F461947

General Info

Members Datasets Scaffolds Average Seq Length
546 306 1092 141

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10486184|Ga0070677_104861841
Length 180
Sequence MRYAHEGGGGSLEFALTSARNFESDSMSLREKLTDAMKEAMKAKDAKRLATVRLMLAALKDKDIAARSETSRELLGDDEILSLLAKMIKQREESAAVYVQGGRPELAENERAEIVIIREFMPKQMDEADAKAAIAAVVAELGATSVKDMGKVMAALKERFAGQMDFGKASGQVKEALTPK

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
266 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
281 2519103095 Burkholderia sp. KJ006 Isolate Nodule
282 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
283 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
284 2643221658 Variovorax sp. Root411 Isolate Unclassified
285 2643221672 Variovorax sp. Root434 Isolate Unclassified
286 2643221683 Variovorax sp. Root473 Isolate Unclassified
287 2738543013 Variovorax sp. BT01 Isolate Unclassified
288 2738543024 Aminobacter sp. AP02 Isolate Unclassified
289 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
290 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
291 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
292 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
293 2885198086 Variovorax sp. 679 Isolate Unclassified
294 2885211737 Variovorax sp. 553 Isolate Unclassified
295 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
296 2904456579 Variovorax sp. 2002 Isolate Unclassified
297 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
298 2928163908 Burkholderia sp. 567 Isolate Unclassified
299 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
300 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
301 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
302 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
303 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
304 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
305 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
306 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.78
Nodule 0.37
Rhizoplane 4.58
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10486184 3300005333 Bacteria 667
2 rootH1_10048523 3300003316 Bacteria 1501
3 rootL2_10188275 3300003322 Bacteria 1123
4 Ga0055527_1003619 3300003760 Bacteria 2252
5 Ga0070658_10892121 3300005327 Bacteria 773
6 Ga0070658_11057019 3300005327 Bacteria 706
7 Ga0070676_10216800 3300005328 Bacteria 1262
8 Ga0070676_10274336 3300005328 Bacteria 1134
9 Ga0070670_100801747 3300005331 Bacteria 850
10 Ga0068869_100069012 3300005334 Bacteria 2612
11 Ga0070666_10421944 3300005335 Bacteria 961
12 Ga0070680_100046457 3300005336 Bacteria 3532
13 Ga0070680_100781504 3300005336 Bacteria 822
14 Ga0068868_100031135 3300005338 Bacteria 4095
15 Ga0068868_100279444 3300005338 Bacteria 1413
16 Ga0070660_100402860 3300005339 Bacteria 1131
17 Ga0070660_101311184 3300005339 Bacteria 614
18 Ga0070689_100197708 3300005340 Bacteria 1640
19 Ga0070691_10096953 3300005341 Bacteria 1461
20 Ga0070687_100770307 3300005343 Bacteria 679
21 Ga0070661_100001304 3300005344 Bacteria 17505
22 Ga0070661_100118935 3300005344 Bacteria 1977
23 Ga0070661_100209232 3300005344 Bacteria 1492
24 Ga0070661_100502594 3300005344 Bacteria 970
25 Ga0070692_10069070 3300005345 Bacteria 1879
26 Ga0070692_10341340 3300005345 Bacteria 928
27 Ga0070668_100314553 3300005347 Bacteria 1317
28 Ga0070669_101971464 3300005353 Bacteria 510
29 Ga0070673_100678484 3300005364 Bacteria 945
30 Ga0070688_100864708 3300005365 Bacteria 711
31 Ga0070659_100025875 3300005366 Bacteria 4513
32 Ga0070659_100072402 3300005366 Bacteria 2742
33 Ga0070667_100672693 3300005367 Bacteria 957
34 Ga0070667_101198831 3300005367 Bacteria 711
35 Ga0070703_10007642 3300005406 Bacteria 3037
36 Ga0070709_10011733 3300005434 Bacteria 4892
37 Ga0070709_10420454 3300005434 Bacteria 1001
38 Ga0070709_10492918 3300005434 Bacteria 929
39 Ga0070709_11600813 3300005434 Bacteria 530
40 Ga0070714_100005999 3300005435 Bacteria 9328
41 Ga0070714_100056781 3300005435 Bacteria 3349
42 Ga0070714_100943660 3300005435 Bacteria 838
43 Ga0070714_101113264 3300005435 Bacteria 770
44 Ga0070713_100079544 3300005436 Bacteria 2793
45 Ga0070713_100141914 3300005436 Bacteria 2129
46 Ga0070710_10257129 3300005437 Bacteria 1125
47 Ga0070711_100058404 3300005439 Bacteria 2675
48 Ga0070705_100001958 3300005440 Bacteria 10525
49 Ga0070700_100006805 3300005441 Bacteria 6131
50 Ga0070700_100253494 3300005441 Bacteria 1263
51 Ga0070694_100000699 3300005444 Bacteria 18668
52 Ga0070694_100105873 3300005444 Bacteria 1997
53 Ga0070708_100063764 3300005445 Bacteria 3299
54 Ga0070663_100021591 3300005455 Bacteria 4286
55 Ga0070663_100089925 3300005455 Bacteria 2273
56 Ga0070663_100225763 3300005455 Bacteria 1472
57 Ga0070663_100296069 3300005455 Bacteria 1294
58 Ga0070678_100131815 3300005456 Bacteria 1987
59 Ga0070662_100629324 3300005457 Bacteria 904
60 Ga0070662_101163156 3300005457 Bacteria 663
61 Ga0070681_10068159 3300005458 Bacteria 3525
62 Ga0070681_10076157 3300005458 Bacteria 3314
63 Ga0070681_10096284 3300005458 Bacteria 2908
64 Ga0070681_10295210 3300005458 Bacteria 1531
65 Ga0070685_10490856 3300005466 Bacteria 867
66 Ga0070685_11138552 3300005466 Bacteria 591
67 Ga0070706_100053841 3300005467 Bacteria 3714
68 Ga0070707_100028609 3300005468 Bacteria 5305
