F461919

General Info

Members Datasets Scaffolds Average Seq Length
545 306 526 327

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0455422|Ga0501044_0455422_18_1148
Length 376
Sequence VRRPLIQIKRAAAAAARLRQINSRRARLPRLGTSATNRSARVKPPAERLLWMYETMLLIRRYEETLAQVYLEGKLPPDIQAGLAFDIASGPVPGEMHLAAGQEPVAVGVCAHLGAEDTVVGTHRPHHFAIAKGVPLDRMTAEIFGKVTGLGRGKGGHMHLFDPEHRFSCSGIVGASLPPACGAALANKMRGSQAVAVAFFGEGAANQGTFHEALNLASLWRLPAVFVCEDNGWAISVAKQKATAVRSNAARAAAYGMEGARVEDNDPIAVFEAAGAAIRRAREGGGPTLLEVKTDRWFGHFQGDPEVYRPKTEVPQLRKNDPIQALRGLLRRRGILDDAKDAALQEAAAARVSAAIEYARASESPSPDEALQHVFA

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2643221546 Microbacterium sp. Root53 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
5 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
6 2738541278 Niastella sp. CF465 Isolate Unclassified
7 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
8 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
9 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
10 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
11 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
12 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
13 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
14 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
15 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
171 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
219 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
296 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
304 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
305 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
306 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.23
Metatranscriptomes 1.28
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 8.81
Rhizosphere 83.12
Stem 0
Stem Tuber 0.18
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10025414 3300001979 Bacteria 1996
2 JGI24739J22299_10001076 3300001989 Bacteria 10177
3 JGI24737J22298_10002127 3300001990 Bacteria 7057
4 JGI24735J21928_10029712 3300002067 Bacteria 1626
5 JGI25406J46586_10004744 3300003203 Bacteria 6318
6 rootH2_10113468 3300003320 Bacteria 1594
7 rootL2_10148238 3300003322 Bacteria 3611
8 rootL2_10344459 3300003322 Bacteria 1573
9 rootH1_10159430 3300003323 Bacteria 2864
10 Ga0055529_1002807 3300003763 Bacteria 3152
11 Ga0055531_10000625 3300003794 Bacteria 30551
12 Ga0055531_10014077 3300003794 Bacteria 3632
13 Ga0058863_10174367 3300004799 Bacteria 1361
14 Ga0070658_10000359 3300005327 Bacteria 39682
15 Ga0070658_10027659 3300005327 Bacteria 4549
16 Ga0070683_100183311 3300005329 Bacteria 1987
17 Ga0070670_100069755 3300005331 Bacteria 3018
18 Ga0070666_10000024 3300005335 Bacteria 161355
19 Ga0070680_100005203 3300005336 Bacteria 9841
20 Ga0070680_100091440 3300005336 Bacteria 2519
21 Ga0070680_100236450 3300005336 Bacteria 1543
22 Ga0068868_100228617 3300005338 Bacteria 1560
23 Ga0070661_100069701 3300005344 Bacteria 2585
24 Ga0070668_100021462 3300005347 Bacteria 4879
25 Ga0070669_100038187 3300005353 Bacteria 3486
26 Ga0070667_100145659 3300005367 Bacteria 2077
27 Ga0070709_10001996 3300005434 Bacteria 11106
28 Ga0070714_100004583 3300005435 Bacteria 10423
29 Ga0070714_100122468 3300005435 Bacteria 2315
30 Ga0070714_100265244 3300005435 Bacteria 1591
31 Ga0070713_100002844 3300005436 Bacteria 11319
32 Ga0070710_10069517 3300005437 Bacteria 2026
33 Ga0070705_100065804 3300005440 Bacteria 2171
34 Ga0070708_100003698 3300005445 Bacteria 11991
35 Ga0070706_100002705 3300005467 Bacteria 17737
36 Ga0070706_100011416 3300005467 Bacteria 8253
37 Ga0070707_100030492 3300005468 Bacteria 5134
38 Ga0070707_100087156 3300005468 Bacteria 3020
39 Ga0070679_100258733 3300005530 Bacteria 1696
40 Ga0070684_100028002 3300005535 Bacteria 4763
41 Ga0070672_100208754 3300005543 Bacteria 1635
42 Ga0070696_100091525 3300005546 Bacteria 2166
43 Ga0068855_100011303 3300005563 Bacteria 10780
44 Ga0070664_100033648 3300005564 Bacteria 4295
45 Ga0068857_100057683 3300005577 Bacteria 3446
46 Ga0068857_100337337 3300005577 Bacteria 1394
47 Ga0068854_100078672 3300005578 Bacteria 2430
48 Ga0068856_100016257 3300005614 Bacteria 7199
49 Ga0068856_100069074 3300005614 Bacteria 3493
50 Ga0068864_100011366 3300005618 Bacteria 7357
51 Ga0068861_100094499 3300005719 Unclassified 2366
52 Ga0068863_100085245 3300005841 Bacteria 2994
53 Ga0068863_100100708 3300005841 Bacteria 2746
54 Ga0081540_1000070 3300005983 Bacteria 111392
55 Ga0081539_10000756 3300005985 Bacteria 64265
56 Ga0070717_10364854 3300006028 Bacteria 1293
57 Ga0070715_10013103 3300006163 Bacteria 3036
58 Ga0097621_100023930 3300006237 Bacteria 4761
59 Ga0097621_100104987 3300006237 Bacteria 2381
60 Ga0075434_100047605 3300006871 Bacteria 4255
61 Ga0075435_100101822 3300007076 Bacteria 2380
62 Ga0075435_100215726 3300007076 Bacteria 1628
63 Ga0099794_10025272 3300007265 Bacteria 2734
64 Ga0105244_10076485 3300009036 Bacteria 1662
65 Ga0105250_10034177 3300009092 Bacteria 2041
66 Ga0105240_10069069 3300009093 Bacteria 4374
67 Ga0105240_10195420 3300009093 Bacteria 2376
68 Ga0105245_10025798 3300009098 Bacteria 5169
69 Ga0105245_10097784 3300009098 Bacteria 2711
70 Ga0105245_10154695 3300009098 Bacteria 2171
71 Ga0114129_10013562 3300009147 Bacteria 11612
72 Ga0114129_10020859 3300009147 Bacteria 9309
73 Ga0105241_10041754 3300009174 Bacteria 3467
74 Ga0105242_10199980 3300009176 Bacteria 1774
75 Ga0105248_10183135 3300009177 Bacteria 2360
76 Ga0105237_10194879 3300009545 Bacteria 2026
77 Ga0105238_10267618 3300009551 Bacteria 1689
78 Ga0105249_10010274 3300009553 Bacteria 8222
79 Ga0157370_10004246 3300013104 Bacteria 16554
80 Ga0157370_10147161 3300013104 Bacteria 2193
81 Ga0157369_10062328 3300013105 Bacteria 4019
82 Ga0157374_10000412 3300013296 Bacteria 38781
83 Ga0163162_10011755 3300013306 Bacteria 8539
84 Ga0163162_10178099 3300013306 Bacteria 2252
85 Ga0157372_10282906 3300013307 Bacteria 1928
86 Ga0157372_10349549 3300013307 Bacteria 1722
87 Ga0157375_10025617 3300013308 Bacteria 5485
88 Ga0163163_10004929 3300014325 Bacteria 11482
89 Ga0157380_10272880 3300014326 Bacteria 1543
90 Ga0157379_10000595 3300014968 Bacteria 29273
91 Ga0157379_10108751 3300014968 Bacteria 2490
92 Ga0157376_10005066 3300014969 Bacteria 9191
93 Ga0157376_10049561 3300014969 Bacteria 3479
94 Ga0163161_10241890 3300017792 Bacteria 1404
95 Ga0206356_11835610 3300020070 Bacteria 1521
96 Ga0206349_1614230 3300020075 Bacteria 1624
97 Ga0206351_10093362 3300020077 Bacteria 1358
98 Ga0206354_10898310 3300020081 Bacteria 1383
99 Ga0224712_10136344 3300022467 Bacteria 1076
100 Ga0209148_1000920 3300025254 Bacteria 19634
101 Ga0209455_1001257 3300025272 Bacteria 11896
102 Ga0209050_1005166 3300025298 Bacteria 8359
103 Ga0209051_1000078 3300025303 Bacteria 201965
104 Ga0209257_1000012 3300025304 Bacteria 1111138
105 Ga0209257_1002037 3300025304 Bacteria 21530
106 Ga0209257_1007974 3300025304 Bacteria 6194
107 Ga0207655_1064747 3300025728 Bacteria 1392
108 Ga0207692_10022436 3300025898 Bacteria 2904
109 Ga0207692_10055634 3300025898 Bacteria 2026
110 Ga0207647_10020780 3300025904 Bacteria 4397
111 Ga0207699_10007582 3300025906 Bacteria 5312
112 Ga0207699_10016958 3300025906 Bacteria 3822
113 Ga0207684_10001819 3300025910 Bacteria 22280
114 Ga0207684_10044060 3300025910 Bacteria 3784
115 Ga0207654_10034099 3300025911 Bacteria 2826
116 Ga0207693_10021819 3300025915 Bacteria 5092
117 Ga0207660_10045821 3300025917 Bacteria 3083
118 Ga0207657_10040476 3300025919 Bacteria 4129
119 Ga0207646_10039662 3300025922 Bacteria 4238
120 Ga0207646_10292260 3300025922 Bacteria 1473
121 Ga0207650_10198109 3300025925 Bacteria 1607
122 Ga0207659_10024861 3300025926 Bacteria 4020
123 Ga0207687_10089183 3300025927 Bacteria 2245
124 Ga0207700_10077355 3300025928 Bacteria 2584
125 Ga0207664_10006658 3300025929 Bacteria 7964
126 Ga0207664_10023522 3300025929 Bacteria 4618
127 Ga0207661_10017030 3300025944 Bacteria 5368
128 Ga0207679_10021940 3300025945 Bacteria 4339
129 Ga0207667_10005945 3300025949 Bacteria 14859
130 Ga0207668_10038263 3300025972 Bacteria 3218
131 Ga0207677_10120599 3300026023 Bacteria 1972
132 Ga0207639_10235726 3300026041 Bacteria 1589
133 Ga0207678_10207883 3300026067 Bacteria 1674
134 Ga0207702_10004539 3300026078 Bacteria 12304
135 Ga0207641_10005846 3300026088 Bacteria 10439
136 Ga0207641_10020773 3300026088 Bacteria 5397
137 Ga0207641_10107703 3300026088 Bacteria 2465
138 Ga0207641_10201317 3300026088 Bacteria 1836
139 Ga0207676_10157383 3300026095 Bacteria 1964
140 Ga0207674_10023156 3300026116 Bacteria 6659
141 Ga0207674_10093828 3300026116 Bacteria 2989
142 Ga0209974_10027691 3300027876 Bacteria 1875
143 Ga0268266_10014137 3300028379 Bacteria 6869
