1118
345 Ga0307405_10034436 3300031731 Bacteria 3014
346 Ga0307405_10089995 3300031731 Bacteria 2029
347 Ga0307405_10437676 3300031731 Bacteria 1033
348 Ga0307413_10079178 3300031824 Bacteria 2100
349 Ga0307413_10116882 3300031824 Bacteria 1798
350 Ga0307413_10137968 3300031824 Bacteria 1680
351 Ga0307413_12054583 3300031824 Bacteria 516
352 Ga0307410_10035977 3300031852 Bacteria 3220
353 Ga0307410_10758925 3300031852 Bacteria 822
354 Ga0307410_11059276 3300031852 Bacteria 701
355 Ga0307406_10111246 3300031901 Bacteria 1886
356 Ga0307406_10194434 3300031901 Bacteria 1488
357 Ga0307406_11129158 3300031901 Bacteria 678
358 Ga0307406_11239960 3300031901 Bacteria 649
359 Ga0307407_10051246 3300031903 Bacteria 2365
360 Ga0307407_10062391 3300031903 Bacteria 2182
361 Ga0307407_10157908 3300031903 Bacteria 1481
362 Ga0307412_10010331 3300031911 Bacteria 5376
363 Ga0307412_10033352 3300031911 Bacteria 3272
364 Ga0307412_10287271 3300031911 Bacteria 1294
365 Ga0307412_10375684 3300031911 Bacteria 1149
366 Ga0307409_100013510 3300031995 Bacteria 5259
367 Ga0307409_100147880 3300031995 Bacteria 2035
368 Ga0307409_100148454 3300031995 Bacteria 2031
369 Ga0307409_100525230 3300031995 Bacteria 1157
370 Ga0307409_101087853 3300031995 Bacteria 820
371 Ga0307409_101088068 3300031995 Bacteria 820
372 Ga0307409_102537319 3300031995 Bacteria 541
373 Ga0307416_100035476 3300032002 Bacteria 3809
374 Ga0307416_100054621 3300032002 Unclassified 3212
375 Ga0307416_100176757 3300032002 Bacteria 1995
376 Ga0307416_101050609 3300032002 Bacteria 918
377 Ga0307416_101630081 3300032002 Bacteria 750
378 Ga0307416_102802016 3300032002 Bacteria 583
379 Ga0307414_10024814 3300032004 Bacteria 3829
380 Ga0307414_10099381 3300032004 Bacteria 2186
381 Ga0307411_10012086 3300032005 Bacteria 4691
382 Ga0307411_10098329 3300032005 Bacteria 2062
383 Ga0307411_10098664 3300032005 Bacteria 2059
384 Ga0307411_10228685 3300032005 Bacteria 1448
385 Ga0307411_10825045 3300032005 Unclassified 818
386 Ga0307415_100007015 3300032126 Bacteria 6127
387 Ga0307415_100046197 3300032126 Bacteria 2924
388 Ga0307415_100189117 3300032126 Bacteria 1623
389 Ga0307415_101702366 3300032126 Unclassified 608
390 Ga0373955_0061165 3300035172 Bacteria 2079
391 Ga0373924_0018795 3300035410 Bacteria 2670
392 Ga0373947_0960782 3300035725 Bacteria 583
393 Ga0373937_0094932 3300036401 Bacteria 2765
394 Ga0373925_0218928 3300037068 Bacteria 1519
395 Ga0395901_0454190 3300038443 Bacteria 1310
396 Ga0439439_0018329 3300041406 Bacteria 1729
397 Ga0439439_0041981 3300041406 Unclassified 1188
398 Ga0439453_0049312 3300041408 Bacteria 847
399 Ga0439453_0112317 3300041408 Bacteria 617
400 Ga0451793_1054381 3300041452 Unclassified 944
401 Ga0451798_0411585 3300041458 Unclassified 622
402 Ga0451798_1053575 3300041458 Bacteria 723
403 Ga0451800_0149602 3300041459 Bacteria 540
404 Ga0451807_0547129 3300041486 Unclassified 776
405 Ga0451853_0296321 3300041512 Unclassified 1066
406 Ga0451853_3265579 3300041512 Unclassified 811
407 Ga0439442_073930 3300042002 Bacteria 727