69 Ga0070698_100293242 3300005471 Bacteria 1558
70 Ga0070698_100384029 3300005471 Bacteria 1337
71 Ga0070698_100440734 3300005471 Bacteria 1238
72 Ga0070699_100003406 3300005518 Bacteria 14071
73 Ga0070699_100010685 3300005518 Bacteria 7945
74 Ga0070699_100667061 3300005518 Bacteria 949
75 Ga0070679_100241980 3300005530 Bacteria 1762
76 Ga0070679_101320762 3300005530 Bacteria 667
77 Ga0070684_100008343 3300005535 Bacteria 8091
78 Ga0070684_100950845 3300005535 Bacteria 806
79 Ga0070697_100018108 3300005536 Bacteria 5551
80 Ga0070697_100045658 3300005536 Bacteria 3551
81 Ga0068853_100197861 3300005539 Bacteria 1828
82 Ga0068853_100976209 3300005539 Bacteria 815
83 Ga0070695_100025497 3300005545 Bacteria 3651
84 Ga0070695_100052565 3300005545 Bacteria 2618
85 Ga0070696_100000087 3300005546 Bacteria 45866
86 Ga0070696_100057519 3300005546 Bacteria 2714
87 Ga0070693_100114965 3300005547 Bacteria 1661
88 Ga0070665_100519237 3300005548 Bacteria 1203
89 Ga0070704_100074282 3300005549 Bacteria 2479
90 Ga0068855_100010656 3300005563 Bacteria 11088
91 Ga0068855_100386618 3300005563 Bacteria 1535
92 Ga0068855_100576652 3300005563 Bacteria 1215
93 Ga0068855_101158726 3300005563 Bacteria 805
94 Ga0070664_100017187 3300005564 Bacteria 5938
95 Ga0070664_100076268 3300005564 Bacteria 2880
96 Ga0070664_100160395 3300005564 Bacteria 1989
97 Ga0068857_100002462 3300005577 Bacteria 15130
98 Ga0068857_100006512 3300005577 Bacteria 10021
99 Ga0068857_100066161 3300005577 Bacteria 3215
100 Ga0068857_100465867 3300005577 Bacteria 1183
101 Ga0068854_100016776 3300005578 Bacteria 4888
102 Ga0068854_100231540 3300005578 Bacteria 1467
103 Ga0068854_100593592 3300005578 Bacteria 945
104 Ga0068854_101129930 3300005578 Bacteria 699
105 Ga0068856_100014644 3300005614 Bacteria 7575
106 Ga0068856_100058639 3300005614 Bacteria 3802
107 Ga0068856_100157560 3300005614 Bacteria 2281
108 Ga0068856_100226518 3300005614 Bacteria 1885
109 Ga0068852_100006004 3300005616 Bacteria 8748
110 Ga0068852_100328135 3300005616 Bacteria 1488
111 Ga0068852_101204047 3300005616 Bacteria 778
112 Ga0068859_100005753 3300005617 Bacteria 12611
113 Ga0068859_100226921 3300005617 Bacteria 1956
114 Ga0068859_100228224 3300005617 Bacteria 1950
115 Ga0068861_100702234 3300005719 Bacteria 940
116 Ga0068851_10046444 3300005834 Bacteria 2196
117 Ga0068851_10103640 3300005834 Bacteria 1512
118 Ga0068851_10247821 3300005834 Bacteria 1009
119 Ga0068863_100214663 3300005841 Bacteria 1853
120 Ga0068863_100254823 3300005841 Bacteria 1696
121 Ga0068858_100739739 3300005842 Bacteria 958
122 Ga0068860_100003602 3300005843 Bacteria 15912
123 Ga0068860_100176197 3300005843 Bacteria 2067
124 Ga0068860_100561030 3300005843 Bacteria 1145
125 Ga0068860_101228913 3300005843 Bacteria 770
126 Ga0068862_100002025 3300005844 Bacteria 18350
127 Ga0068862_100225675 3300005844 Bacteria 1697
128 Ga0081455_10185896 3300005937 Bacteria 1569
129 Ga0075365_10208589 3300006038 Bacteria 1370
130 Ga0075365_10244855 3300006038 Bacteria 1259
131 Ga0075368_10047730 3300006042 Bacteria 1695
132 Ga0075368_10069238 3300006042 Bacteria 1423
133 Ga0075368_10438247 3300006042 Bacteria 577
134 Ga0075363_100006779 3300006048 Bacteria 5230
135 Ga0075363_100220895 3300006048 Bacteria 1086
136 Ga0075364_10001764 3300006051 Bacteria 11953
137 Ga0070716_100080482 3300006173 Bacteria 1942
138 Ga0070712_100110336 3300006175 Bacteria 2052
139 Ga0075367_10019742 3300006178 Bacteria 3741
140 Ga0075367_10121558 3300006178 Bacteria 1609
141 Ga0075366_10569946 3300006195 Bacteria 701
142 Ga0068871_100030252 3300006358 Bacteria 4262
143 Ga0068871_100041456 3300006358 Bacteria 3692
144 Ga0068871_100203891 3300006358 Bacteria 1708
145 Ga0068871_100787104 3300006358 Bacteria 876
146 Ga0068871_101213420 3300006358 Bacteria 708
147 Ga0075428_100118173 3300006844 Bacteria 2887
148 Ga0075428_100125061 3300006844 Bacteria 2799
149 Ga0075430_100006832 3300006846 Bacteria 9617
150 Ga0075430_100174578 3300006846 Bacteria 1788
151 Ga0075431_100011319 3300006847 Bacteria 8987
152 Ga0075431_100031574 3300006847 Bacteria 5455
153 Ga0075431_100044166 3300006847 Bacteria 4597
154 Ga0075431_100110011 3300006847 Bacteria 2844
155 Ga0075431_100193254 3300006847 Bacteria 2085
156 Ga0075434_100004320 3300006871 Bacteria 12779
157 Ga0075434_100363724 3300006871 Bacteria 1468
158 Ga0075429_100144782 3300006880 Bacteria 2080
159 Ga0075429_100184143 3300006880 Bacteria 1830
160 Ga0068865_100236377 3300006881 Bacteria 1436
161 Ga0075436_100101305 3300006914 Bacteria 2006
162 Ga0075436_100110279 3300006914 Bacteria 1920
163 Ga0075436_100117556 3300006914 Bacteria 1859
164 Ga0097620_100005754 3300006931 Bacteria 12611
165 Ga0097620_100226922 3300006931 Bacteria 1956
166 Ga0097620_100228222 3300006931 Bacteria 1950
167 Ga0075435_100003824 3300007076 Bacteria 10271
168 Ga0075435_100174196 3300007076 Bacteria 1816
169 Ga0105240_10001807 3300009093 Bacteria 36004
170 Ga0105240_10040180 3300009093 Bacteria 5987
171 Ga0105240_10076488 3300009093 Bacteria 4126
172 Ga0105240_11516851 3300009093 Bacteria 702
173 Ga0111539_10024810 3300009094 Bacteria 7352
174 Ga0111539_11933466 3300009094 Bacteria 684
175 Ga0105245_10010247 3300009098 Bacteria 8162
176 Ga0105245_10029614 3300009098 Bacteria 4838
177 Ga0105245_10335351 3300009098 Bacteria 1494