144 Ga0307515_10009264 3300028794 Bacteria 19057
145 Ga0265327_10040353 3300031251 Bacteria 2526
146 Ga0307513_10002444 3300031456 Bacteria 25765
147 Ga0307513_10024629 3300031456 Bacteria 6997
148 Ga0307509_10000003 3300031507 Bacteria 577578
149 Ga0316575_10053284 3300031665 Bacteria 1611
150 Ga0316576_10086574 3300031727 Bacteria 2330
151 Ga0316578_10011028 3300031728 Bacteria 4709
152 Ga0307516_10000124 3300031730 Bacteria 90831
153 Ga0316577_10004706 3300031733 Bacteria 7086
154 Ga0307413_10194410 3300031824 Bacteria 1459
155 Ga0307415_100252533 3300032126 Bacteria 1434
156 Ga0316585_10019216 3300032137 Bacteria 2081
157 Ga0307510_10000005 3300033180 Bacteria 633068
158 Ga0373959_0004769 3300034820 Bacteria 2202
159 Ga0373934_0000130 3300035086 Bacteria 27677
160 Ga0373934_0004921 3300035086 Bacteria 4945
161 Ga0373940_0004805 3300035088 Bacteria 2881
162 Ga0373951_0013589 3300035091 Bacteria 1829
163 Ga0373923_0006523 3300035111 Bacteria 4041
164 Ga0373939_0004318 3300035114 Bacteria 3357
165 Ga0373945_0026495 3300035116 Bacteria 2019
166 Ga0373953_0002767 3300035117 Bacteria 5330
167 Ga0373953_0007839 3300035117 Bacteria 3598
168 Ga0373954_0002741 3300035118 Bacteria 7414
169 Ga0373954_0080653 3300035118 Bacteria 1554
170 Ga0373956_0005031 3300035119 Bacteria 5298
171 Ga0373957_0000470 3300035120 Bacteria 10181
172 Ga0373960_0006967 3300035121 Bacteria 2666
173 Ga0373943_0124430 3300035170 Bacteria 1373
174 Ga0373946_0023049 3300035171 Bacteria 2429
175 Ga0373955_0000232 3300035172 Bacteria 23186
176 Ga0373955_0003806 3300035172 Bacteria 6645
177 Ga0373955_0026220 3300035172 Bacteria 3000
178 Ga0373962_0010931 3300035242 Bacteria 2270
179 Ga0316574_0204878 3300035398 Bacteria 1266
180 Ga0373924_0001616 3300035410 Bacteria 7391
181 Ga0373924_0039634 3300035410 Bacteria 1925
182 Ga0373931_0007792 3300035691 Bacteria 5059
183 Ga0373935_0091660 3300035692 Bacteria 1990
184 Ga0373927_0066748 3300035695 Bacteria 2327
185 Ga0373933_0000056 3300035724 Bacteria 66983
186 Ga0373933_0030617 3300035724 Bacteria 3116
187 Ga0373933_0151355 3300035724 Bacteria 1469
188 Ga0373937_0000152 3300036401 Bacteria 66956
189 Ga0373937_0036797 3300036401 Bacteria 4460
190 Ga0373937_0126816 3300036401 Bacteria 2381
191 Ga0316584_0045244 3300036712 Bacteria 3285
192 Ga0316584_0062949 3300036712 Bacteria 2778
193 Ga0373925_0011658 3300037068 Bacteria 6357
194 Ga0373925_0096926 3300037068 Bacteria 2261
195 Ga0395899_0001479 3300037312 Bacteria 19996
196 Ga0395899_0004051 3300037312 Bacteria 11556
197 Ga0395899_0040268 3300037312 Bacteria 3495
198 Ga0395899_0233407 3300037312 Bacteria 1269
199 Ga0395900_0000021 3300037418 Bacteria 351144
200 Ga0395900_0033580 3300037418 Bacteria 5280
201 Ga0395900_0051229 3300037418 Bacteria 4253
202 Ga0395898_0001024 3300037466 Bacteria 43550
203 Ga0395898_0014460 3300037466 Bacteria 8106
204 Ga0395898_0019040 3300037466 Bacteria 6990
205 Ga0395898_0050997 3300037466 Bacteria 4047
206 Ga0395905_0000551 3300037471 Bacteria 51169
207 Ga0395905_0006370 3300037471 Bacteria 11895
208 Ga0395905_0054506 3300037471 Bacteria 3742
209 Ga0395901_0013399 3300038443 Bacteria 8333
210 Ga0395901_0042062 3300038443 Bacteria 4736
211 Ga0395901_0141402 3300038443 Bacteria 2529
212 Ga0400483_155706 3300039062 Bacteria 2398
213 Ga0439436_0000469 3300041404 Bacteria 10388
214 Ga0439436_0027719 3300041404 Bacteria 1656
215 Ga0439438_000423 3300041405 Bacteria 19119
216 Ga0439447_000080 3300041407 Bacteria 34054
217 Ga0439466_0008067 3300041411 Bacteria 3970
218 Ga0439466_0034649 3300041411 Bacteria 1711
219 Ga0451804_0502709 3300041463 Bacteria 834
220 Ga0439449_0109484 3300042007 Bacteria 1023
221 Ga0439462_0007240 3300042015 Bacteria 2774
222 Ga0439434_0000994 3300042435 Bacteria 8185
223 Ga0466972_0000396 3300044658 Bacteria 23138
224 Ga0466967_0292245 3300045976 Bacteria 1566
225 Ga0495592_0000129 3300046454 Bacteria 66962
226 Ga0495592_0030087 3300046454 Bacteria 4106
227 Ga0495603_0010644 3300046455 Bacteria 5576
228 Ga0495629_0063082 3300046459 Bacteria 2587
229 Ga0495629_0112761 3300046459 Bacteria 1895
230 Ga0495638_0116275 3300046460 Bacteria 1584
231 Ga0495638_0140811 3300046460 Bacteria 1408
232 Ga0495641_0032123 3300046461 Bacteria 2501
233 Ga0495641_0038294 3300046461 Bacteria 2240
234 Ga0495651_0000089 3300046462 Bacteria 66983
235 Ga0495651_0012375 3300046462 Bacteria 6577
236 Ga0495651_0022915 3300046462 Bacteria 4856
237 Ga0495653_0036492 3300046463 Bacteria 3871
238 Ga0495653_0088381 3300046463 Bacteria 2273
239 Ga0495653_0227023 3300046463 Bacteria 1252
240 Ga0495580_0070186 3300046472 Bacteria 2447
241 Ga0495582_0037468 3300046473 Bacteria 2667
242 Ga0495639_0051000 3300046475 Bacteria 1880
243 Ga0495639_0120861 3300046475 Bacteria 1249
244 Ga0495662_0061955 3300046476 Bacteria 1807
245 Ga0495664_0008812 3300046477 Bacteria 5635
246 Ga0495608_0000086 3300046511 Bacteria 67464
247 Ga0495608_0189849 3300046511 Bacteria 1297
248 Ga0495610_0015125 3300046512 Bacteria 4499
249 Ga0495618_0025866 3300046514 Bacteria 3645
250 Ga0495620_0002623 3300046515 Bacteria 10405
251 Ga0495628_0003130 3300046516 Bacteria 14861
252 Ga0495630_0048631 3300046517 Bacteria 3174
253 Ga0495630_0105434 3300046517 Bacteria 2134
254 Ga0495632_0021591 3300046519 Bacteria 3467
255 Ga0495648_0151239 3300046524 Bacteria 1211
256 Ga0495666_0137397 3300046526 Bacteria 1140
257 Ga0495652_0000221 3300046529 Bacteria 66315
258 Ga0495652_0069917 3300046529 Bacteria 2936
259 Ga0495652_0090260 3300046529 Bacteria 2507
260 Ga0495654_0001503 3300046530 Bacteria 15943
261 Ga0495665_0006230 3300046531 Bacteria 6438
262 Ga0495640_0027380 3300046533 Bacteria 4111
263 Ga0495640_0114213 3300046533 Bacteria 1761
264 Ga0495586_0007075 3300046535 Bacteria 5981
265 Ga0495586_0115192 3300046535 Bacteria 1498
266 Ga0495587_0000099 3300046536 Bacteria 67448
267 Ga0495587_0008394 3300046536 Bacteria 6646
268 Ga0495609_0011191 3300046538 Bacteria 4281
269 Ga0495645_0033608 3300046543 Bacteria 3741
270 Ga0495645_0101453 3300046543 Bacteria 2046
271 Ga0495645_0124538 3300046543 Bacteria 1812
272 Ga0495667_0000088 3300046559 Bacteria 66785
273 Ga0495667_0073525 3300046559 Bacteria 2226
274 Ga0495667_0163211 3300046559 Bacteria 1433
275 Ga0495667_0215162 3300046559 Bacteria 1227
276 Ga0495634_0030721 3300046642 Bacteria 3706
277 Ga0495634_0066946 3300046642 Bacteria 2377
278 Ga0495634_0124610 3300046642 Bacteria 1647
279 Ga0495635_0006553 3300046663 Bacteria 8125
280 Ga0495657_0000130 3300046675 Bacteria 66983
281 Ga0495657_0008081 3300046675 Bacteria 8068
282 Ga0495599_0000190 3300046678 Bacteria 40649
283 Ga0495623_0006721 3300046679 Bacteria 7486
284 Ga0495623_0020925 3300046679 Bacteria 4226
285 Ga0495623_0058929 3300046679 Bacteria 2413
286 Ga0495646_0022185 3300046680 Bacteria 4005
287 Ga0495646_0029377 3300046680 Bacteria 3436
288 Ga0495647_0026697 3300046681 Bacteria 2117
289 Ga0495658_0016791 3300046683 Bacteria 3772
290 Ga0495658_0037020 3300046683 Bacteria 2695
291 Ga0495658_0080652 3300046683 Bacteria 1909
292 Ga0495669_0227676 3300046684 Bacteria 894
293 Ga0495613_0084744 3300046689 Bacteria 2300
294 Ga0495613_0158095 3300046689 Bacteria 1613
295 Ga0495624_0053832 3300046690 Bacteria 2539
296 Ga0495624_0157992 3300046690 Bacteria 1385
297 Ga0495670_0000622 3300046691 Bacteria 16978
298 Ga0495671_0034947 3300046692 Bacteria 2554
299 Ga0495649_0189123 3300046694 Bacteria 1072
300 Ga0495600_0031134 3300046809 Bacteria 3455
301 Ga0495600_0105635 3300046809 Bacteria 1835
302 Ga0495600_0166927 3300046809 Bacteria 1421
303 Ga0495600_0188147 3300046809 Unclassified 1329
304 Ga0495581_0016108 3300047315 Bacteria 4345
305 Ga0495581_0037108 3300047315 Bacteria 2819
306 Ga0495604_0000117 3300047317 Bacteria 66983
307 Ga0495604_0060316 3300047317 Bacteria 2906
308 Ga0495674_0023556 3300047319 Bacteria 5673
309 Ga0495674_0114496 3300047319 Bacteria 2283
310 Ga0495674_0149407 3300047319 Bacteria 1960
311 Ga0495672_0002434 3300047320 Bacteria 17144
312 Ga0495672_0010322 3300047320 Bacteria 6670
313 Ga0495676_0188995 3300047321 Bacteria 1438
314 Ga0495680_0004248 3300047322 Bacteria 13751
315 Ga0495680_0104902 3300047322 Bacteria 2102
316 Ga0495680_0144936 3300047322 Bacteria 1735
317 Ga0495675_0007540 3300047444 Bacteria 6706
318 Ga0495675_0020240 3300047444 Bacteria 4230
319 Ga0495684_0078599 3300047471 Bacteria 2504
320 Ga0495684_0084616 3300047471 Unclassified 2406
321 Ga0495684_0093931 3300047471 Bacteria 2271
322 Ga0495593_0045507 3300047673 Bacteria 2341
323 Ga0495602_0000424 3300048088 Bacteria 39603
324 Ga0495602_0042960 3300048088 Bacteria 4114
325 Ga0495602_0085854 3300048088 Bacteria 2628
326 Ga0496100_0009470 3300048903 Bacteria 5473