408 Ga0450920_017425 3300042122 Bacteria 1374
409 Ga0450920_093868 3300042122 Unclassified 620
410 Ga0450922_044889 3300042124 Bacteria 506
411 Ga0450923_011821 3300042125 Unclassified 1578
412 Ga0450894_000917 3300042131 Bacteria 4656
413 Ga0450894_010748 3300042131 Bacteria 1190
414 Ga0450896_001373 3300042133 Bacteria 2976
415 Ga0450899_011950 3300042135 Unclassified 972
416 Ga0450906_029740 3300042145 Bacteria 966
417 Ga0450906_046210 3300042145 Archaea 768
418 Ga0439446_0042371 3300042156 Bacteria 1343
419 Ga0439446_0238162 3300042156 Bacteria 624
420 Ga0439434_0100780 3300042435 Bacteria 930
421 Ga0439435_0073151 3300042436 Bacteria 1018
422 Ga0450918_016061 3300042531 Unclassified 1300
423 Ga0453683_0267887 3300044673 Bacteria 1090
424 Ga0453683_0431974 3300044673 Bacteria 851
425 Ga0466960_0552837 3300044901 Bacteria 679
426 Ga0451576_0019002 3300045051 Bacteria 7508
427 Ga0451576_0087926 3300045051 Bacteria 3232
428 Ga0451576_0088183 3300045051 Bacteria 3227
429 Ga0451576_0141587 3300045051 Bacteria 2507
430 Ga0495603_0281180 3300046455 Bacteria 956
431 Ga0495629_0041493 3300046459 Bacteria 3238
432 Ga0495584_0059004 3300046491 Bacteria 1930
433 Ga0495644_0107255 3300046523 Bacteria 1059
434 Ga0495644_0108459 3300046523 Bacteria 1053
435 Ga0495642_0020658 3300046528 Bacteria 2588
436 Ga0495598_0000639 3300046537 Bacteria 6589
437 Ga0495598_0111365 3300046537 Bacteria 918
438 Ga0495598_0191079 3300046537 Bacteria 735
439 Ga0495609_0283437 3300046538 Bacteria 677
440 Ga0495621_0005445 3300046539 Bacteria 3661
441 Ga0495621_0125410 3300046539 Bacteria 995
442 Ga0495621_0126588 3300046539 Bacteria 991
443 Ga0495621_0163194 3300046539 Bacteria 882
444 Ga0495633_0036633 3300046558 Bacteria 2350
445 Ga0495633_0306996 3300046558 Bacteria 720
446 Ga0495656_0127809 3300046615 Bacteria 1207
447 Ga0495635_0825147 3300046663 Bacteria 597
448 Ga0495659_0001860 3300046664 Bacteria 6963
449 Ga0495659_0016110 3300046664 Bacteria 2463
450 Ga0495659_0016315 3300046664 Bacteria 2448
451 Ga0495657_0165823 3300046675 Bacteria 1364
452 Ga0495623_0190598 3300046679 Bacteria 1185
453 Ga0495658_0098976 3300046683 Bacteria 1738
454 Ga0495669_0038093 3300046684 Bacteria 2129
455 Ga0495669_0214867 3300046684 Bacteria 921
456 Ga0495669_0538977 3300046684 Bacteria 568
457 Ga0495670_0055238 3300046691 Bacteria 1991
458 Ga0495636_0414504 3300047318 Bacteria 643
459 Ga0495677_0205681 3300047445 Bacteria 766
460 Ga0495685_026844 3300047447 Bacteria 1981
461 Ga0496101_1270121 3300048904 Unclassified 576
462 Ga0496104_0141803 3300048907 Bacteria 2309
463 Ga0496106_0098054 3300048909 Bacteria 2270
464 Ga0496107_0090538 3300048910 Bacteria 2235
465 Ga0501298_025815 3300049521 Bacteria 1127
466 Ga0501298_116342 3300049521 Bacteria 625
467 Ga0501299_046523 3300049522 Bacteria 886
468 Ga0501031_0370927 3300049568 Bacteria 926
469 Ga0501036_0023673 3300049572 Bacteria 5175
470 Ga0501037_0489017 3300049573 Bacteria 836
471 Ga0501038_0619457 3300049574 Bacteria 817
472 Ga0501039_1039337 3300049575 Bacteria 636