178 Ga0105245_11288149 3300009098 Bacteria 780
179 Ga0114129_10054450 3300009147 Bacteria 5609
180 Ga0114129_10142497 3300009147 Bacteria 3284
181 Ga0105241_10097032 3300009174 Bacteria 2336
182 Ga0105241_10127983 3300009174 Bacteria 2052
183 Ga0105248_11165115 3300009177 Bacteria 871
184 Ga0105237_10007603 3300009545 Bacteria 11843
185 Ga0105237_10277946 3300009545 Bacteria 1677
186 Ga0105238_10032504 3300009551 Bacteria 5309
187 Ga0105249_10000473 3300009553 Bacteria 37304
188 Ga0105249_10017583 3300009553 Bacteria 6348
189 Ga0105239_10149927 3300010375 Bacteria 2602
190 Ga0105239_10251205 3300010375 Bacteria 1986
191 Ga0105239_11309101 3300010375 Bacteria 836
192 Ga0105246_10003863 3300011119 Bacteria 9080
193 Ga0105246_10100668 3300011119 Bacteria 2103
194 Ga0157347_1004982 3300012502 Bacteria 1254
195 Ga0157373_10011247 3300013100 Bacteria 6585
196 Ga0157373_10435398 3300013100 Bacteria 942
197 Ga0157373_10456442 3300013100 Bacteria 920
198 Ga0157371_10189827 3300013102 Bacteria 1471
199 Ga0157371_10858044 3300013102 Bacteria 687
200 Ga0157370_10035276 3300013104 Bacteria 4864
201 Ga0157370_10134269 3300013104 Bacteria 2307
202 Ga0157370_10170094 3300013104 Bacteria 2026
203 Ga0157370_10317359 3300013104 Bacteria 1438
204 Ga0157370_10645683 3300013104 Bacteria 967
205 Ga0157370_11149070 3300013104 Bacteria 701
206 Ga0157369_10039300 3300013105 Bacteria 5171
207 Ga0157369_10333948 3300013105 Bacteria 1574
208 Ga0157369_10370551 3300013105 Bacteria 1486
209 Ga0157374_10839889 3300013296 Bacteria 935
210 Ga0157378_11974542 3300013297 Bacteria 633
211 Ga0163162_10395728 3300013306 Bacteria 1514
212 Ga0157372_10030538 3300013307 Bacteria 5895
213 Ga0157372_10149955 3300013307 Bacteria 2691
214 Ga0157372_10395158 3300013307 Bacteria 1611
215 Ga0157372_10900320 3300013307 Bacteria 1027
216 Ga0157372_11377513 3300013307 Bacteria 813
217 Ga0157375_10877467 3300013308 Bacteria 1042
218 Ga0163163_10092914 3300014325 Bacteria 3033
219 Ga0163163_10913600 3300014325 Bacteria 941
220 Ga0157380_11507870 3300014326 Bacteria 726
221 Ga0157377_10651533 3300014745 Bacteria 758
222 Ga0157377_10716801 3300014745 Bacteria 728
223 Ga0157379_10548070 3300014968 Bacteria 1076
224 Ga0213872_10003475 3300021361 Bacteria 8735
225 Ga0213872_10031328 3300021361 Bacteria 2438
226 Ga0213871_10002584 3300021441 Bacteria 3349
227 Ga0207656_10031039 3300025321 Bacteria 2211
228 Ga0207653_10008855 3300025885 Bacteria 3139
229 Ga0207692_10015870 3300025898 Bacteria 3323
230 Ga0207692_10389913 3300025898 Bacteria 866
231 Ga0207699_10009128 3300025906 Bacteria 4925
232 Ga0207699_10036085 3300025906 Bacteria 2816
233 Ga0207699_10075906 3300025906 Bacteria 2069
234 Ga0207699_10398843 3300025906 Bacteria 979
235 Ga0207645_10048404 3300025907 Bacteria 2715
236 Ga0207645_10365158 3300025907 Bacteria 967
237 Ga0207643_10000698 3300025908 Bacteria 20918
238 Ga0207643_10111004 3300025908 Bacteria 1616
239 Ga0207705_11017816 3300025909 Bacteria 640
240 Ga0207684_10049525 3300025910 Bacteria 3563
241 Ga0207684_10173106 3300025910 Bacteria 1861
242 Ga0207654_10040357 3300025911 Bacteria 2629
243 Ga0207707_10016503 3300025912 Bacteria 6439
244 Ga0207707_10020479 3300025912 Bacteria 5776
245 Ga0207707_10425406 3300025912 Bacteria 1138
246 Ga0207707_10441948 3300025912 Bacteria 1113
247 Ga0207695_10015405 3300025913 Bacteria 9002
248 Ga0207695_10040390 3300025913 Bacteria 5003
249 Ga0207695_10161352 3300025913 Bacteria 2173
250 Ga0207671_10189182 3300025914 Bacteria 1605
251 Ga0207693_10048685 3300025915 Bacteria 3328
252 Ga0207660_10042812 3300025917 Bacteria 3180
253 Ga0207660_10672754 3300025917 Bacteria 844
254 Ga0207657_10010020 3300025919 Bacteria 9481
255 Ga0207657_10095143 3300025919 Bacteria 2479
256 Ga0207649_10047506 3300025920 Bacteria 2642
257 Ga0207652_10007529 3300025921 Bacteria 8767
258 Ga0207652_10407163 3300025921 Bacteria 1227
259 Ga0207652_11140903 3300025921 Bacteria 680
260 Ga0207694_10074276 3300025924 Bacteria 2661
261 Ga0207687_10003108 3300025927 Bacteria 11254
262 Ga0207687_10029503 3300025927 Bacteria 3691
263 Ga0207687_10611407 3300025927 Bacteria 919
264 Ga0207687_10923584 3300025927 Bacteria 747
265 Ga0207700_10389665 3300025928 Bacteria 1219
266 Ga0207664_10017130 3300025929 Bacteria 5303
267 Ga0207664_10063859 3300025929 Bacteria 2944
268 Ga0207664_10251627 3300025929 Bacteria 1542
269 Ga0207664_10659306 3300025929 Bacteria 941
270 Ga0207690_10045017 3300025932 Bacteria 2913
271 Ga0207690_10146447 3300025932 Bacteria 1746
272 Ga0207706_10196076 3300025933 Bacteria 1772
273 Ga0207706_10549277 3300025933 Bacteria 994
274 Ga0207709_11607052 3300025935 Bacteria 540
275 Ga0207670_10307281 3300025936 Bacteria 1244
276 Ga0207665_10039269 3300025939 Bacteria 3155
277 Ga0207689_10000688 3300025942 Bacteria 32316
278 Ga0207689_10062323 3300025942 Bacteria 3066
279 Ga0207689_10106153 3300025942 Bacteria 2308
280 Ga0207679_10130206 3300025945 Bacteria 2017
281 Ga0207679_11286367 3300025945 Bacteria 671
282 Ga0207667_10046584 3300025949 Bacteria 4591
283 Ga0207667_10175159 3300025949 Bacteria 2204
284 Ga0207667_10597414 3300025949 Bacteria 1113
285 Ga0207651_10489432 3300025960 Bacteria 1061
286 Ga0207712_10000863 3300025961 Bacteria 22110
287 Ga0207712_10338515 3300025961 Bacteria 1247