327 Ga0496100_0020777 3300048903 Bacteria 3943
328 Ga0496100_0089461 3300048903 Bacteria 2097
329 Ga0496101_0011202 3300048904 Bacteria 5942
330 Ga0496101_0094973 3300048904 Bacteria 2223
331 Ga0496101_0115232 3300048904 Bacteria 2027
332 Ga0496102_0001941 3300048905 Bacteria 17816
333 Ga0496102_0153248 3300048905 Bacteria 2166
334 Ga0496102_0376887 3300048905 Bacteria 1335
335 Ga0496103_0006316 3300048906 Bacteria 7084
336 Ga0496103_0021858 3300048906 Bacteria 3850
337 Ga0496104_0031584 3300048907 Bacteria 4926
338 Ga0496104_0031597 3300048907 Bacteria 4924
339 Ga0496104_0046549 3300048907 Bacteria 4085
340 Ga0496104_0137102 3300048907 Bacteria 2351
341 Ga0496104_0213825 3300048907 Bacteria 1840
342 Ga0496105_0011011 3300048908 Bacteria 7128
343 Ga0496105_0109617 3300048908 Bacteria 2279
344 Ga0496105_0381728 3300048908 Bacteria 1121
345 Ga0496106_0020846 3300048909 Bacteria 4864
346 Ga0496106_0167214 3300048909 Bacteria 1741
347 Ga0496106_0175836 3300048909 Bacteria 1698
348 Ga0496106_0313086 3300048909 Bacteria 1260
349 Ga0496107_0011421 3300048910 Bacteria 6186
350 Ga0496107_0037990 3300048910 Bacteria 3456
351 Ga0496108_0151947 3300048911 Bacteria 1998
352 Ga0496109_0018589 3300048912 Bacteria 6106
353 Ga0496109_0264046 3300048912 Bacteria 1622
354 Ga0496109_0318551 3300048912 Bacteria 1467
355 Ga0496110_0164211 3300048913 Bacteria 2013
356 Ga0496111_0182641 3300048914 Bacteria 1559
357 Ga0496112_0035671 3300048915 Bacteria 4847
358 Ga0496112_0118298 3300048915 Bacteria 2620
359 Ga0496112_0149627 3300048915 Bacteria 2302
360 Ga0496112_0169299 3300048915 Bacteria 2150
361 Ga0496112_0204101 3300048915 Bacteria 1935
362 Ga0496113_0052722 3300048916 Bacteria 3039
363 Ga0496113_0065196 3300048916 Bacteria 2756
364 Ga0496113_0153015 3300048916 Bacteria 1821
365 Ga0496113_0460087 3300048916 Bacteria 1022
366 Ga0496114_0000881 3300048917 Bacteria 22473
367 Ga0496114_0022499 3300048917 Bacteria 5138
368 Ga0496114_0038736 3300048917 Bacteria 3944
369 Ga0496114_0136177 3300048917 Bacteria 2124
370 Ga0496114_0260276 3300048917 Bacteria 1527
371 Ga0496114_0322937 3300048917 Bacteria 1364
372 Ga0496115_0244214 3300048918 Bacteria 1479
373 Ga0496125_0009117 3300048928 Bacteria 10263
374 Ga0495682_0015816 3300049460 Bacteria 2857
375 Ga0501312_008033 3300049528 Bacteria 1361
376 Ga0501031_0001766 3300049568 Bacteria 13562
377 Ga0501031_0002099 3300049568 Bacteria 12563
378 Ga0501031_0060385 3300049568 Bacteria 2471
379 Ga0501032_0018468 3300049569 Bacteria 4885
380 Ga0501032_0241860 3300049569 Bacteria 1172
381 Ga0501033_0063409 3300049570 Bacteria 2720
382 Ga0501033_0201672 3300049570 Bacteria 1421
383 Ga0501034_0009097 3300049571 Bacteria 10433
384 Ga0501034_0040541 3300049571 Bacteria 4713
385 Ga0501036_0002998 3300049572 Bacteria 13432
386 Ga0501036_0007365 3300049572 Bacteria 8968
387 Ga0501036_0014768 3300049572 Bacteria 6514
388 Ga0501036_0029536 3300049572 Bacteria 4631
389 Ga0501036_0042236 3300049572 Bacteria 3861
390 Ga0501036_0073975 3300049572 Bacteria 2881
391 Ga0501036_0084349 3300049572 Bacteria 2686
392 Ga0501037_0012789 3300049573 Bacteria 6184
393 Ga0501037_0026963 3300049573 Bacteria 4245
394 Ga0501037_0043477 3300049573 Bacteria 3301
395 Ga0501037_0077793 3300049573 Bacteria 2407
396 Ga0501037_0280107 3300049573 Bacteria 1162
397 Ga0501038_0001209 3300049574 Bacteria 23407
398 Ga0501038_0012377 3300049574 Bacteria 7798
399 Ga0501038_0060494 3300049574 Bacteria 3242
400 Ga0501038_0145494 3300049574 Bacteria 1935
401 Ga0501039_0003892 3300049575 Bacteria 11208
402 Ga0501039_0051877 3300049575 Bacteria 3173
403 Ga0501039_0086781 3300049575 Bacteria 2437
404 Ga0501039_0185688 3300049575 Bacteria 1635
405 Ga0501040_0000014 3300049576 Archaea 76174
406 Ga0501040_0007863 3300049576 Bacteria 6910
407 Ga0501040_0010694 3300049576 Bacteria 6001
408 Ga0501040_0034901 3300049576 Bacteria 3409
409 Ga0501040_0039399 3300049576 Bacteria 3213
410 Ga0501040_0067975 3300049576 Bacteria 2457
411 Ga0501040_0078626 3300049576 Bacteria 2282
412 Ga0501040_0299843 3300049576 Archaea 1149
413 Ga0501041_0001368 3300049577 Bacteria 13457
414 Ga0501041_0026616 3300049577 Bacteria 3480
415 Ga0501041_0028612 3300049577 Bacteria 3361
416 Ga0501042_0006968 3300049578 Bacteria 7375
417 Ga0501042_0016652 3300049578 Bacteria 5052
418 Ga0501042_0022756 3300049578 Bacteria 4379
419 Ga0501042_0030658 3300049578 Bacteria 3800
420 Ga0501042_0039389 3300049578 Bacteria 3358
421 Ga0501042_0252104 3300049578 Bacteria 1274
422 Ga0501043_0008874 3300049579 Bacteria 7911
423 Ga0501043_0031354 3300049579 Bacteria 4179
424 Ga0501043_0039779 3300049579 Bacteria 3696
425 Ga0501043_0096590 3300049579 Bacteria 2322
426 Ga0501043_0145685 3300049579 Bacteria 1854
427 Ga0501046_0010232 3300049580 Bacteria 8071
428 Ga0501046_0016295 3300049580 Bacteria 6229
429 Ga0501046_0122606 3300049580 Bacteria 1977
430 Ga0501046_0217300 3300049580 Bacteria 1417
431 Ga0501047_0019820 3300049581 Bacteria 6455
432 Ga0501047_0448880 3300049581 Bacteria 1119
433 Ga0501048_0005060 3300049582 Bacteria 10047
434 Ga0501048_0006036 3300049582 Bacteria 9225
435 Ga0501048_0007085 3300049582 Bacteria 8515
436 Ga0501068_0065812 3300049584 Bacteria 2207
437 Ga0501068_0079020 3300049584 Bacteria 2017
438 Ga0501069_0039781 3300049585 Bacteria 2598
439 Ga0501069_0045706 3300049585 Bacteria 2426
440 Ga0501071_0007540 3300049587 Bacteria 7159
441 Ga0501071_0019782 3300049587 Bacteria 4674
442 Ga0501071_0023579 3300049587 Bacteria 4298
443 Ga0501071_0129588 3300049587 Bacteria 1873
444 Ga0501071_0196153 3300049587 Bacteria 1516
445 Ga0501072_0031709 3300049588 Bacteria 4139
446 Ga0501072_0045112 3300049588 Bacteria 3465
447 Ga0501072_0048592 3300049588 Bacteria 3341
448 Ga0501072_0104872 3300049588 Bacteria 2248
449 Ga0501073_0023822 3300049589 Bacteria 4396
450 Ga0501073_0033373 3300049589 Bacteria 3665
451 Ga0501074_0001599 3300049590 Bacteria 15367
452 Ga0501074_0004070 3300049590 Bacteria 10431
453 Ga0501074_0009651 3300049590 Bacteria 7005
454 Ga0501074_0014129 3300049590 Bacteria 5805
455 Ga0501074_0098986 3300049590 Bacteria 2087
456 Ga0501075_0047228 3300049591 Bacteria 3235
457 Ga0501075_0057652 3300049591 Bacteria 2924
458 Ga0501075_0068126 3300049591 Bacteria 2688
459 Ga0501075_0120944 3300049591 Bacteria 1993
460 Ga0501075_0244211 3300049591 Bacteria 1369
461 Ga0501076_0002222 3300049592 Bacteria 13300
462 Ga0501076_0047403 3300049592 Bacteria 3397
463 Ga0501076_0160425 3300049592 Bacteria 1832
464 Ga0501077_0047832 3300049593 Bacteria 2717
465 Ga0501077_0076365 3300049593 Bacteria 2122
466 Ga0501079_0002277 3300049741 Bacteria 13860
467 Ga0501079_0068286 3300049741 Bacteria 2744
468 Ga0501079_0194308 3300049741 Bacteria 1584
469 Ga0501079_0223030 3300049741 Bacteria 1473
470 Ga0501080_0098558 3300049742 Bacteria 2713
471 Ga0501080_0560882 3300049742 Bacteria 1017
472 Ga0501081_0008633 3300049743 Bacteria 6619
473 Ga0501081_0011026 3300049743 Bacteria 5910
474 Ga0501081_0053212 3300049743 Bacteria 2795
475 Ga0501081_0183230 3300049743 Bacteria 1515
476 Ga0501083_0046497 3300049744 Bacteria 2934
477 Ga0501035_0027279 3300049822 Bacteria 5220
478 Ga0501035_0030510 3300049822 Bacteria 4913
479 Ga0501044_0006290 3300049823 Bacteria 13124
480 Ga0501044_0036424 3300049823 Bacteria 5148
481 Ga0501044_0080169 3300049823 Bacteria 3307
482 Ga0501044_0086489 3300049823 Bacteria 3167
483 Ga0501044_0146296 3300049823 Bacteria 2348
484 Ga0501044_0364425 3300049823 Bacteria 1363
485 Ga0501044_0455422 3300049823 Bacteria 1185
486 Ga0501045_0004554 3300049824 Bacteria 9576
487 Ga0501045_0012593 3300049824 Bacteria 5954
488 Ga0501045_0029334 3300049824 Bacteria 3976
489 Ga0501045_0041206 3300049824 Bacteria 3360
490 Ga0501045_0046908 3300049824 Bacteria 3146
491 Ga0501045_0069052 3300049824 Bacteria 2597
492 nmdc:mga0n895_124803_c1 3300050512 Bacteria 2598
493 nmdc:mga0n895_56920_c1 3300050512 Bacteria 3854
494 nmdc:mga0rr50_29731_c1 3300050513 Bacteria 3858
495 nmdc:mga0rr50_32571_c1 3300050513 Bacteria 3715
496 nmdc:mga0a205_22836_c1 3300050515 Bacteria 5931
497 Ga0495612_0026636 3300053078 Bacteria 2323
498 Ga0495595_0020497 3300053084 Bacteria 2878
499 Ga0495595_0063047 3300053084 Bacteria 1739
500 Ga0495619_0045575 3300053085 Bacteria 2881
501 Ga0495619_0050130 3300053085 Bacteria 2755
502 Ga0500643_000603 3300053087 Bacteria 24488
503 Ga0500644_0017847 3300053088 Bacteria 2068
504 Ga0500583_0053884 3300053092 Bacteria 1877
505 Ga0500651_0115914 3300053093 Bacteria 1631
506 Ga0500568_0000220 3300053139 Bacteria 48991
507 Ga0500568_0011394 3300053139 Bacteria 4131
508 Ga0500588_0028308 3300053146 Bacteria 1588
509 Ga0500604_0000016 3300053151 Bacteria 91519
510 Ga0500616_0000142 3300053153 Bacteria 122026