473 Ga0501040_0389071 3300049576 Bacteria 1001
474 Ga0501040_1096052 3300049576 Bacteria 578
475 Ga0501041_0101273 3300049577 Bacteria 1783
476 Ga0501041_0437696 3300049577 Bacteria 830
477 Ga0501042_0104002 3300049578 Bacteria 2043
478 Ga0501046_0151769 3300049580 Bacteria 1748
479 Ga0501067_0046089 3300049583 Bacteria 2420
480 Ga0501069_0339751 3300049585 Bacteria 884
481 Ga0501071_0466206 3300049587 Bacteria 967
482 Ga0501072_0326733 3300049588 Bacteria 1219
483 Ga0501072_0705716 3300049588 Bacteria 793
484 Ga0501072_0739839 3300049588 Bacteria 772
485 Ga0501073_0509682 3300049589 Bacteria 832
486 Ga0501074_0572606 3300049590 Bacteria 799
487 Ga0501075_0464512 3300049591 Bacteria 965
488 Ga0501075_1345144 3300049591 Bacteria 541
489 Ga0501076_0133991 3300049592 Bacteria 2011
490 Ga0501076_0654083 3300049592 Bacteria 867
491 Ga0501076_0742223 3300049592 Bacteria 810
492 Ga0501076_0957456 3300049592 Bacteria 705
493 Ga0501076_1116076 3300049592 Bacteria 649
494 Ga0501077_0937040 3300049593 Unclassified 557
495 Ga0501199_053892 3300049650 Bacteria 549
496 Ga0501209_075868 3300049656 Bacteria 963
497 Ga0501079_0424450 3300049741 Bacteria 1044
498 Ga0501079_0867434 3300049741 Bacteria 711
499 Ga0501081_0343455 3300049743 Unclassified 1099
500 Ga0501272_032069 3300049769 Bacteria 671
501 Ga0501045_0028825 3300049824 Bacteria 4007
502 nmdc:mga05p37_10180_c1 3300050507 Bacteria 11162
503 nmdc:mga05p37_1449262_c1 3300050507 Unclassified 688
504 nmdc:mga05p37_221179_c1 3300050507 Bacteria 2285
505 nmdc:mga05p37_66097_c1 3300050507 Bacteria 4448
506 nmdc:mga05p37_76467_c1 3300050507 Bacteria 4122
507 nmdc:mga09592_224599_c1 3300050508 Bacteria 1627
508 nmdc:mga09592_482530_c1 3300050508 Bacteria 1068
509 nmdc:mga09592_508569_c1 3300050508 Bacteria 1037
510 nmdc:mga09592_6998_c1 3300050508 Bacteria 5202
511 nmdc:mga0qj67_173120_c1 3300050509 Bacteria 1753
512 nmdc:mga0qj67_663519_c1 3300050509 Bacteria 831
513 nmdc:mga0qj67_917223_c1 3300050509 Bacteria 690
514 nmdc:mga06r32_217293_c1 3300050510 Unclassified 1899
515 nmdc:mga06r32_65221_c1 3300050510 Bacteria 3512
516 nmdc:mga08y16_1131049_c1 3300050511 Bacteria 757
517 nmdc:mga08y16_206572_c1 3300050511 Bacteria 2034
518 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
519 nmdc:mga08y16_296108_c1 3300050511 Bacteria 1668
520 nmdc:mga08y16_644464_c1 3300050511 Bacteria 1064
521 nmdc:mga08y16_829928_c1 3300050511 Bacteria 915
522 nmdc:mga0n895_20182_c1 3300050512 Bacteria 6210
523 nmdc:mga0n895_235871_c1 3300050512 Bacteria 1857
524 nmdc:mga0n895_240372_c1 3300050512 Bacteria 1838
525 nmdc:mga0n895_274052_c1 3300050512 Bacteria 1711
526 nmdc:mga0n895_8463_c1 3300050512 Bacteria 8907
527 nmdc:mga0rr50_1128572_c1 3300050513 Bacteria 667
528 nmdc:mga0rr50_164533_c1 3300050513 Bacteria 1803
529 nmdc:mga0rr50_377620_c1 3300050513 Bacteria 1195
530 nmdc:mga0rr50_590439_c1 3300050513 Bacteria 947
531 nmdc:mga0rr50_66030_c1 3300050513 Bacteria 2743
532 nmdc:mga08x19_1050294_c1 3300050514 Bacteria 578
533 nmdc:mga08x19_1218761_c1 3300050514 Bacteria 533