288 Ga0207668_10019558 3300025972 Bacteria 4285
289 Ga0207668_10394945 3300025972 Bacteria 1168
290 Ga0207640_10031310 3300025981 Bacteria 3286
291 Ga0207640_10197677 3300025981 Bacteria 1521
292 Ga0207658_10348078 3300025986 Bacteria 1290
293 Ga0207658_10425385 3300025986 Bacteria 1172
294 Ga0207658_10471694 3300025986 Bacteria 1114
295 Ga0207677_10019908 3300026023 Bacteria 4062
296 Ga0207703_10493592 3300026035 Bacteria 1148
297 Ga0207703_10854522 3300026035 Bacteria 870
298 Ga0207703_10936215 3300026035 Bacteria 830
299 Ga0207678_10021752 3300026067 Bacteria 5625
300 Ga0207678_10093921 3300026067 Bacteria 2562
301 Ga0207678_10097526 3300026067 Bacteria 2512
302 Ga0207678_11056718 3300026067 Bacteria 719
303 Ga0207708_10031642 3300026075 Bacteria 4016
304 Ga0207708_11094036 3300026075 Bacteria 695
305 Ga0207702_10020662 3300026078 Bacteria 5448
306 Ga0207702_10037081 3300026078 Bacteria 4079
307 Ga0207702_10452912 3300026078 Bacteria 1245
308 Ga0207641_10042871 3300026088 Bacteria 3798
309 Ga0207641_10288557 3300026088 Bacteria 1546
310 Ga0207648_10620656 3300026089 Bacteria 998
311 Ga0207674_10000418 3300026116 Bacteria 55342
312 Ga0207674_10012297 3300026116 Bacteria 9569
313 Ga0207674_10012355 3300026116 Bacteria 9545
314 Ga0207674_10013990 3300026116 Bacteria 8871
315 Ga0207674_10664073 3300026116 Bacteria 1007
316 Ga0207675_100151714 3300026118 Bacteria 2206
317 Ga0207683_10148836 3300026121 Bacteria 2112
318 Ga0207683_10251118 3300026121 Bacteria 1614
319 Ga0207698_10015166 3300026142 Bacteria 5153
320 Ga0207698_10276706 3300026142 Bacteria 1550
321 Ga0209813_10002329 3300027866 Bacteria 4351
322 Ga0209813_10013878 3300027866 Bacteria 2159
323 Ga0209813_10444996 3300027866 Bacteria 529
324 Ga0207428_10086996 3300027907 Bacteria 2432
325 Ga0268266_10386128 3300028379 Bacteria 1322
326 Ga0268266_10913841 3300028379 Bacteria 849
327 Ga0268265_10003109 3300028380 Bacteria 12109
328 Ga0268265_10168303 3300028380 Bacteria 1870
329 Ga0268264_10007646 3300028381 Bacteria 9007
330 Ga0268264_10040293 3300028381 Bacteria 3859
331 Ga0265337_1038277 3300028556 Bacteria 1391
332 Ga0265319_1122909 3300028563 Bacteria 808
333 Ga0265318_10144362 3300028577 Bacteria 873
334 Ga0307515_10008675 3300028794 Bacteria 19780
335 Ga0307515_10142912 3300028794 Bacteria 2555
336 Ga0265338_10035203 3300028800 Bacteria 4820
337 Ga0265330_10022609 3300031235 Bacteria 2861
338 Ga0265332_10079661 3300031238 Bacteria 1390
339 Ga0265325_10118508 3300031241 Bacteria 1279
340 Ga0265325_10153558 3300031241 Bacteria 1087
341 Ga0265339_10098634 3300031249 Bacteria 1524
342 Ga0265316_10719577 3300031344 Bacteria 703
343 Ga0265313_10000806 3300031595 Bacteria 31638
344 Ga0265314_10008873 3300031711 Bacteria 8582
345 Ga0265314_10016879 3300031711 Bacteria 5751
346 Ga0265314_10021446 3300031711 Bacteria 4966
347 Ga0265314_10085342 3300031711 Bacteria 2070
348 Ga0265342_10174807 3300031712 Bacteria 1179
349 Ga0307406_10400585 3300031901 Unclassified 1088
350 Ga0307409_100011127 3300031995 Bacteria 5648
351 Ga0307409_100612889 3300031995 Bacteria 1077
352 Ga0373936_0320828 3300035113 Bacteria 702
353 Ga0373956_0245066 3300035119 Bacteria 852
354 Ga0373957_0089085 3300035120 Bacteria 1225
355 Ga0373943_0019899 3300035170 Bacteria 3092
356 Ga0373931_0896773 3300035691 Bacteria 596
357 Ga0373933_0051990 3300035724 Bacteria 2450
358 Ga0373937_0014621 3300036401 Bacteria 6932
359 Ga0395899_0010094 3300037312 Bacteria 7241
360 Ga0395900_0024896 3300037418 Bacteria 6124
361 Ga0395900_0159117 3300037418 Bacteria 2305
362 Ga0395898_0005826 3300037466 Bacteria 13258
363 Ga0395905_0005250 3300037471 Bacteria 13256
364 Ga0395905_0006563 3300037471 Bacteria 11688
365 Ga0395901_0012653 3300038443 Bacteria 8560
366 Ga0436360_0422209 3300039438 Bacteria 508
367 Ga0436360_0853923 3300039438 Bacteria 5969
368 Ga0436361_0687376 3300039447 Bacteria 2033
369 Ga0436361_0763525 3300039447 Bacteria 48860
370 Ga0439465_0129851 3300041413 Bacteria 889
371 Ga0451849_1288333 3300041505 Bacteria 814
372 Ga0439448_0112962 3300042005 Bacteria 929
373 Ga0451577_0462147 3300042876 Bacteria 1153
374 Ga0466961_0148524 3300044693 Bacteria 1464
375 Ga0466963_0650296 3300044694 Bacteria 744
376 Ga0466964_0130287 3300044706 Bacteria 1145
377 Ga0453684_0167163 3300044712 Bacteria 2596
378 Ga0451576_0122951 3300045051 Bacteria 2703
379 Ga0466967_0383354 3300045976 Bacteria 1365
380 Ga0466967_0404429 3300045976 Bacteria 1329
381 Ga0466967_1074262 3300045976 Bacteria 802
382 Ga0495629_0107051 3300046459 Bacteria 1951
383 Ga0495638_0010933 3300046460 Bacteria 6276
384 Ga0495638_0038832 3300046460 Bacteria 3023
385 Ga0495638_0149400 3300046460 Bacteria 1356
386 Ga0495640_0617723 3300046533 Bacteria 654
387 Ga0495586_0683808 3300046535 Bacteria 593
388 Ga0495622_0004258 3300046557 Bacteria 6660
389 Ga0495668_0611831 3300046616 Bacteria 602
390 Ga0495625_0180369 3300046660 Bacteria 1405
391 Ga0495657_0053803 3300046675 Bacteria 2692
392 Ga0495613_0835987 3300046689 Bacteria 599
393 Ga0496100_0073208 3300048903 Bacteria 2292
394 Ga0496102_0002254 3300048905 Bacteria 16517
395 Ga0496103_0066350 3300048906 Bacteria 2252
396 Ga0496103_0412427 3300048906 Bacteria 867
397 Ga0496103_0524103 3300048906 Bacteria 757
398 Ga0496104_0000312 3300048907 Bacteria 43264