511 Ga0500616_0002749 3300053153 Bacteria 14222
512 Ga0500622_0005299 3300053156 Bacteria 7780
513 Ga0500622_0012327 3300053156 Bacteria 4630
514 Ga0500587_002760 3300053739 Bacteria 2481
515 Ga0501084_0008104 3300054114 Bacteria 8655
516 Ga0501084_0032643 3300054114 Bacteria 4354
517 Ga0501084_0047595 3300054114 Bacteria 3591
518 Ga0501084_0158563 3300054114 Bacteria 1909
519 Ga0501082_0003368 3300060353 Bacteria 13950
520 Ga0501082_0010723 3300060353 Bacteria 7886
521 Ga0501082_0035992 3300060353 Bacteria 4265
522 Ga0501082_0078585 3300060353 Bacteria 2846
523 Ga0530510_0004203 3300061734 Bacteria 9952
524 Ga0530510_0012282 3300061734 Bacteria 6012
525 Ga0530510_0036320 3300061734 Bacteria 3552
526 Ga0530510_0067307 3300061734 Bacteria 2598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_0502709 Ga0451804_0502709_58_819 241
2 3300049581 Ga0501047_0448880 Ga0501047_0448880_264_1097 265
3 3300046684 Ga0495669_0227676 Ga0495669_0227676_26_877 278
4 3300036401 Ga0373937_0126816 Ga0373937_0126816_1523_2362 279
5 3300050513 nmdc:mga0rr50_29731_c1 nmdc:mga0rr50_29731_c1_11_850 279
6 3300020077 Ga0206351_10093362 Ga0206351_100933622 286
7 3300049574 Ga0501038_0060494 Ga0501038_0060494_2332_3231 287
8 3300009147 Ga0114129_10020859 Ga0114129_1002085912 288
9 3300048909 Ga0496106_0020846 Ga0496106_0020846_3919_4845 293
10 3300005331 Ga0070670_100069755 Ga0070670_1000697551 295
11 3300049589 Ga0501073_0033373 Ga0501073_0033373_2286_3233 297
12 3300049823 Ga0501044_0146296 Ga0501044_0146296_908_1855 297
13 3300007265 Ga0099794_10025272 Ga0099794_100252722 299
14 3300048916 Ga0496113_0460087 Ga0496113_0460087_23_961 299
15 3300053139 Ga0500568_0000220 Ga0500568_0000220_21399_22352 299
16 3300053153 Ga0500616_0000142 Ga0500616_0000142_83836_84789 299
17 3300054114 Ga0501084_0047595 Ga0501084_0047595_2670_3578 302
18 3300005543 Ga0070672_100208754 Ga0070672_1002087541 303
19 3300006237 Ga0097621_100023930 Ga0097621_1000239304 303
20 3300009553 Ga0105249_10010274 Ga0105249_100102747 303
21 3300014968 Ga0157379_10108751 Ga0157379_101087512 303
22 3300014969 Ga0157376_10005066 Ga0157376_100050669 303
23 3300014969 Ga0157376_10049561 Ga0157376_100495613 303
24 3300025304 Ga0209257_1002037 Ga0209257_100203710 303
25 3300025926 Ga0207659_10024861 Ga0207659_100248614 303
26 3300035724 Ga0373933_0151355 Ga0373933_0151355_342_1289 303
27 3300041404 Ga0439436_0027719 Ga0439436_0027719_424_1371 303
28 3300042007 Ga0439449_0109484 Ga0439449_0109484_62_1009 303
29 3300042015 Ga0439462_0007240 Ga0439462_0007240_1543_2490 303
30 3300044658 Ga0466972_0000396 Ga0466972_0000396_26_973 303
31 3300046460 Ga0495638_0140811 Ga0495638_0140811_157_1104 303
32 3300046517 Ga0495630_0048631 Ga0495630_0048631_65_1012 303
33 3300046533 Ga0495640_0114213 Ga0495640_0114213_80_1027 303
34 3300046535 Ga0495586_0007075 Ga0495586_0007075_2360_3307 303
35 3300046642 Ga0495634_0066946 Ga0495634_0066946_232_1179 303
36 3300046683 Ga0495658_0016791 Ga0495658_0016791_1490_2437 303
37 3300046694 Ga0495649_0189123 Ga0495649_0189123_35_982 303
38 3300046809 Ga0495600_0188147 Ga0495600_0188147_164_1111 303
39 3300047319 Ga0495674_0023556 Ga0495674_0023556_624_1571 303
40 3300047471 Ga0495684_0084616 Ga0495684_0084616_260_1207 303
41 3300049528 Ga0501312_008033 Ga0501312_008033_108_1055 303
42 3300049569 Ga0501032_0241860 Ga0501032_0241860_112_1059 303
43 3300049571 Ga0501034_0009097 Ga0501034_0009097_7967_8914 303
44 3300049572 Ga0501036_0014768 Ga0501036_0014768_5163_6110 303
45 3300049573 Ga0501037_0012789 Ga0501037_0012789_1470_2417 303
46 3300049579 Ga0501043_0096590 Ga0501043_0096590_625_1572 303
47 3300049580 Ga0501046_0217300 Ga0501046_0217300_149_1096 303
48 3300049822 Ga0501035_0030510 Ga0501035_0030510_1836_2783 303
49 3300049823 Ga0501044_0006290 Ga0501044_0006290_7968_8915 303
50 3300053085 Ga0495619_0050130 Ga0495619_0050130_1682_2629 303
51 3300049576 Ga0501040_0000014 Ga0501040_0000014_61400_62446 304
52 3300053739 Ga0500587_002760 Ga0500587_002760_609_1562 304
53 3300005367 Ga0070667_100145659 Ga0070667_1001456592 305
54 3300006237 Ga0097621_100104987 Ga0097621_1001049872 305
55 3300009098 Ga0105245_10097784 Ga0105245_100977842 305
56 3300009174 Ga0105241_10041754 Ga0105241_100417541 305
57 3300009177 Ga0105248_10183135 Ga0105248_101831353 305
58 3300009545 Ga0105237_10194879 Ga0105237_101948792 305
59 3300013306 Ga0163162_10178099 Ga0163162_101780992 305
60 3300014968 Ga0157379_10000595 Ga0157379_1000059523 305
61 3300048905 Ga0496102_0001941 Ga0496102_0001941_15684_16646 305
62 3300048906 Ga0496103_0006316 Ga0496103_0006316_5088_6050 305
63 3300025911 Ga0207654_10034099 Ga0207654_100340992 306
64 3300046692 Ga0495671_0034947 Ga0495671_0034947_617_1615 306
65 3300048904 Ga0496101_0115232 Ga0496101_0115232_742_1704 306
66 3300048907 Ga0496104_0031584 Ga0496104_0031584_1366_2328 306
67 3300026088 Ga0207641_10005846 Ga0207641_100058465 307
68 3300031456 Ga0307513_10024629 Ga0307513_100246296 307
69 3300003203 JGI25406J46586_10004744 JGI25406J46586_100047445 308
70 3300005985 Ga0081539_10000756 Ga0081539_1000075631 308
71 3300014326 Ga0157380_10272880 Ga0157380_102728801 308
72 3300046460 Ga0495638_0116275 Ga0495638_0116275_519_1517 309
73 3300053146 Ga0500588_0028308 Ga0500588_0028308_225_1223 309
74 3300005445 Ga0070708_100003698 Ga0070708_1000036987 311
75 3300005467 Ga0070706_100011416 Ga0070706_1000114162 311
76 3300005468 Ga0070707_100087156 Ga0070707_1000871563 311
77 3300025910 Ga0207684_10044060 Ga0207684_100440603 311
78 3300025922 Ga0207646_10292260 Ga0207646_102922601 311
79 3300005841 Ga0068863_100085245 Ga0068863_1000852452 312
80 3300009098 Ga0105245_10154695 Ga0105245_101546952 312
81 3300013296 Ga0157374_10000412 Ga0157374_100004126 312
82 3300013306 Ga0163162_10011755 Ga0163162_100117555 312
83 3300026088 Ga0207641_10201317 Ga0207641_102013172 312
84 3300037466 Ga0395898_0014460 Ga0395898_0014460_6515_7462 312
85 3300046459 Ga0495629_0112761 Ga0495629_0112761_400_1338 312
86 3300046463 Ga0495653_0088381 Ga0495653_0088381_1055_1993 312
87 3300046475 Ga0495639_0051000 Ga0495639_0051000_243_1181 312
88 3300046511 Ga0495608_0189849 Ga0495608_0189849_341_1279 312
89 3300046526 Ga0495666_0137397 Ga0495666_0137397_14_952 312
90 3300046535 Ga0495586_0115192 Ga0495586_0115192_120_1058 312
91 3300046559 Ga0495667_0073525 Ga0495667_0073525_726_1664 312
92 3300048903 Ga0496100_0009470 Ga0496100_0009470_1298_2275 312
93 3300048908 Ga0496105_0381728 Ga0496105_0381728_134_1111 312
94 3300048915 Ga0496112_0118298 Ga0496112_0118298_117_1094 312
95 3300048918 Ga0496115_0244214 Ga0496115_0244214_25_963 312
96 3300049572 Ga0501036_0073975 Ga0501036_0073975_1720_2658 312
97 3300049576 Ga0501040_0078626 Ga0501040_0078626_1314_2252 312
98 3300049587 Ga0501071_0196153 Ga0501071_0196153_43_981 312
99 3300049741 Ga0501079_0223030 Ga0501079_0223030_266_1204 312
100 3300049743 Ga0501081_0183230 Ga0501081_0183230_16_957 312
101 3300049823 Ga0501044_0364425 Ga0501044_0364425_227_1165 312
102 3300049824 Ga0501045_0046908 Ga0501045_0046908_1872_2810 312
103 3300053084 Ga0495595_0063047 Ga0495595_0063047_539_1477 312
104 3300005467 Ga0070706_100002705 Ga0070706_10000270515 313
105 3300005468 Ga0070707_100030492 Ga0070707_1000304925 313
106 3300025910 Ga0207684_10001819 Ga0207684_100018193 313
107 3300025922 Ga0207646_10039662 Ga0207646_100396622 313
108 3300039062 Ga0400483_155706 Ga0400483_155706_943_1917 313
109 3300046809 Ga0495600_0105635 Ga0495600_0105635_416_1426 313
110 3300005563 Ga0068855_100011303 Ga0068855_1000113035 314
111 3300005841 Ga0068863_100100708 Ga0068863_1001007082 314
112 3300009093 Ga0105240_10195420 Ga0105240_101954202 314
113 3300013104 Ga0157370_10147161 Ga0157370_101471613 314
114 3300025949 Ga0207667_10005945 Ga0207667_100059453 314
115 3300003794 Ga0055531_10014077 Ga0055531_100140773 315
116 3300009093 Ga0105240_10069069 Ga0105240_100690692 315
117 3300025298 Ga0209050_1005166 Ga0209050_10051665 315
118 3300025304 Ga0209257_1007974 Ga0209257_10079747 315
119 3300026088 Ga0207641_10107703 Ga0207641_101077032 315
120 3300046519 Ga0495632_0021591 Ga0495632_0021591_1197_2162 315
121 3300053093 Ga0500651_0115914 Ga0500651_0115914_494_1447 315
122 3300053156 Ga0500622_0012327 Ga0500622_0012327_846_1799 315
123 3300005335 Ga0070666_10000024 Ga0070666_1000002441 316
124 3300005353 Ga0070669_100038187 Ga0070669_1000381874 316
125 3300049742 Ga0501080_0098558 Ga0501080_0098558_154_1149 316
126 3300049742 Ga0501080_0560882 Ga0501080_0560882_18_992 316
127 3300031665 Ga0316575_10053284 Ga0316575_100532842 318
128 3300037312 Ga0395899_0001479 Ga0395899_0001479_18181_19167 318
129 3300037418 Ga0395900_0033580 Ga0395900_0033580_3026_4012 318