534 nmdc:mga0a205_56886_c1 3300050515 Bacteria 3776
535 nmdc:mga0a205_83674_c1 3300050515 Bacteria 3082
536 Ga0501084_0588289 3300054114 Bacteria 940
537 Ga0501084_1285052 3300054114 Bacteria 613
538 Ga0590071_000138 3300059421 Bacteria 20646
539 Ga0590074_000107 3300059423 Bacteria 9458
540 Ga0590075_000140 3300059424 Bacteria 19060
541 Ga0590077_001845 3300059426 Bacteria 4708
542 Ga0501082_0040230 3300060353 Bacteria 4033
543 Ga0501082_1952391 3300060353 Unclassified 512
544 Ga0530510_0144796 3300061734 Bacteria 1752
545 Ga0530510_0527552 3300061734 Bacteria 896
546 Ga0530510_1470096 3300061734 Bacteria 523
547 Ga0075433_10022050
548 LJQas_1022215
549 JGI24751J29686_10125297
550 JGI25406J46586_10000816
551 Ga0065714_10009532
552 Ga0065712_10010200
553 Ga0065712_10069509
554 Ga0065712_10089173
555 Ga0065712_10172095
556 Ga0065715_10124339
557 Ga0065715_10268911
558 Ga0065715_10452196
559 Ga0065715_10548719
560 Ga0065715_10618179
561 Ga0070658_10064061
562 Ga0070658_10228765
563 Ga0070658_10742048
564 Ga0070676_10911910
565 Ga0070683_100018512
566 Ga0070683_100360285
567 Ga0070690_100022364
568 Ga0070690_100446475
569 Ga0070690_100591989
570 Ga0070670_100001833
571 Ga0070670_100007405
572 Ga0070670_101285394
573 Ga0070677_10023896
574 Ga0070677_10250080
575 Ga0070677_10268001
576 Ga0070677_10373564
577 Ga0068869_100021807
578 Ga0068869_100179303
579 Ga0068869_101848872
580 Ga0070666_10239075
581 Ga0070680_100162547
582 Ga0070680_100498489
583 Ga0070682_101516361
584 Ga0068868_100049653
585 Ga0068868_100238070
586 Ga0070660_100013121
587 Ga0070689_100072754
588 Ga0070687_100337243
589 Ga0070661_101615350
590 Ga0070692_10069967
591 Ga0070669_100519612
592 Ga0070669_101107336
593 Ga0070675_100028999
594 Ga0070675_100317189
595 Ga0070675_101150827
596 Ga0070675_101206224
597 Ga0070675_102035195
598 Ga0070671_100148295
599 Ga0070671_100562813
600 Ga0070674_100000622
601 Ga0070674_100114878
602 Ga0070674_101443531
603 Ga0070674_101730247
604 Ga0070674_102063682
605 Ga0070673_100025371
606 Ga0070673_100141101
607 Ga0070673_100951384
608 Ga0070688_100002444
609 Ga0070659_100149624
610 Ga0070667_100703870
611 Ga0070667_101199007
612 Ga0070709_10636951
613 Ga0070713_100428040
614 Ga0070701_10143973
615 Ga0070701_10219227
616 Ga0070711_100755478
617 Ga0070705_100003171
618 Ga0070705_100077369
619 Ga0070705_100233671
620 Ga0070705_100438249
621 Ga0070700_100139125
622 Ga0070694_100001815
623 Ga0070694_100104512
624 Ga0070694_100571017
625 Ga0070708_101987398
626 Ga0070663_100357198
627 Ga0070663_100590507
628 Ga0070663_101875369
629 Ga0070678_100368512
630 Ga0070678_100505916
631 Ga0070678_100929785
632 Ga0070678_101769353
633 Ga0070662_101198595
634 Ga0070681_10054824
635 Ga0070681_10426256
636 Ga0070681_11088970
637 Ga0070685_10005183
638 Ga0070685_11397646
639 Ga0070706_100239580
640 Ga0070706_100466665
641 Ga0070707_100165428
642 Ga0070707_100214089
643 Ga0070707_100572169
644 Ga0070698_100002047
645 Ga0070698_100003530
646 Ga0070698_100028774
647 Ga0070698_100462261
648 Ga0070698_100999543
649 Ga0070698_101222173