399 Ga0496104_0961984 3300048907 Bacteria 758
400 Ga0496105_0026537 3300048908 Bacteria 4727
401 Ga0496106_0003151 3300048909 Bacteria 12308
402 Ga0496106_0362118 3300048909 Bacteria 1165
403 Ga0496106_0508999 3300048909 Bacteria 967
404 Ga0496107_0024127 3300048910 Bacteria 4301
405 Ga0496107_0159464 3300048910 Bacteria 1671
406 Ga0496107_0311494 3300048910 Bacteria 1172
407 Ga0496107_0536187 3300048910 Bacteria 867
408 Ga0496108_0002264 3300048911 Bacteria 15418
409 Ga0496109_0001614 3300048912 Bacteria 18833
410 Ga0496109_0312344 3300048912 Bacteria 1483
411 Ga0496109_1858007 3300048912 Bacteria 535
412 Ga0496110_0008344 3300048913 Bacteria 8335
413 Ga0496111_0039147 3300048914 Bacteria 3398
414 Ga0496111_0258913 3300048914 Bacteria 1291
415 Ga0496112_0026138 3300048915 Bacteria 5613
416 Ga0496113_0010656 3300048916 Bacteria 6088
417 Ga0496115_0279533 3300048918 Bacteria 1371
418 Ga0496118_0003663 3300048921 Bacteria 19078
419 Ga0501032_0282410 3300049569 Bacteria 1075
420 Ga0501033_0067092 3300049570 Bacteria 2638
421 Ga0501033_0303140 3300049570 Bacteria 1124
422 Ga0501033_0566721 3300049570 Bacteria 781
423 Ga0501033_0571460 3300049570 Bacteria 777
424 Ga0501034_0068636 3300049571 Bacteria 3555
425 Ga0501034_0120668 3300049571 Bacteria 2608
426 Ga0501036_0488494 3300049572 Bacteria 1025
427 Ga0501036_0808788 3300049572 Bacteria 772
428 Ga0501036_1180692 3300049572 Bacteria 624
429 Ga0501037_0572069 3300049573 Bacteria 761
430 Ga0501038_0152834 3300049574 Bacteria 1881
431 Ga0501038_0399948 3300049574 Bacteria 1063
432 Ga0501039_0065886 3300049575 Bacteria 2811
433 Ga0501039_0084009 3300049575 Bacteria 2480
434 Ga0501039_1345374 3300049575 Bacteria 550
435 Ga0501040_0156746 3300049576 Bacteria 1608
436 Ga0501041_0335723 3300049577 Bacteria 954
437 Ga0501042_0070137 3300049578 Bacteria 2507
438 Ga0501043_0404499 3300049579 Bacteria 1031
439 Ga0501046_0000023 3300049580 Bacteria 213965
440 Ga0501046_0047573 3300049580 Bacteria 3400
441 Ga0501046_0449790 3300049580 Bacteria 926
442 Ga0501046_0511183 3300049580 Bacteria 859
443 Ga0501047_0050313 3300049581 Bacteria 4024
444 Ga0501048_0061107 3300049582 Bacteria 2669
445 Ga0501048_0258104 3300049582 Bacteria 1238
446 Ga0501067_0095904 3300049583 Bacteria 1647
447 Ga0501068_0944526 3300049584 Bacteria 568
448 Ga0501071_0246636 3300049587 Bacteria 1347
449 Ga0501071_0313312 3300049587 Bacteria 1191
450 Ga0501072_0098444 3300049588 Bacteria 2325
451 Ga0501072_0622931 3300049588 Bacteria 850
452 Ga0501073_0664658 3300049589 Bacteria 719
453 Ga0501075_0030459 3300049591 Bacteria 3997
454 Ga0501075_0031611 3300049591 Bacteria 3930
455 Ga0501076_0063146 3300049592 Bacteria 2951
456 Ga0501076_0281951 3300049592 Bacteria 1361
457 Ga0501077_0180344 3300049593 Bacteria 1342
458 Ga0501079_0043059 3300049741 Bacteria 3485
459 Ga0501079_0138821 3300049741 Bacteria 1893
460 Ga0501080_0754904 3300049742 Bacteria 855
461 Ga0501035_0001979 3300049822 Bacteria 20499
462 Ga0501035_0231261 3300049822 Bacteria 1575
463 Ga0501035_0656300 3300049822 Bacteria 850
464 Ga0501035_0708599 3300049822 Bacteria 811
465 Ga0501044_0002133 3300049823 Bacteria 22663
466 Ga0501044_0174434 3300049823 Bacteria 2120
467 Ga0501044_0248125 3300049823 Bacteria 1722
468 Ga0501044_0460381 3300049823 Bacteria 1177
469 Ga0501045_0072123 3300049824 Bacteria 2542
470 Ga0501045_0772526 3300049824 Bacteria 708
471 nmdc:mga03n38_26405_c1 3300050490 Bacteria 2398
472 nmdc:mga03n38_35209_c1 3300050490 Bacteria 2143
473 nmdc:mga00v17_72283_c1 3300050491 Bacteria 2140
474 nmdc:mga06z11_19604_c1 3300050494 Bacteria 3113
475 nmdc:mga06z11_333084_c1 3300050494 Bacteria 907
476 nmdc:mga06z11_66547_c1 3300050494 Bacteria 1895
477 nmdc:mga04h51_196615_c1 3300050495 Bacteria 791
478 nmdc:mga04h51_2530_c1 3300050495 Bacteria 4351
479 nmdc:mga04h51_375363_c1 3300050495 Bacteria 592
480 nmdc:mga05p37_136381_c1 3300050507 Bacteria 3009
481 nmdc:mga05p37_46881_c1 3300050507 Bacteria 5314
482 nmdc:mga09592_205217_c1 3300050508 Bacteria 1707
483 nmdc:mga09592_361042_c1 3300050508 Bacteria 1257
484 nmdc:mga09592_75789_c1 3300050508 Bacteria 2860
485 nmdc:mga0qj67_108608_c1 3300050509 Bacteria 2239
486 nmdc:mga0qj67_17780_c1 3300050509 Bacteria 5408
487 nmdc:mga0qj67_233094_c1 3300050509 Bacteria 1494
488 nmdc:mga06r32_101866_c1 3300050510 Bacteria 2818
489 nmdc:mga06r32_1491665_c1 3300050510 Bacteria 616
490 nmdc:mga06r32_232324_c1 3300050510 Bacteria 1832
491 nmdc:mga06r32_6871_c1 3300050510 Bacteria 10227
492 nmdc:mga06r32_8952_c1 3300050510 Bacteria 9019
493 nmdc:mga08y16_149186_c1 3300050511 Bacteria 2431
494 nmdc:mga0n895_7590_c1 3300050512 Bacteria 9324
495 nmdc:mga0rr50_11232_c1 3300050513 Bacteria 5719
496 nmdc:mga0rr50_141758_c1 3300050513 Bacteria 1934
497 nmdc:mga08x19_105767_c1 3300050514 Bacteria 1872
498 nmdc:mga08x19_98763_c1 3300050514 Bacteria 1934
499 Ga0495619_0314798 3300053085 Bacteria 1084
500 Ga0495619_0529000 3300053085 Bacteria 810
501 Ga0500651_0295548 3300053093 Bacteria 930
502 Ga0500555_131689 3300053103 Bacteria 620
503 Ga0500556_0188152 3300053104 Bacteria 816
504 Ga0500595_007101 3300053119 Bacteria 4682
505 Ga0500608_082348 3300053122 Bacteria 1516
506 Ga0500642_0102767 3300053130 Bacteria 1330
507 Ga0500559_0098295 3300053136 Bacteria 1346