130 3300037471 Ga0395905_0006370 Ga0395905_0006370_9337_10323 318
131 3300049588 Ga0501072_0104872 Ga0501072_0104872_644_1609 318
132 3300003322 rootL2_10148238 rootL2_101482382 319
133 3300031727 Ga0316576_10086574 Ga0316576_100865742 319
134 3300036712 Ga0316584_0062949 Ga0316584_0062949_159_1154 319
135 iso_pu_bacteria 2899370129 2899372459 320
136 iso_pu_bacteria 2917736166 2917742495 320
137 3300005719 Ga0068861_100094499 Ga0068861_1000944991 321
138 iso_pu_bacteria 2881644220 2881646829 321
139 3300005336 Ga0070680_100005203 Ga0070680_1000052038 322
140 iso_pu_bacteria 2643221645 2644252021 322
141 3300048911 Ga0496108_0151947 Ga0496108_0151947_944_1966 323
142 3300049576 Ga0501040_0299843 Ga0501040_0299843_58_1083 323
143 iso_pu_bacteria 2728369097 2729146872 323
144 iso_pu_bacteria 2738543004 2739201655 323
145 iso_pu_bacteria 2738543015 2739262456 323
146 iso_pu_bacteria 2744054611 2744954560 323
147 iso_pu_bacteria 651053060 651176885 323
148 iso_pu_bacteria 8011350971 8011351461 323
149 3300003320 rootH2_10113468 rootH2_101134682 324
150 3300003322 rootL2_10344459 rootL2_103444592 324
151 3300003323 rootH1_10159430 rootH1_101594302 324
152 3300005327 Ga0070658_10027659 Ga0070658_100276593 324
153 3300005329 Ga0070683_100183311 Ga0070683_1001833112 324
154 3300005336 Ga0070680_100091440 Ga0070680_1000914402 324
155 3300005344 Ga0070661_100069701 Ga0070661_1000697012 324
156 3300005434 Ga0070709_10001996 Ga0070709_1000199612 324
157 3300005435 Ga0070714_100122468 Ga0070714_1001224682 324
158 3300005435 Ga0070714_100265244 Ga0070714_1002652442 324
159 3300005436 Ga0070713_100002844 Ga0070713_1000028447 324
160 3300005437 Ga0070710_10069517 Ga0070710_100695172 324
161 3300005440 Ga0070705_100065804 Ga0070705_1000658042 324
162 3300005530 Ga0070679_100258733 Ga0070679_1002587331 324
163 3300005546 Ga0070696_100091525 Ga0070696_1000915252 324
164 3300005564 Ga0070664_100033648 Ga0070664_1000336485 324
165 3300005577 Ga0068857_100057683 Ga0068857_1000576832 324
166 3300005578 Ga0068854_100078672 Ga0068854_1000786722 324
167 3300005614 Ga0068856_100016257 Ga0068856_1000162577 324
168 3300005614 Ga0068856_100069074 Ga0068856_1000690742 324
169 3300005983 Ga0081540_1000070 Ga0081540_100007028 324
170 3300006028 Ga0070717_10364854 Ga0070717_103648542 324
171 3300006163 Ga0070715_10013103 Ga0070715_100131034 324
172 3300006871 Ga0075434_100047605 Ga0075434_1000476055 324
173 3300007076 Ga0075435_100101822 Ga0075435_1001018222 324
174 3300007076 Ga0075435_100215726 Ga0075435_1002157261 324
175 3300009147 Ga0114129_10013562 Ga0114129_100135624 324
176 3300013105 Ga0157369_10062328 Ga0157369_100623284 324
177 3300013307 Ga0157372_10349549 Ga0157372_103495491 324
178 3300020081 Ga0206354_10898310 Ga0206354_108983102 324
179 3300025898 Ga0207692_10022436 Ga0207692_100224362 324
180 3300025898 Ga0207692_10055634 Ga0207692_100556341 324
181 3300025906 Ga0207699_10007582 Ga0207699_100075825 324
182 3300025906 Ga0207699_10016958 Ga0207699_100169583 324
183 3300025915 Ga0207693_10021819 Ga0207693_100218193 324
184 3300025917 Ga0207660_10045821 Ga0207660_100458212 324
185 3300025919 Ga0207657_10040476 Ga0207657_100404763 324
186 3300025925 Ga0207650_10198109 Ga0207650_101981092 324
187 3300025928 Ga0207700_10077355 Ga0207700_100773552 324
188 3300025929 Ga0207664_10006658 Ga0207664_100066584 324
189 3300025944 Ga0207661_10017030 Ga0207661_100170306 324
190 3300025945 Ga0207679_10021940 Ga0207679_100219403 324
191 3300026023 Ga0207677_10120599 Ga0207677_101205992 324
192 3300026078 Ga0207702_10004539 Ga0207702_1000453910 324
193 3300026116 Ga0207674_10093828 Ga0207674_100938282 324
194 3300028379 Ga0268266_10014137 Ga0268266_100141377 324
195 3300028794 Ga0307515_10009264 Ga0307515_1000926417 324
196 3300031507 Ga0307509_10000003 Ga0307509_10000003275 324
197 3300031730 Ga0307516_10000124 Ga0307516_1000012429 324
198 3300033180 Ga0307510_10000005 Ga0307510_10000005126 324
199 3300034820 Ga0373959_0004769 Ga0373959_0004769_104_1078 324
200 3300035086 Ga0373934_0000130 Ga0373934_0000130_1032_2006 324
201 3300035086 Ga0373934_0004921 Ga0373934_0004921_2538_3512 324
202 3300035088 Ga0373940_0004805 Ga0373940_0004805_1136_2110 324
203 3300035091 Ga0373951_0013589 Ga0373951_0013589_207_1181 324
204 3300035111 Ga0373923_0006523 Ga0373923_0006523_1065_2039 324
205 3300035114 Ga0373939_0004318 Ga0373939_0004318_759_1733 324
206 3300035116 Ga0373945_0026495 Ga0373945_0026495_16_990 324
207 3300035117 Ga0373953_0002767 Ga0373953_0002767_1074_2048 324
208 3300035117 Ga0373953_0007839 Ga0373953_0007839_1454_2428 324
209 3300035118 Ga0373954_0002741 Ga0373954_0002741_5963_6937 324
210 3300035118 Ga0373954_0080653 Ga0373954_0080653_269_1243 324
211 3300035119 Ga0373956_0005031 Ga0373956_0005031_2923_3897 324
212 3300035120 Ga0373957_0000470 Ga0373957_0000470_7809_8783 324
213 3300035121 Ga0373960_0006967 Ga0373960_0006967_396_1370 324
214 3300035170 Ga0373943_0124430 Ga0373943_0124430_65_1039 324
215 3300035171 Ga0373946_0023049 Ga0373946_0023049_713_1687 324
216 3300035172 Ga0373955_0000232 Ga0373955_0000232_20786_21760 324
217 3300035172 Ga0373955_0003806 Ga0373955_0003806_1971_2945 324
218 3300035172 Ga0373955_0026220 Ga0373955_0026220_299_1273 324
219 3300035242 Ga0373962_0010931 Ga0373962_0010931_1116_2090 324
220 3300035410 Ga0373924_0001616 Ga0373924_0001616_1400_2374 324
221 3300035410 Ga0373924_0039634 Ga0373924_0039634_342_1316 324
222 3300035691 Ga0373931_0007792 Ga0373931_0007792_2966_3940 324
223 3300035692 Ga0373935_0091660 Ga0373935_0091660_371_1345 324
224 3300035695 Ga0373927_0066748 Ga0373927_0066748_402_1376 324
225 3300035724 Ga0373933_0000056 Ga0373933_0000056_1427_2401 324
226 3300035724 Ga0373933_0030617 Ga0373933_0030617_410_1384 324
227 3300036401 Ga0373937_0000152 Ga0373937_0000152_1400_2374 324
228 3300036401 Ga0373937_0036797 Ga0373937_0036797_1955_2929 324
229 3300037068 Ga0373925_0096926 Ga0373925_0096926_277_1251 324
230 3300046454 Ga0495592_0000129 Ga0495592_0000129_64583_65557 324
231 3300046454 Ga0495592_0030087 Ga0495592_0030087_1366_2340 324
232 3300046455 Ga0495603_0010644 Ga0495603_0010644_371_1345 324
233 3300046459 Ga0495629_0063082 Ga0495629_0063082_400_1374 324
234 3300046461 Ga0495641_0032123 Ga0495641_0032123_346_1320 324
235 3300046461 Ga0495641_0038294 Ga0495641_0038294_574_1548 324
236 3300046462 Ga0495651_0000089 Ga0495651_0000089_1427_2401 324
237 3300046462 Ga0495651_0012375 Ga0495651_0012375_2785_3759 324
238 3300046462 Ga0495651_0022915 Ga0495651_0022915_1893_2867 324
239 3300046463 Ga0495653_0036492 Ga0495653_0036492_1407_2381 324
240 3300046472 Ga0495580_0070186 Ga0495580_0070186_960_1934 324
241 3300046473 Ga0495582_0037468 Ga0495582_0037468_987_1961 324
242 3300046475 Ga0495639_0120861 Ga0495639_0120861_221_1195 324
243 3300046476 Ga0495662_0061955 Ga0495662_0061955_726_1700 324
244 3300046477 Ga0495664_0008812 Ga0495664_0008812_410_1384 324
245 3300046511 Ga0495608_0000086 Ga0495608_0000086_1423_2397 324
246 3300046514 Ga0495618_0025866 Ga0495618_0025866_2577_3551 324
247 3300046516 Ga0495628_0003130 Ga0495628_0003130_12511_13485 324
248 3300046517 Ga0495630_0105434 Ga0495630_0105434_26_1000 324
249 3300046529 Ga0495652_0000221 Ga0495652_0000221_1427_2401 324
250 3300046529 Ga0495652_0069917 Ga0495652_0069917_1514_2488 324
251 3300046529 Ga0495652_0090260 Ga0495652_0090260_1013_1987 324
252 3300046531 Ga0495665_0006230 Ga0495665_0006230_356_1330 324
253 3300046533 Ga0495640_0027380 Ga0495640_0027380_485_1459 324
254 3300046536 Ga0495587_0000099 Ga0495587_0000099_1407_2381 324
255 3300046536 Ga0495587_0008394 Ga0495587_0008394_5224_6198 324
256 3300046543 Ga0495645_0033608 Ga0495645_0033608_1067_2041 324
257 3300046543 Ga0495645_0101453 Ga0495645_0101453_341_1315 324
258 3300046559 Ga0495667_0000088 Ga0495667_0000088_64413_65387 324
259 3300046559 Ga0495667_0215162 Ga0495667_0215162_159_1133 324
260 3300046642 Ga0495634_0030721 Ga0495634_0030721_1211_2185 324
261 3300046642 Ga0495634_0124610 Ga0495634_0124610_25_999 324
262 3300046663 Ga0495635_0006553 Ga0495635_0006553_595_1569 324
263 3300046675 Ga0495657_0000130 Ga0495657_0000130_64583_65557 324
264 3300046675 Ga0495657_0008081 Ga0495657_0008081_838_1812 324
265 3300046678 Ga0495599_0000190 Ga0495599_0000190_38260_39234 324
266 3300046679 Ga0495623_0006721 Ga0495623_0006721_1425_2399 324
267 3300046679 Ga0495623_0020925 Ga0495623_0020925_472_1446 324
268 3300046679 Ga0495623_0058929 Ga0495623_0058929_521_1495 324
269 3300046680 Ga0495646_0022185 Ga0495646_0022185_1241_2215 324
270 3300046680 Ga0495646_0029377 Ga0495646_0029377_1874_2848 324
271 3300046681 Ga0495647_0026697 Ga0495647_0026697_376_1350 324