650 Ga0070699_100002695
651 Ga0070699_100005175
652 Ga0070699_100011830
653 Ga0070699_100029759
654 Ga0070699_100069732
655 Ga0070699_100510388
656 Ga0070699_101094345
657 Ga0070679_100073428
658 Ga0070684_100037676
659 Ga0070684_100763586
660 Ga0070697_100285033
661 Ga0070697_101031127
662 Ga0070672_100035513
663 Ga0070672_100415786
664 Ga0070672_101926971
665 Ga0070686_101236336
666 Ga0070686_101236622
667 Ga0070695_100108256
668 Ga0070695_100248080
669 Ga0070695_100283273
670 Ga0070696_100001831
671 Ga0070696_100006617
672 Ga0070696_101279919
673 Ga0070665_100823819
674 Ga0070704_100000764
675 Ga0070704_100042985
676 Ga0070704_100425029
677 Ga0070704_100959574
678 Ga0068855_100031521
679 Ga0070664_100025836
680 Ga0068857_100316006
681 Ga0068857_100319317
682 Ga0068854_100410681
683 Ga0068856_100394426
684 Ga0070702_100272700
685 Ga0068852_102060166
686 Ga0068859_100051075
687 Ga0068859_100886049
688 Ga0068859_101547954
689 Ga0068859_102032339
690 Ga0068864_100036454
691 Ga0068864_102040979
692 Ga0068866_11087066
693 Ga0068858_100278065
694 Ga0081538_10134092
695 Ga0081539_10000093
696 Ga0075364_10550634
697 Ga0070712_100048976
698 Ga0097621_100996251
699 Ga0068871_100494173
700 Ga0068871_101460104
701 Ga0075428_100000007
702 Ga0075428_100112905
703 Ga0075428_100122349
704 Ga0075428_100231055
705 Ga0075428_100287901
706 Ga0075428_100996594
707 Ga0075430_100139765
708 Ga0075430_100711341
709 Ga0075430_101016389
710 Ga0075431_100019425
711 Ga0075431_100034867
712 Ga0075431_101086582
713 Ga0075433_10121204
714 Ga0075433_10173185
715 Ga0075433_10191229
716 Ga0075433_11044854
717 Ga0075434_100000452
718 Ga0075434_100031729
719 Ga0075434_100305307
720 Ga0075434_100370843
721 Ga0075429_100020383
722 Ga0075429_100024367
723 Ga0075429_100296348
724 Ga0068865_100817300
725 Ga0068865_101210400
726 Ga0097620_100051072
727 Ga0097620_100886052
728 Ga0097620_101547810
729 Ga0097620_102032288
730 Ga0075435_100024637
731 Ga0075435_100042630
732 Ga0075435_100792921
733 Ga0111539_10000209
734 Ga0111539_10133039
735 Ga0111539_10220778
736 Ga0111539_10572816
737 Ga0111539_11209123
738 Ga0111539_12487920
739 Ga0105245_10311005
740 Ga0105245_10828410
741 Ga0114129_10000309
742 Ga0114129_10005556
743 Ga0114129_10013363
744 Ga0114129_10146578
745 Ga0114129_10278129
746 Ga0114129_11534824
747 Ga0114129_11965804
748 Ga0114129_13138258
749 Ga0105243_10176821
750 Ga0105243_10431394
751 Ga0105243_11905539
752 Ga0105242_10314216
753 Ga0105242_10531224
754 Ga0105242_10604252
755 Ga0105242_10913541
756 Ga0105242_11834106
757 Ga0105242_12784708
758 Ga0105248_10003756
759 Ga0105248_10082834
760 Ga0105248_10547948
761 Ga0105248_12814146
762 Ga0105248_13319248
763 Ga0105237_11362994
764 Ga0105238_10129790
765 Ga0105238_11467725
766 Ga0105238_12515443
767 Ga0105249_10008788
768 Ga0105249_10468512
769 Ga0105239_11010887
770 Ga0105246_10051087
771 Ga0105246_10939510
772 Ga0105246_11280621
773 Ga0157324_1034415
774 Ga0157370_12142705
775 Ga0157374_10443511
776 Ga0157374_10519350
777 Ga0157374_10641525
778 Ga0157378_10228480
779 Ga0157378_13094726