508 Ga0500568_0087910 3300053139 Bacteria 1174
509 Ga0500573_0000055 3300053140 Bacteria 82259
510 Ga0500590_119936 3300053148 Bacteria 1234
511 Ga0500616_0066922 3300053153 Bacteria 1843
512 Ga0500622_0002756 3300053156 Bacteria 12377
513 Ga0500627_0220773 3300053158 Bacteria 846
514 Ga0501084_0239711 3300054114 Bacteria 1531
515 Ga0501084_0594735 3300054114 Bacteria 935
516 Ga0501082_0174436 3300060353 Bacteria 1869
517 Ga0501082_0442168 3300060353 Bacteria 1136
518 Ga0501082_0447523 3300060353 Bacteria 1128
519 Ga0530510_0019773 3300061734 Bacteria 4784
520 2513229330 2513020051 Bacteria 6053213
521 2519461301 2519103095 Bacteria 6629912
522 2585290133 2582581311 Bacteria 6763856
523 2644129570 2643221623 Bacteria 5239945
524 2644325016 2643221658 Bacteria 6064537
525 2644400256 2643221672 Bacteria 6322190
526 2644467572 2643221683 Bacteria 5749203
527 2739252329 2738543013 Bacteria 5618633
528 2739307080 2738543024 Bacteria 5603683
529 2817258917 2816332253 Bacteria 6764532
530 2817280662 2816332256 Bacteria 6891714
531 2817454830 2816332286 Bacteria 6853759
532 2837654554 2837651117 Bacteria 3772164
533 2885203305 2885198086 Bacteria 7212419
534 2885217345 2885211737 Bacteria 7212420
535 2904452411 2904449895 Bacteria 6927402
536 2904458441 2904456579 Bacteria 6819253
537 2928157576 2928157003 Bacteria 7522202
538 2928165379 2928163908 Bacteria 7561269
539 2945910878 2945909444 Bacteria 7065066
540 2945986881 2945984333 Bacteria 7358892
541 2981990643 2981990288 Bacteria 7590678
542 642416447 641736154 Bacteria 7689995
543 8002289172 8002285264 Bacteria 6717907
544 8020809149 8020807995 Bacteria 6801506
545 8040168074 8040167225 Bacteria 6542727
546 8040174541 8040173305 Bacteria 6827067
547 Ga0070677_10486184
548 rootH1_10048523
549 rootL2_10188275
550 Ga0055527_1003619
551 Ga0070658_10892121
552 Ga0070658_11057019
553 Ga0070676_10216800
554 Ga0070676_10274336
555 Ga0070670_100801747
556 Ga0068869_100069012
557 Ga0070666_10421944
558 Ga0070680_100046457
559 Ga0070680_100781504
560 Ga0068868_100031135
561 Ga0068868_100279444
562 Ga0070660_100402860
563 Ga0070660_101311184
564 Ga0070689_100197708
565 Ga0070691_10096953
566 Ga0070687_100770307
567 Ga0070661_100001304
568 Ga0070661_100118935
569 Ga0070661_100209232
570 Ga0070661_100502594
571 Ga0070692_10069070
572 Ga0070692_10341340
573 Ga0070668_100314553
574 Ga0070669_101971464
575 Ga0070673_100678484
576 Ga0070688_100864708
577 Ga0070659_100025875
578 Ga0070659_100072402
579 Ga0070667_100672693
580 Ga0070667_101198831
581 Ga0070703_10007642
582 Ga0070709_10011733
583 Ga0070709_10420454
584 Ga0070709_10492918
585 Ga0070709_11600813
586 Ga0070714_100005999
587 Ga0070714_100056781
588 Ga0070714_100943660
589 Ga0070714_101113264
590 Ga0070713_100079544
591 Ga0070713_100141914
592 Ga0070710_10257129
593 Ga0070711_100058404
594 Ga0070705_100001958
595 Ga0070700_100006805
596 Ga0070700_100253494
597 Ga0070694_100000699
598 Ga0070694_100105873
599 Ga0070708_100063764
600 Ga0070663_100021591
601 Ga0070663_100089925
602 Ga0070663_100225763
603 Ga0070663_100296069
604 Ga0070678_100131815
605 Ga0070662_100629324
606 Ga0070662_101163156
607 Ga0070681_10068159
608 Ga0070681_10076157
609 Ga0070681_10096284
610 Ga0070681_10295210
611 Ga0070685_10490856
612 Ga0070685_11138552
613 Ga0070706_100053841
614 Ga0070707_100028609
615 Ga0070698_100293242
616 Ga0070698_100384029
617 Ga0070698_100440734
618 Ga0070699_100003406
619 Ga0070699_100010685
620 Ga0070699_100667061
621 Ga0070679_100241980
622 Ga0070679_101320762
623 Ga0070684_100008343
624 Ga0070684_100950845
625 Ga0070697_100018108
626 Ga0070697_100045658
627 Ga0068853_100197861
628 Ga0068853_100976209
629 Ga0070695_100025497
630 Ga0070695_100052565
631 Ga0070696_100000087
632 Ga0070696_100057519
633 Ga0070693_100114965
634 Ga0070665_100519237
635 Ga0070704_100074282
636 Ga0068855_100010656
637 Ga0068855_100386618
638 Ga0068855_100576652
639 Ga0068855_101158726
640 Ga0070664_100017187
641 Ga0070664_100076268
642 Ga0070664_100160395
643 Ga0068857_100002462
644 Ga0068857_100006512
645 Ga0068857_100066161
646 Ga0068857_100465867
647 Ga0068854_100016776
648 Ga0068854_100231540
649 Ga0068854_100593592
650 Ga0068854_101129930
651 Ga0068856_100014644
652 Ga0068856_100058639
653 Ga0068856_100157560
654 Ga0068856_100226518
655 Ga0068852_100006004
656 Ga0068852_100328135
657 Ga0068852_101204047
658 Ga0068859_100005753
659 Ga0068859_100226921
660 Ga0068859_100228224
661 Ga0068861_100702234
662 Ga0068851_10046444
663 Ga0068851_10103640
664 Ga0068851_10247821
665 Ga0068863_100214663
666 Ga0068863_100254823
667 Ga0068858_100739739
668 Ga0068860_100003602
669 Ga0068860_100176197
670 Ga0068860_100561030
671 Ga0068860_101228913
672 Ga0068862_100002025
673 Ga0068862_100225675
674 Ga0081455_10185896
675 Ga0075365_10208589
676 Ga0075365_10244855
677 Ga0075368_10047730
678 Ga0075368_10069238
679 Ga0075368_10438247
680 Ga0075363_100006779
681 Ga0075363_100220895
682 Ga0075364_10001764
683 Ga0070716_100080482
684 Ga0070712_100110336
685 Ga0075367_10019742
686 Ga0075367_10121558
687 Ga0075366_10569946
688 Ga0068871_100030252
689 Ga0068871_100041456
690 Ga0068871_100203891
691 Ga0068871_100787104
692 Ga0068871_101213420
693 Ga0075428_100118173
694 Ga0075428_100125061
695 Ga0075430_100006832