272 3300046683 Ga0495658_0037020 Ga0495658_0037020_1322_2296 324
273 3300046689 Ga0495613_0084744 Ga0495613_0084744_529_1503 324
274 3300046689 Ga0495613_0158095 Ga0495613_0158095_520_1494 324
275 3300046690 Ga0495624_0053832 Ga0495624_0053832_1166_2140 324
276 3300046690 Ga0495624_0157992 Ga0495624_0157992_30_1004 324
277 3300046809 Ga0495600_0031134 Ga0495600_0031134_1405_2379 324
278 3300046809 Ga0495600_0166927 Ga0495600_0166927_269_1243 324
279 3300047315 Ga0495581_0016108 Ga0495581_0016108_400_1374 324
280 3300047315 Ga0495581_0037108 Ga0495581_0037108_1446_2420 324
281 3300047317 Ga0495604_0000117 Ga0495604_0000117_64583_65557 324
282 3300047317 Ga0495604_0060316 Ga0495604_0060316_394_1368 324
283 3300047319 Ga0495674_0114496 Ga0495674_0114496_852_1826 324
284 3300047320 Ga0495672_0010322 Ga0495672_0010322_1372_2370 324
285 3300047322 Ga0495680_0004248 Ga0495680_0004248_18_992 324
286 3300047322 Ga0495680_0104902 Ga0495680_0104902_823_1797 324
287 3300047322 Ga0495680_0144936 Ga0495680_0144936_404_1378 324
288 3300047444 Ga0495675_0007540 Ga0495675_0007540_1427_2401 324
289 3300047444 Ga0495675_0020240 Ga0495675_0020240_1725_2699 324
290 3300047471 Ga0495684_0078599 Ga0495684_0078599_439_1413 324
291 3300047471 Ga0495684_0093931 Ga0495684_0093931_23_997 324
292 3300047673 Ga0495593_0045507 Ga0495593_0045507_72_1046 324
293 3300048088 Ga0495602_0000424 Ga0495602_0000424_1399_2373 324
294 3300048088 Ga0495602_0042960 Ga0495602_0042960_1938_2912 324
295 3300048088 Ga0495602_0085854 Ga0495602_0085854_1544_2518 324
296 3300048903 Ga0496100_0020777 Ga0496100_0020777_2538_3512 324
297 3300048904 Ga0496101_0011202 Ga0496101_0011202_3278_4252 324
298 3300048905 Ga0496102_0153248 Ga0496102_0153248_116_1090 324
299 3300048907 Ga0496104_0031597 Ga0496104_0031597_319_1293 324
300 3300048908 Ga0496105_0011011 Ga0496105_0011011_1757_2731 324
301 3300048910 Ga0496107_0037990 Ga0496107_0037990_1769_2743 324
302 3300048912 Ga0496109_0318551 Ga0496109_0318551_419_1393 324
303 3300048913 Ga0496110_0164211 Ga0496110_0164211_758_1732 324
304 3300048915 Ga0496112_0035671 Ga0496112_0035671_3632_4606 324
305 3300048915 Ga0496112_0169299 Ga0496112_0169299_666_1640 324
306 3300048916 Ga0496113_0052722 Ga0496113_0052722_1368_2342 324
307 3300048917 Ga0496114_0260276 Ga0496114_0260276_122_1096 324
308 3300049569 Ga0501032_0018468 Ga0501032_0018468_1937_2941 324
309 3300049571 Ga0501034_0040541 Ga0501034_0040541_3382_4359 324
310 3300049572 Ga0501036_0007365 Ga0501036_0007365_6157_7161 324
311 3300049572 Ga0501036_0042236 Ga0501036_0042236_2770_3747 324
312 3300049572 Ga0501036_0084349 Ga0501036_0084349_71_1048 324
313 3300049573 Ga0501037_0026963 Ga0501037_0026963_2171_3175 324
314 3300049573 Ga0501037_0043477 Ga0501037_0043477_265_1242 324
315 3300049574 Ga0501038_0145494 Ga0501038_0145494_231_1235 324
316 3300049575 Ga0501039_0051877 Ga0501039_0051877_879_1883 324
317 3300049576 Ga0501040_0039399 Ga0501040_0039399_729_1733 324
318 3300049576 Ga0501040_0067975 Ga0501040_0067975_1053_2030 324
319 3300049577 Ga0501041_0001368 Ga0501041_0001368_11852_12856 324
320 3300049578 Ga0501042_0006968 Ga0501042_0006968_4484_5488 324
321 3300049578 Ga0501042_0016652 Ga0501042_0016652_1060_2037 324
322 3300049578 Ga0501042_0252104 Ga0501042_0252104_228_1202 324
323 3300049579 Ga0501043_0008874 Ga0501043_0008874_2377_3354 324
324 3300049579 Ga0501043_0031354 Ga0501043_0031354_1324_2328 324
325 3300049580 Ga0501046_0122606 Ga0501046_0122606_882_1859 324
326 3300049581 Ga0501047_0019820 Ga0501047_0019820_2468_3445 324
327 3300049582 Ga0501048_0005060 Ga0501048_0005060_5972_6949 324
328 3300049582 Ga0501048_0006036 Ga0501048_0006036_6348_7352 324
329 3300049585 Ga0501069_0045706 Ga0501069_0045706_748_1752 324
330 3300049587 Ga0501071_0007540 Ga0501071_0007540_5535_6539 324
331 3300049588 Ga0501072_0048592 Ga0501072_0048592_857_1861 324
332 3300049589 Ga0501073_0023822 Ga0501073_0023822_1067_2044 324
333 3300049590 Ga0501074_0009651 Ga0501074_0009651_3388_4365 324
334 3300049590 Ga0501074_0014129 Ga0501074_0014129_3001_4005 324
335 3300049591 Ga0501075_0120944 Ga0501075_0120944_347_1324 324
336 3300049593 Ga0501077_0047832 Ga0501077_0047832_1181_2185 324
337 3300049741 Ga0501079_0194308 Ga0501079_0194308_237_1214 324
338 3300049743 Ga0501081_0008633 Ga0501081_0008633_4920_5924 324
339 3300049744 Ga0501083_0046497 Ga0501083_0046497_902_1906 324
340 3300049823 Ga0501044_0036424 Ga0501044_0036424_3976_4953 324
341 3300049823 Ga0501044_0086489 Ga0501044_0086489_1909_2913 324
342 3300049824 Ga0501045_0029334 Ga0501045_0029334_1483_2487 324
343 3300049824 Ga0501045_0069052 Ga0501045_0069052_566_1543 324
344 3300050512 nmdc:mga0n895_124803_c1 nmdc:mga0n895_124803_c1_1155_2129 324
345 3300050512 nmdc:mga0n895_56920_c1 nmdc:mga0n895_56920_c1_2212_3186 324
346 3300050513 nmdc:mga0rr50_32571_c1 nmdc:mga0rr50_32571_c1_1383_2357 324
347 3300050515 nmdc:mga0a205_22836_c1 nmdc:mga0a205_22836_c1_4130_5104 324
348 3300053078 Ga0495612_0026636 Ga0495612_0026636_1202_2176 324
349 3300053084 Ga0495595_0020497 Ga0495595_0020497_580_1554 324
350 3300053085 Ga0495619_0045575 Ga0495619_0045575_1459_2433 324
351 3300053139 Ga0500568_0011394 Ga0500568_0011394_2734_3732 324
352 3300053156 Ga0500622_0005299 Ga0500622_0005299_4792_5790 324
353 3300054114 Ga0501084_0032643 Ga0501084_0032643_1345_2349 324
354 3300054114 Ga0501084_0158563 Ga0501084_0158563_877_1854 324
355 3300060353 Ga0501082_0003368 Ga0501082_0003368_12197_13201 324
356 3300061734 Ga0530510_0012282 Ga0530510_0012282_2093_3097 324
357 iso_pu_bacteria 2675903059 2676485352 324
358 3300003794 Ga0055531_10000625 Ga0055531_1000062519 325
359 3300009036 Ga0105244_10076485 Ga0105244_100764852 325
360 3300009092 Ga0105250_10034177 Ga0105250_100341772 325
361 3300017792 Ga0163161_10241890 Ga0163161_102418902 325
362 3300025303 Ga0209051_1000078 Ga0209051_100007882 325
363 3300025304 Ga0209257_1000012 Ga0209257_1000012341 325
364 3300025728 Ga0207655_1064747 Ga0207655_10647472 325
365 3300027876 Ga0209974_10027691 Ga0209974_100276912 325
366 3300031251 Ga0265327_10040353 Ga0265327_100403532 325
367 3300031456 Ga0307513_10002444 Ga0307513_1000244412 325
368 3300031824 Ga0307413_10194410 Ga0307413_101944101 325
369 3300037312 Ga0395899_0004051 Ga0395899_0004051_10196_11182 325
370 3300037312 Ga0395899_0233407 Ga0395899_0233407_34_1044 325
371 3300037418 Ga0395900_0000021 Ga0395900_0000021_346350_347336 325
372 3300037466 Ga0395898_0001024 Ga0395898_0001024_38784_39770 325
373 3300037471 Ga0395905_0000551 Ga0395905_0000551_3809_4795 325
374 3300038443 Ga0395901_0013399 Ga0395901_0013399_3561_4547 325
375 3300041404 Ga0439436_0000469 Ga0439436_0000469_2696_3685 325
376 3300041405 Ga0439438_000423 Ga0439438_000423_3917_4906 325
377 3300041407 Ga0439447_000080 Ga0439447_000080_6140_7129 325
378 3300041411 Ga0439466_0008067 Ga0439466_0008067_1882_2871 325
379 3300041411 Ga0439466_0034649 Ga0439466_0034649_363_1352 325
380 3300042435 Ga0439434_0000994 Ga0439434_0000994_3608_4597 325
381 3300046512 Ga0495610_0015125 Ga0495610_0015125_703_1692 325
382 3300046515 Ga0495620_0002623 Ga0495620_0002623_3324_4313 325
383 3300046524 Ga0495648_0151239 Ga0495648_0151239_20_1009 325
384 3300046530 Ga0495654_0001503 Ga0495654_0001503_5896_6885 325
385 3300046538 Ga0495609_0011191 Ga0495609_0011191_2369_3358 325
386 3300046691 Ga0495670_0000622 Ga0495670_0000622_10290_11279 325
387 3300047320 Ga0495672_0002434 Ga0495672_0002434_7432_8421 325
388 3300048909 Ga0496106_0313086 Ga0496106_0313086_154_1131 325
389 3300048928 Ga0496125_0009117 Ga0496125_0009117_8556_9545 325
390 3300049460 Ga0495682_0015816 Ga0495682_0015816_662_1651 325
391 3300049568 Ga0501031_0001766 Ga0501031_0001766_6894_7880 325
392 3300049573 Ga0501037_0280107 Ga0501037_0280107_131_1120 325
393 3300049574 Ga0501038_0001209 Ga0501038_0001209_3735_4718 325
394 3300049575 Ga0501039_0185688 Ga0501039_0185688_539_1522 325
395 3300049576 Ga0501040_0007863 Ga0501040_0007863_2434_3417 325
396 3300049577 Ga0501041_0026616 Ga0501041_0026616_1443_2426 325
397 3300049578 Ga0501042_0022756 Ga0501042_0022756_1177_2160 325
398 3300049579 Ga0501043_0145685 Ga0501043_0145685_39_1022 325
399 3300049580 Ga0501046_0010232 Ga0501046_0010232_6156_7139 325
400 3300049587 Ga0501071_0129588 Ga0501071_0129588_858_1841 325
401 3300049590 Ga0501074_0001599 Ga0501074_0001599_14118_15101 325
402 3300049591 Ga0501075_0068126 Ga0501075_0068126_532_1515 325
403 3300049591 Ga0501075_0244211 Ga0501075_0244211_160_1143 325
404 3300049743 Ga0501081_0053212 Ga0501081_0053212_850_1833 325
405 3300049824 Ga0501045_0004554 Ga0501045_0004554_5511_6494 325
406 3300054114 Ga0501084_0008104 Ga0501084_0008104_6233_7216 325