780 Ga0163162_10092589
781 Ga0163162_11026202
782 Ga0157375_10061068
783 Ga0157375_11653797
784 Ga0157375_12250160
785 Ga0157375_13078297
786 Ga0163163_10055848
787 Ga0163163_10061434
788 Ga0163163_12375255
789 Ga0157380_10044094
790 Ga0157380_10339154
791 Ga0157380_10342310
792 Ga0157380_11172330
793 Ga0157380_11391044
794 Ga0157380_12335874
795 Ga0157380_12547624
796 Ga0157380_13020281
797 Ga0157380_13499475
798 Ga0157377_10035827
799 Ga0157377_10353312
800 Ga0157377_10586201
801 Ga0157377_11605667
802 Ga0157376_10059217
803 Ga0157376_10137518
804 Ga0157376_13008597
805 Ga0163161_10148554
806 Ga0207697_10192942
807 Ga0207653_10047384
808 Ga0207682_10055482
809 Ga0207682_10094685
810 Ga0207688_10373234
811 Ga0207685_10167632
812 Ga0207699_10299815
813 Ga0207699_10319737
814 Ga0207643_10482407
815 Ga0207705_10421323
816 Ga0207684_10374679
817 Ga0207684_11047517
818 Ga0207707_10739016
819 Ga0207662_10062235
820 Ga0207662_10113928
821 Ga0207662_10426289
822 Ga0207649_10201168
823 Ga0207646_10190081
824 Ga0207681_10424128
825 Ga0207650_10024341
826 Ga0207650_10632432
827 Ga0207659_10042765
828 Ga0207659_10145056
829 Ga0207659_10151666
830 Ga0207659_10852800
831 Ga0207700_10147799
832 Ga0207644_10050667
833 Ga0207644_10124149
834 Ga0207644_11203499
835 Ga0207690_11140140
836 Ga0207706_10262877
837 Ga0207706_11013544
838 Ga0207686_10608749
839 Ga0207686_10629333
840 Ga0207686_11027538
841 Ga0207670_10007104
842 Ga0207670_10090955
843 Ga0207670_11923712
844 Ga0207669_11122931
845 Ga0207669_11518028
846 Ga0207669_11881352
847 Ga0207704_10401799
848 Ga0207704_10411406
849 Ga0207691_10126045
850 Ga0207691_10159765
851 Ga0207691_10546750
852 Ga0207691_10569700
853 Ga0207691_10691068
854 Ga0207711_10101039
855 Ga0207661_10046312
856 Ga0207661_10621678
857 Ga0207679_10276525
858 Ga0207679_10310318
859 Ga0207651_10014093
860 Ga0207651_10548598
861 Ga0207640_10956201
862 Ga0207658_10398096
863 Ga0207677_10456780
864 Ga0207703_10278418
865 Ga0207703_11083198
866 Ga0207703_11169995
867 Ga0207703_11516526
868 Ga0207639_10651216
869 Ga0207641_10095383
870 Ga0207641_10164541
871 Ga0207648_11877199
872 Ga0207676_11142830
873 Ga0207676_11301890
874 Ga0207674_10190804
875 Ga0207674_10482478
876 Ga0207683_11229037
877 Ga0207698_10394291
878 Ga0207698_11486495
879 Ga0209971_1057204
880 Ga0209971_1171237
881 Ga0207428_10000022
882 Ga0268266_10434676
883 Ga0268264_10015786
884 Ga0268264_10909479
885 Ga0265331_10136601
886 Ga0307408_100006008
887 Ga0307408_100014610
888 Ga0307408_100270549
889 Ga0307408_100400475
890 Ga0307408_100448697
891 Ga0307405_10034436
892 Ga0307405_10089995
893 Ga0307405_10437676
894 Ga0307413_10079178
895 Ga0307413_10116882
896 Ga0307413_10137968
897 Ga0307413_12054583
898 Ga0307410_10035977
899 Ga0307410_10758925
900 Ga0307410_11059276
901 Ga0307406_10111246
902 Ga0307406_10194434
903 Ga0307406_11129158
904 Ga0307406_11239960
905 Ga0307407_10051246
906 Ga0307407_10062391
907 Ga0307407_10157908
908 Ga0307412_10010331
909 Ga0307412_10033352
910 Ga0307412_10287271
911 Ga0307412_10375684