696 Ga0075430_100174578
697 Ga0075431_100011319
698 Ga0075431_100031574
699 Ga0075431_100044166
700 Ga0075431_100110011
701 Ga0075431_100193254
702 Ga0075434_100004320
703 Ga0075434_100363724
704 Ga0075429_100144782
705 Ga0075429_100184143
706 Ga0068865_100236377
707 Ga0075436_100101305
708 Ga0075436_100110279
709 Ga0075436_100117556
710 Ga0097620_100005754
711 Ga0097620_100226922
712 Ga0097620_100228222
713 Ga0075435_100003824
714 Ga0075435_100174196
715 Ga0105240_10001807
716 Ga0105240_10040180
717 Ga0105240_10076488
718 Ga0105240_11516851
719 Ga0111539_10024810
720 Ga0111539_11933466
721 Ga0105245_10010247
722 Ga0105245_10029614
723 Ga0105245_10335351
724 Ga0105245_11288149
725 Ga0114129_10054450
726 Ga0114129_10142497
727 Ga0105241_10097032
728 Ga0105241_10127983
729 Ga0105248_11165115
730 Ga0105237_10007603
731 Ga0105237_10277946
732 Ga0105238_10032504
733 Ga0105249_10000473
734 Ga0105249_10017583
735 Ga0105239_10149927
736 Ga0105239_10251205
737 Ga0105239_11309101
738 Ga0105246_10003863
739 Ga0105246_10100668
740 Ga0157347_1004982
741 Ga0157373_10011247
742 Ga0157373_10435398
743 Ga0157373_10456442
744 Ga0157371_10189827
745 Ga0157371_10858044
746 Ga0157370_10035276
747 Ga0157370_10134269
748 Ga0157370_10170094
749 Ga0157370_10317359
750 Ga0157370_10645683
751 Ga0157370_11149070
752 Ga0157369_10039300
753 Ga0157369_10333948
754 Ga0157369_10370551
755 Ga0157374_10839889
756 Ga0157378_11974542
757 Ga0163162_10395728
758 Ga0157372_10030538
759 Ga0157372_10149955
760 Ga0157372_10395158
761 Ga0157372_10900320
762 Ga0157372_11377513
763 Ga0157375_10877467
764 Ga0163163_10092914
765 Ga0163163_10913600
766 Ga0157380_11507870
767 Ga0157377_10651533
768 Ga0157377_10716801
769 Ga0157379_10548070
770 Ga0213872_10003475
771 Ga0213872_10031328
772 Ga0213871_10002584
773 Ga0207656_10031039
774 Ga0207653_10008855
775 Ga0207692_10015870
776 Ga0207692_10389913
777 Ga0207699_10009128
778 Ga0207699_10036085
779 Ga0207699_10075906
780 Ga0207699_10398843
781 Ga0207645_10048404
782 Ga0207645_10365158
783 Ga0207643_10000698
784 Ga0207643_10111004
785 Ga0207705_11017816
786 Ga0207684_10049525
787 Ga0207684_10173106
788 Ga0207654_10040357
789 Ga0207707_10016503
790 Ga0207707_10020479
791 Ga0207707_10425406
792 Ga0207707_10441948
793 Ga0207695_10015405
794 Ga0207695_10040390
795 Ga0207695_10161352
796 Ga0207671_10189182
797 Ga0207693_10048685
798 Ga0207660_10042812
799 Ga0207660_10672754
800 Ga0207657_10010020
801 Ga0207657_10095143
802 Ga0207649_10047506
803 Ga0207652_10007529
804 Ga0207652_10407163
805 Ga0207652_11140903
806 Ga0207694_10074276
807 Ga0207687_10003108
808 Ga0207687_10029503
809 Ga0207687_10611407
810 Ga0207687_10923584
811 Ga0207700_10389665
812 Ga0207664_10017130
813 Ga0207664_10063859
814 Ga0207664_10251627
815 Ga0207664_10659306
816 Ga0207690_10045017
817 Ga0207690_10146447
818 Ga0207706_10196076
819 Ga0207706_10549277
820 Ga0207709_11607052
821 Ga0207670_10307281
822 Ga0207665_10039269
823 Ga0207689_10000688
824 Ga0207689_10062323
825 Ga0207689_10106153
826 Ga0207679_10130206
827 Ga0207679_11286367
828 Ga0207667_10046584
829 Ga0207667_10175159
830 Ga0207667_10597414
831 Ga0207651_10489432
832 Ga0207712_10000863
833 Ga0207712_10338515
834 Ga0207668_10019558
835 Ga0207668_10394945
836 Ga0207640_10031310
837 Ga0207640_10197677
838 Ga0207658_10348078
839 Ga0207658_10425385
840 Ga0207658_10471694
841 Ga0207677_10019908
842 Ga0207703_10493592
843 Ga0207703_10854522
844 Ga0207703_10936215
845 Ga0207678_10021752
846 Ga0207678_10093921
847 Ga0207678_10097526
848 Ga0207678_11056718
849 Ga0207708_10031642
850 Ga0207708_11094036
851 Ga0207702_10020662
852 Ga0207702_10037081
853 Ga0207702_10452912
854 Ga0207641_10042871
855 Ga0207641_10288557
856 Ga0207648_10620656
857 Ga0207674_10000418
858 Ga0207674_10012297
859 Ga0207674_10012355
860 Ga0207674_10013990
861 Ga0207674_10664073
862 Ga0207675_100151714
863 Ga0207683_10148836
864 Ga0207683_10251118
865 Ga0207698_10015166
866 Ga0207698_10276706
867 Ga0209813_10002329
868 Ga0209813_10013878
869 Ga0209813_10444996
870 Ga0207428_10086996
871 Ga0268266_10386128
872 Ga0268266_10913841
873 Ga0268265_10003109
874 Ga0268265_10168303
875 Ga0268264_10007646
876 Ga0268264_10040293
877 Ga0265337_1038277
878 Ga0265319_1122909
879 Ga0265318_10144362
880 Ga0307515_10008675
881 Ga0307515_10142912
882 Ga0265338_10035203
883 Ga0265330_10022609
884 Ga0265332_10079661
885 Ga0265325_10118508
886 Ga0265325_10153558
887 Ga0265339_10098634
888 Ga0265316_10719577
889 Ga0265313_10000806
890 Ga0265314_10008873
891 Ga0265314_10016879
892 Ga0265314_10021446
893 Ga0265314_10085342
894 Ga0265342_10174807
895 Ga0307406_10400585
896 Ga0307409_100011127
897 Ga0307409_100612889
898 Ga0373936_0320828
899 Ga0373956_0245066
900 Ga0373957_0089085
901 Ga0373943_0019899
902 Ga0373931_0896773
903 Ga0373933_0051990
904 Ga0373937_0014621
905 Ga0395899_0010094
906 Ga0395900_0024896
907 Ga0395900_0159117
908 Ga0395898_0005826
909 Ga0395905_0005250
910 Ga0395905_0006563
911 Ga0395901_0012653
912 Ga0436360_0422209
913 Ga0436360_0853923
914 Ga0436361_0687376
915 Ga0436361_0763525
916 Ga0439465_0129851
917 Ga0451849_1288333
918 Ga0439448_0112962
919 Ga0451577_0462147
920 Ga0466961_0148524
921 Ga0466963_0650296
922 Ga0466964_0130287
923 Ga0453684_0167163
924 Ga0451576_0122951