407 3300060353 Ga0501082_0035992 Ga0501082_0035992_2296_3279 325
408 3300061734 Ga0530510_0067307 Ga0530510_0067307_1364_2347 325
409 iso_pu_bacteria 2523231044 2523384042 325
410 iso_pu_bacteria 2643221546 2643753849 325
411 iso_pu_bacteria 2738541278 2738730471 325
412 3300003763 Ga0055529_1002807 Ga0055529_10028073 326
413 3300025254 Ga0209148_1000920 Ga0209148_100092014 326
414 3300025272 Ga0209455_1001257 Ga0209455_10012578 326
415 3300026088 Ga0207641_10020773 Ga0207641_100207734 326
416 3300053088 Ga0500644_0017847 Ga0500644_0017847_886_1878 326
417 3300053092 Ga0500583_0053884 Ga0500583_0053884_287_1276 326
418 3300048907 Ga0496104_0213825 Ga0496104_0213825_546_1547 327
419 3300053087 Ga0500643_000603 Ga0500643_000603_20754_21755 327
420 iso_pu_bacteria 3006969106 3006971283 327
421 3300001989 JGI24739J22299_10001076 JGI24739J22299_100010768 328
422 3300001990 JGI24737J22298_10002127 JGI24737J22298_100021274 328
423 3300002067 JGI24735J21928_10029712 JGI24735J21928_100297122 328
424 3300005347 Ga0070668_100021462 Ga0070668_1000214624 328
425 3300005577 Ga0068857_100337337 Ga0068857_1003373372 328
426 3300025904 Ga0207647_10020780 Ga0207647_100207805 328
427 3300025972 Ga0207668_10038263 Ga0207668_100382635 328
428 3300026041 Ga0207639_10235726 Ga0207639_102357261 328
429 3300026116 Ga0207674_10023156 Ga0207674_100231562 328
430 3300048917 Ga0496114_0000881 Ga0496114_0000881_18693_19691 328
431 3300053151 Ga0500604_0000016 Ga0500604_0000016_57893_58888 328
432 iso_pu_bacteria 8004021418 8004024566 329
433 iso_pu_bacteria 8004025490 8004026878 329
434 3300009098 Ga0105245_10025798 Ga0105245_100257983 330
435 3300009176 Ga0105242_10199980 Ga0105242_101999802 330
436 3300009551 Ga0105238_10267618 Ga0105238_102676182 330
437 3300013104 Ga0157370_10004246 Ga0157370_100042468 330
438 3300013308 Ga0157375_10025617 Ga0157375_100256171 330
439 3300025927 Ga0207687_10089183 Ga0207687_100891832 330
440 3300031728 Ga0316578_10011028 Ga0316578_100110283 330
441 3300031733 Ga0316577_10004706 Ga0316577_100047066 330
442 3300032137 Ga0316585_10019216 Ga0316585_100192161 330
443 3300035398 Ga0316574_0204878 Ga0316574_0204878_41_1036 330
444 3300036712 Ga0316584_0045244 Ga0316584_0045244_484_1479 330
445 3300046463 Ga0495653_0227023 Ga0495653_0227023_138_1151 330
446 3300047319 Ga0495674_0149407 Ga0495674_0149407_152_1165 330
447 3300048905 Ga0496102_0376887 Ga0496102_0376887_230_1261 330
448 3300048917 Ga0496114_0022499 Ga0496114_0022499_2181_3212 330
449 3300048917 Ga0496114_0136177 Ga0496114_0136177_686_1699 330
450 3300049592 Ga0501076_0160425 Ga0501076_0160425_617_1645 331
451 3300037312 Ga0395899_0040268 Ga0395899_0040268_1466_2482 332
452 3300037466 Ga0395898_0050997 Ga0395898_0050997_1658_2674 332
453 3300038443 Ga0395901_0042062 Ga0395901_0042062_2083_3099 332
454 3300005327 Ga0070658_10000359 Ga0070658_1000035919 333
455 3300005618 Ga0068864_100011366 Ga0068864_1000113663 334
456 3300014325 Ga0163163_10004929 Ga0163163_1000492912 334
457 3300026095 Ga0207676_10157383 Ga0207676_101573832 334
458 3300037068 Ga0373925_0011658 Ga0373925_0011658_2681_3688 334
459 3300046559 Ga0495667_0163211 Ga0495667_0163211_315_1322 334
460 3300049568 Ga0501031_0060385 Ga0501031_0060385_553_1566 334
461 3300049570 Ga0501033_0201672 Ga0501033_0201672_74_1087 334
462 3300049572 Ga0501036_0029536 Ga0501036_0029536_2301_3314 334
463 3300049575 Ga0501039_0086781 Ga0501039_0086781_620_1633 334
464 3300049578 Ga0501042_0039389 Ga0501042_0039389_368_1381 334
465 3300049587 Ga0501071_0023579 Ga0501071_0023579_2756_3769 334
466 3300049588 Ga0501072_0031709 Ga0501072_0031709_2048_3061 334
467 3300049590 Ga0501074_0098986 Ga0501074_0098986_394_1407 334
468 3300049591 Ga0501075_0057652 Ga0501075_0057652_66_1079 334
469 3300049592 Ga0501076_0047403 Ga0501076_0047403_135_1148 334
470 3300049593 Ga0501077_0076365 Ga0501077_0076365_346_1359 334
471 3300049741 Ga0501079_0068286 Ga0501079_0068286_414_1427 334
472 3300049824 Ga0501045_0041206 Ga0501045_0041206_1927_2940 334
473 3300053153 Ga0500616_0002749 Ga0500616_0002749_5406_6524 334
474 3300060353 Ga0501082_0078585 Ga0501082_0078585_368_1381 334
475 3300061734 Ga0530510_0036320 Ga0530510_0036320_2468_3481 334
476 iso_pu_bacteria 2818991458 2819668381 334
477 3300026067 Ga0207678_10207883 Ga0207678_102078832 335
478 3300048909 Ga0496106_0175836 Ga0496106_0175836_217_1227 335
479 3300048916 Ga0496113_0153015 Ga0496113_0153015_205_1221 335
480 iso_pu_bacteria 2818991318 2819428081 336
481 3300049576 Ga0501040_0034901 Ga0501040_0034901_323_1342 337
482 3300048915 Ga0496112_0149627 Ga0496112_0149627_168_1193 338
483 3300005535 Ga0070684_100028002 Ga0070684_1000280022 339
484 3300047321 Ga0495676_0188995 Ga0495676_0188995_370_1395 339
485 3300049568 Ga0501031_0002099 Ga0501031_0002099_7169_8191 339
486 3300049570 Ga0501033_0063409 Ga0501033_0063409_1423_2445 339
487 3300049572 Ga0501036_0002998 Ga0501036_0002998_10450_11472 339
488 3300049573 Ga0501037_0077793 Ga0501037_0077793_958_1980 339
489 3300049574 Ga0501038_0012377 Ga0501038_0012377_4373_5395 339
490 3300049575 Ga0501039_0003892 Ga0501039_0003892_3310_4332 339
491 3300049576 Ga0501040_0010694 Ga0501040_0010694_3483_4505 339
492 3300049577 Ga0501041_0028612 Ga0501041_0028612_52_1074 339
493 3300049578 Ga0501042_0030658 Ga0501042_0030658_972_1994 339
494 3300049579 Ga0501043_0039779 Ga0501043_0039779_2606_3628 339
495 3300049580 Ga0501046_0016295 Ga0501046_0016295_808_1830 339
496 3300049582 Ga0501048_0007085 Ga0501048_0007085_3104_4126 339
497 3300049584 Ga0501068_0079020 Ga0501068_0079020_693_1715 339
498 3300049585 Ga0501069_0039781 Ga0501069_0039781_1446_2477 339
499 3300049587 Ga0501071_0019782 Ga0501071_0019782_1906_2928 339
500 3300049588 Ga0501072_0045112 Ga0501072_0045112_578_1600 339
501 3300049590 Ga0501074_0004070 Ga0501074_0004070_6038_7060 339
502 3300049591 Ga0501075_0047228 Ga0501075_0047228_252_1274 339
503 3300049592 Ga0501076_0002222 Ga0501076_0002222_5001_6023 339
504 3300049741 Ga0501079_0002277 Ga0501079_0002277_5982_7004 339
505 3300049743 Ga0501081_0011026 Ga0501081_0011026_3070_4092 339
506 3300049822 Ga0501035_0027279 Ga0501035_0027279_2516_3538 339
507 3300049823 Ga0501044_0080169 Ga0501044_0080169_1161_2183 339
508 3300049824 Ga0501045_0012593 Ga0501045_0012593_3232_4254 339
509 3300060353 Ga0501082_0010723 Ga0501082_0010723_2286_3308 339
510 3300061734 Ga0530510_0004203 Ga0530510_0004203_1679_2701 339
511 3300005338 Ga0068868_100228617 Ga0068868_1002286171 340
512 3300022467 Ga0224712_10136344 Ga0224712_101363441 340
513 3300032126 Ga0307415_100252533 Ga0307415_1002525332 340
514 3300048903 Ga0496100_0089461 Ga0496100_0089461_552_1616 340
515 3300048904 Ga0496101_0094973 Ga0496101_0094973_201_1265 340
516 3300048906 Ga0496103_0021858 Ga0496103_0021858_1378_2442 340
517 3300048907 Ga0496104_0046549 Ga0496104_0046549_658_1728 340
518 3300048907 Ga0496104_0137102 Ga0496104_0137102_1265_2329 340
519 3300048909 Ga0496106_0167214 Ga0496106_0167214_52_1116 340
520 3300048910 Ga0496107_0011421 Ga0496107_0011421_4680_5744 340
521 3300048912 Ga0496109_0018589 Ga0496109_0018589_4934_5998 340
522 3300048912 Ga0496109_0264046 Ga0496109_0264046_367_1437 340
523 3300048914 Ga0496111_0182641 Ga0496111_0182641_63_1133 340
524 3300048915 Ga0496112_0204101 Ga0496112_0204101_501_1553 340
525 3300048916 Ga0496113_0065196 Ga0496113_0065196_1167_2237 340
526 3300048917 Ga0496114_0038736 Ga0496114_0038736_1943_3007 340
527 3300049584 Ga0501068_0065812 Ga0501068_0065812_178_1242 340
528 3300045976 Ga0466967_0292245 Ga0466967_0292245_210_1259 341
529 3300048908 Ga0496105_0109617 Ga0496105_0109617_863_1897 341
530 3300048917 Ga0496114_0322937 Ga0496114_0322937_280_1314 341
531 3300001979 JGI24740J21852_10025414 JGI24740J21852_100254142 342
532 3300004799 Ga0058863_10174367 Ga0058863_101743671 342
533 3300005336 Ga0070680_100236450 Ga0070680_1002364502 342
534 3300005435 Ga0070714_100004583 Ga0070714_1000045833 342
535 3300013307 Ga0157372_10282906 Ga0157372_102829062 342
536 3300020070 Ga0206356_11835610 Ga0206356_118356102 342
537 3300020075 Ga0206349_1614230 Ga0206349_16142301 342
538 3300025929 Ga0207664_10023522 Ga0207664_100235222 342
539 3300037418 Ga0395900_0051229 Ga0395900_0051229_952_2013 342
540 3300037466 Ga0395898_0019040 Ga0395898_0019040_2157_3218 342
541 3300037471 Ga0395905_0054506 Ga0395905_0054506_2359_3420 342
542 3300038443 Ga0395901_0141402 Ga0395901_0141402_1323_2384 342
543 3300046543 Ga0495645_0124538 Ga0495645_0124538_474_1565 342
544 3300046683 Ga0495658_0080652 Ga0495658_0080652_371_1417 342
545 3300049823 Ga0501044_0455422 Ga0501044_0455422_18_1148 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00676