912 Ga0307409_100013510
913 Ga0307409_100147880
914 Ga0307409_100148454
915 Ga0307409_100525230
916 Ga0307409_101087853
917 Ga0307409_101088068
918 Ga0307409_102537319
919 Ga0307416_100035476
920 Ga0307416_100054621
921 Ga0307416_100176757
922 Ga0307416_101050609
923 Ga0307416_101630081
924 Ga0307416_102802016
925 Ga0307414_10024814
926 Ga0307414_10099381
927 Ga0307411_10012086
928 Ga0307411_10098329
929 Ga0307411_10098664
930 Ga0307411_10228685
931 Ga0307411_10825045
932 Ga0307415_100007015
933 Ga0307415_100046197
934 Ga0307415_100189117
935 Ga0307415_101702366
936 Ga0373955_0061165
937 Ga0373924_0018795
938 Ga0373947_0960782
939 Ga0373937_0094932
940 Ga0373925_0218928
941 Ga0395901_0454190
942 Ga0439439_0018329
943 Ga0439439_0041981
944 Ga0439453_0049312
945 Ga0439453_0112317
946 Ga0451793_1054381
947 Ga0451798_0411585
948 Ga0451798_1053575
949 Ga0451800_0149602
950 Ga0451807_0547129
951 Ga0451853_0296321
952 Ga0451853_3265579
953 Ga0439442_073930
954 Ga0450920_017425
955 Ga0450920_093868
956 Ga0450922_044889
957 Ga0450923_011821
958 Ga0450894_000917
959 Ga0450894_010748
960 Ga0450896_001373
961 Ga0450899_011950
962 Ga0450906_029740
963 Ga0450906_046210
964 Ga0439446_0042371
965 Ga0439446_0238162
966 Ga0439434_0100780
967 Ga0439435_0073151
968 Ga0450918_016061
969 Ga0453683_0267887
970 Ga0453683_0431974
971 Ga0466960_0552837
972 Ga0451576_0019002
973 Ga0451576_0087926
974 Ga0451576_0088183
975 Ga0451576_0141587
976 Ga0495603_0281180
977 Ga0495629_0041493
978 Ga0495584_0059004
979 Ga0495644_0107255
980 Ga0495644_0108459
981 Ga0495642_0020658
982 Ga0495598_0000639
983 Ga0495598_0111365
984 Ga0495598_0191079
985 Ga0495609_0283437
986 Ga0495621_0005445
987 Ga0495621_0125410
988 Ga0495621_0126588
989 Ga0495621_0163194
990 Ga0495633_0036633
991 Ga0495633_0306996
992 Ga0495656_0127809
993 Ga0495635_0825147
994 Ga0495659_0001860
995 Ga0495659_0016110
996 Ga0495659_0016315
997 Ga0495657_0165823
998 Ga0495623_0190598
999 Ga0495658_0098976
1000 Ga0495669_0038093
1001 Ga0495669_0214867
1002 Ga0495669_0538977
1003 Ga0495670_0055238
1004 Ga0495636_0414504
1005 Ga0495677_0205681
1006 Ga0495685_026844
1007 Ga0496101_1270121
1008 Ga0496104_0141803
1009 Ga0496106_0098054
1010 Ga0496107_0090538
1011 Ga0501298_025815
1012 Ga0501298_116342
1013 Ga0501299_046523
1014 Ga0501031_0370927
1015 Ga0501036_0023673
1016 Ga0501037_0489017
1017 Ga0501038_0619457
1018 Ga0501039_1039337
1019 Ga0501040_0389071
1020 Ga0501040_1096052
1021 Ga0501041_0101273
1022 Ga0501041_0437696
1023 Ga0501042_0104002
1024 Ga0501046_0151769
1025 Ga0501067_0046089
1026 Ga0501069_0339751
1027 Ga0501071_0466206
1028 Ga0501072_0326733
1029 Ga0501072_0705716
1030 Ga0501072_0739839
1031 Ga0501073_0509682
1032 Ga0501074_0572606
1033 Ga0501075_0464512
1034 Ga0501075_1345144
1035 Ga0501076_0133991
1036 Ga0501076_0654083
1037 Ga0501076_0742223
1038 Ga0501076_0957456
1039 Ga0501076_1116076
1040 Ga0501077_0937040
1041 Ga0501199_053892
1042 Ga0501209_075868
1043 Ga0501079_0424450
1044 Ga0501079_0867434
1045 Ga0501081_0343455
1046 Ga0501272_032069