925 Ga0466967_0383354
926 Ga0466967_0404429
927 Ga0466967_1074262
928 Ga0495629_0107051
929 Ga0495638_0010933
930 Ga0495638_0038832
931 Ga0495638_0149400
932 Ga0495640_0617723
933 Ga0495586_0683808
934 Ga0495622_0004258
935 Ga0495668_0611831
936 Ga0495625_0180369
937 Ga0495657_0053803
938 Ga0495613_0835987
939 Ga0496100_0073208
940 Ga0496102_0002254
941 Ga0496103_0066350
942 Ga0496103_0412427
943 Ga0496103_0524103
944 Ga0496104_0000312
945 Ga0496104_0961984
946 Ga0496105_0026537
947 Ga0496106_0003151
948 Ga0496106_0362118
949 Ga0496106_0508999
950 Ga0496107_0024127
951 Ga0496107_0159464
952 Ga0496107_0311494
953 Ga0496107_0536187
954 Ga0496108_0002264
955 Ga0496109_0001614
956 Ga0496109_0312344
957 Ga0496109_1858007
958 Ga0496110_0008344
959 Ga0496111_0039147
960 Ga0496111_0258913
961 Ga0496112_0026138
962 Ga0496113_0010656
963 Ga0496115_0279533
964 Ga0496118_0003663
965 Ga0501032_0282410
966 Ga0501033_0067092
967 Ga0501033_0303140
968 Ga0501033_0566721
969 Ga0501033_0571460
970 Ga0501034_0068636
971 Ga0501034_0120668
972 Ga0501036_0488494
973 Ga0501036_0808788
974 Ga0501036_1180692
975 Ga0501037_0572069
976 Ga0501038_0152834
977 Ga0501038_0399948
978 Ga0501039_0065886
979 Ga0501039_0084009
980 Ga0501039_1345374
981 Ga0501040_0156746
982 Ga0501041_0335723
983 Ga0501042_0070137
984 Ga0501043_0404499
985 Ga0501046_0000023
986 Ga0501046_0047573
987 Ga0501046_0449790
988 Ga0501046_0511183
989 Ga0501047_0050313
990 Ga0501048_0061107
991 Ga0501048_0258104
992 Ga0501067_0095904
993 Ga0501068_0944526
994 Ga0501071_0246636
995 Ga0501071_0313312
996 Ga0501072_0098444
997 Ga0501072_0622931
998 Ga0501073_0664658
999 Ga0501075_0030459
1000 Ga0501075_0031611
1001 Ga0501076_0063146
1002 Ga0501076_0281951
1003 Ga0501077_0180344
1004 Ga0501079_0043059
1005 Ga0501079_0138821
1006 Ga0501080_0754904
1007 Ga0501035_0001979
1008 Ga0501035_0231261
1009 Ga0501035_0656300
1010 Ga0501035_0708599
1011 Ga0501044_0002133
1012 Ga0501044_0174434
1013 Ga0501044_0248125
1014 Ga0501044_0460381
1015 Ga0501045_0072123
1016 Ga0501045_0772526
1017 nmdc:mga03n38_26405_c1
1018 nmdc:mga03n38_35209_c1
1019 nmdc:mga00v17_72283_c1
1020 nmdc:mga06z11_19604_c1
1021 nmdc:mga06z11_333084_c1
1022 nmdc:mga06z11_66547_c1
1023 nmdc:mga04h51_196615_c1
1024 nmdc:mga04h51_2530_c1
1025 nmdc:mga04h51_375363_c1
1026 nmdc:mga05p37_136381_c1
1027 nmdc:mga05p37_46881_c1
1028 nmdc:mga09592_205217_c1
1029 nmdc:mga09592_361042_c1
1030 nmdc:mga09592_75789_c1
1031 nmdc:mga0qj67_108608_c1
1032 nmdc:mga0qj67_17780_c1
1033 nmdc:mga0qj67_233094_c1
1034 nmdc:mga06r32_101866_c1
1035 nmdc:mga06r32_1491665_c1
1036 nmdc:mga06r32_232324_c1
1037 nmdc:mga06r32_6871_c1
1038 nmdc:mga06r32_8952_c1
1039 nmdc:mga08y16_149186_c1
1040 nmdc:mga0n895_7590_c1
1041 nmdc:mga0rr50_11232_c1
1042 nmdc:mga0rr50_141758_c1
1043 nmdc:mga08x19_105767_c1
1044 nmdc:mga08x19_98763_c1
1045 Ga0495619_0314798
1046 Ga0495619_0529000
1047 Ga0500651_0295548
1048 Ga0500555_131689
1049 Ga0500556_0188152
1050 Ga0500595_007101
1051 Ga0500608_082348
1052 Ga0500642_0102767
1053 Ga0500559_0098295
1054 Ga0500568_0087910
1055 Ga0500573_0000055
1056 Ga0500590_119936
1057 Ga0500616_0066922
1058 Ga0500622_0002756
1059 Ga0500627_0220773
1060 Ga0501084_0239711
1061 Ga0501084_0594735
1062 Ga0501082_0174436
1063 Ga0501082_0442168
1064 Ga0501082_0447523
1065 Ga0530510_0019773
1066 2513229330
1067 2519461301
1068 2585290133
1069 2644129570
1070 2644325016
1071 2644400256
1072 2644467572
1073 2739252329
1074 2739307080
1075 2817258917
1076 2817280662
1077 2817454830
1078 2837654554
1079 2885203305
1080 2885217345
1081 2904452411
1082 2904458441
1083 2928157576
1084 2928165379
1085 2945910878
1086 2945986881
1087 2981990643
1088 642416447
1089 8002289172
1090 8020809149
1091 8040168074
1092 8040174541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

30

177

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1moj-assembly1.cif.gz_A crystal structure of an archaeal dps-homologue from halobacterium salinarum 0.9589 50 92
3s4c-assembly1.cif.gz_A-2 lactose phosphorylase in complex with sulfate 0.9013 53 93
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8932 1 150
3act-assembly1.cif.gz_A crystal structure of cellvibrio gilvus cellobiose phosphorylase histidine mutant 0.8906 53 93
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8822 1 150
ID Description Score Start End Superfamily
2yxyA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Hypothetical protein YfhH domain 0.9856 53 93 1.10.287.880
1mojA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9589 50 92 1.20.1260.10
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9585 2 93 1.10.1510.10
af_Q86K90_1153_1377_1.10.3380.30 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.956 47 89 1.10.3380.30
af_Q12032_29_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9348 6 93 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A528LWK8-F1-model_v4 GatB/YqeY domain-containing protein 0.9904 51 150 GO:0016884
AF-A0A2E0YLD9-F1-model_v4 deleted 0.9849 2 150
AF-A0A2T6AQF1-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9838 2 149 GO:0016884
AF-A0A399ZDI4-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9797 2 150 GO:0016740
GO:0016884
AF-A0A7H1MYW0-F1-model_v4 GatB/YqeY domain-containing protein 0.9787 2 150 GO:0016884

Map