E1_dh

Dehydrogenase E1 component

83

368

0.95

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

151

263

0.89

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

155

292

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly2.cif.gz_G human pyruvate dehydrogenase complex e1 component v138m mutation 0.9279 19 334
1x7z-assembly1.cif.gz_A-2 crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase 0.9276 16 340
6cer-assembly1.cif.gz_C human pyruvate dehydrogenase complex e1 component v138m mutation 0.9263 19 334
3exg-assembly4.cif.gz_O crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex 0.9261 19 334
2bff-assembly1.cif.gz_A-2 reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 0.9226 16 340
ID Description Score Start End Superfamily
af_A0A1D6GTY5_25_137_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9515 142 255 3.40.50.970
af_Q2FY52_1_330_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.938 19 340 3.40.50.970
af_F4KIN4_12_241_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9365 148 340 3.40.50.970
af_A0A1D6GTY5_25_137_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9274 142 255 3.40.50.970
af_B4FGJ4_23_381_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9212 19 341 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A2T2XDV0-F1-model_v4 Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha 0.9846 33 163 GO:0004739
GO:0006086
AF-A0A4Q9W2P6-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.98 73 279 GO:0004739
GO:0006086
AF-A0A151AI31-F1-model_v4 Dehydrogenase E1 component 0.9759 28 178 GO:0004739
GO:0006086
AF-A0A7T4UPU2-F1-model_v4 Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha 0.9752 19 341 GO:0004739
GO:0006086
AF-A0A059WH10-F1-model_v4 Dehydrogenase E1 component 0.972 60 285 GO:0004739
GO:0006086

Feature Viewer

pLDDT pTM Quality
91.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map