1047 Ga0501045_0028825
1048 nmdc:mga05p37_10180_c1
1049 nmdc:mga05p37_1449262_c1
1050 nmdc:mga05p37_221179_c1
1051 nmdc:mga05p37_66097_c1
1052 nmdc:mga05p37_76467_c1
1053 nmdc:mga09592_224599_c1
1054 nmdc:mga09592_482530_c1
1055 nmdc:mga09592_508569_c1
1056 nmdc:mga09592_6998_c1
1057 nmdc:mga0qj67_173120_c1
1058 nmdc:mga0qj67_663519_c1
1059 nmdc:mga0qj67_917223_c1
1060 nmdc:mga06r32_217293_c1
1061 nmdc:mga06r32_65221_c1
1062 nmdc:mga08y16_1131049_c1
1063 nmdc:mga08y16_206572_c1
1064 nmdc:mga08y16_21_c1
1065 nmdc:mga08y16_296108_c1
1066 nmdc:mga08y16_644464_c1
1067 nmdc:mga08y16_829928_c1
1068 nmdc:mga0n895_20182_c1
1069 nmdc:mga0n895_235871_c1
1070 nmdc:mga0n895_240372_c1
1071 nmdc:mga0n895_274052_c1
1072 nmdc:mga0n895_8463_c1
1073 nmdc:mga0rr50_1128572_c1
1074 nmdc:mga0rr50_164533_c1
1075 nmdc:mga0rr50_377620_c1
1076 nmdc:mga0rr50_590439_c1
1077 nmdc:mga0rr50_66030_c1
1078 nmdc:mga08x19_1050294_c1
1079 nmdc:mga08x19_1218761_c1
1080 nmdc:mga0a205_56886_c1
1081 nmdc:mga0a205_83674_c1
1082 Ga0501084_0588289
1083 Ga0501084_1285052
1084 Ga0590071_000138
1085 Ga0590074_000107
1086 Ga0590075_000140
1087 Ga0590077_001845
1088 Ga0501082_0040230
1089 Ga0501082_1952391
1090 Ga0530510_0144796
1091 Ga0530510_0527552
1092 Ga0530510_1470096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

66

144

0.98

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

5

128

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8b-assembly1.cif.gz_B-2 crystal structure of the covalent thioimide intermediate of unimodular nitrile reductase quef 0.9582 17 129
4fgc-assembly1.cif.gz_A-2 crystal structure of active site mutant c55a of nitrile reductase quef, bound to substrate preq0 0.9504 17 128
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9299 33 128
3bp1-assembly1.cif.gz_D crystal structure of putative 7-cyano-7-deazaguanine reductase quef from vibrio cholerae o1 biovar eltor 0.9278 31 126
4ghm-assembly1.cif.gz_B crystal structure of the h233a mutant of 7-cyano-7-deazaguanine reductase, quef from vibrio cholerae complexed with preq0 0.9272 31 126
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9675 18 129 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9134 31 128 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9076 22 130 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8908 31 130 3.30.1130.10
af_B4FH02_104_236_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8873 33 128 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A432TJK3-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF 0.999 19 107 GO:0005737
GO:0008616
GO:0033739
AF-A0A4Q5ZII6-F1-model_v4 deleted 0.9953 19 111
AF-T0YYQ9-F1-model_v4 Nitrile oxidoreductase, NADPH-dependent, QueF (EC 1.7.1.13) 0.9903 21 104 GO:0005737
GO:0008616
GO:0033739
AF-A0A0F8Z518-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase N-terminal domain-containing protein 0.9871 19 128 GO:0005737
GO:0008616
GO:0033739
AF-A0A7V2N4G7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9871 19 129 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Map