F461919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 545 | 306 | 526 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0455422|Ga0501044_0455422_18_1148 |
| Length | 376 |
| Sequence | VRRPLIQIKRAAAAAARLRQINSRRARLPRLGTSATNRSARVKPPAERLLWMYETMLLIRRYEETLAQVYLEGKLPPDIQAGLAFDIASGPVPGEMHLAAGQEPVAVGVCAHLGAEDTVVGTHRPHHFAIAKGVPLDRMTAEIFGKVTGLGRGKGGHMHLFDPEHRFSCSGIVGASLPPACGAALANKMRGSQAVAVAFFGEGAANQGTFHEALNLASLWRLPAVFVCEDNGWAISVAKQKATAVRSNAARAAAYGMEGARVEDNDPIAVFEAAGAAIRRAREGGGPTLLEVKTDRWFGHFQGDPEVYRPKTEVPQLRKNDPIQALRGLLRRRGILDDAKDAALQEAAAARVSAAIEYARASESPSPDEALQHVFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 3 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 4 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 5 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 6 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 7 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 8 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 9 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 10 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 11 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 12 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 13 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 14 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 15 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 130 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 131 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 132 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 133 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 137 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 138 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 144 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 149 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 169 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 170 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 171 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 172 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 173 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 176 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 177 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 293 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 294 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 296 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 299 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 303 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 304 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 305 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 306 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.23 |
| Metatranscriptomes | 1.28 |
| Isolates | 3.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.22 |
| Nodule | 0 |
| Rhizoplane | 8.81 |
| Rhizosphere | 83.12 |
| Stem | 0 |
| Stem Tuber | 0.18 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10025414 | 3300001979 | Bacteria | 1996 |
| 2 | JGI24739J22299_10001076 | 3300001989 | Bacteria | 10177 |
| 3 | JGI24737J22298_10002127 | 3300001990 | Bacteria | 7057 |
| 4 | JGI24735J21928_10029712 | 3300002067 | Bacteria | 1626 |
| 5 | JGI25406J46586_10004744 | 3300003203 | Bacteria | 6318 |
| 6 | rootH2_10113468 | 3300003320 | Bacteria | 1594 |
| 7 | rootL2_10148238 | 3300003322 | Bacteria | 3611 |
| 8 | rootL2_10344459 | 3300003322 | Bacteria | 1573 |
| 9 | rootH1_10159430 | 3300003323 | Bacteria | 2864 |
| 10 | Ga0055529_1002807 | 3300003763 | Bacteria | 3152 |
| 11 | Ga0055531_10000625 | 3300003794 | Bacteria | 30551 |
| 12 | Ga0055531_10014077 | 3300003794 | Bacteria | 3632 |
| 13 | Ga0058863_10174367 | 3300004799 | Bacteria | 1361 |
| 14 | Ga0070658_10000359 | 3300005327 | Bacteria | 39682 |
| 15 | Ga0070658_10027659 | 3300005327 | Bacteria | 4549 |
| 16 | Ga0070683_100183311 | 3300005329 | Bacteria | 1987 |
| 17 | Ga0070670_100069755 | 3300005331 | Bacteria | 3018 |
| 18 | Ga0070666_10000024 | 3300005335 | Bacteria | 161355 |
| 19 | Ga0070680_100005203 | 3300005336 | Bacteria | 9841 |
| 20 | Ga0070680_100091440 | 3300005336 | Bacteria | 2519 |
| 21 | Ga0070680_100236450 | 3300005336 | Bacteria | 1543 |
| 22 | Ga0068868_100228617 | 3300005338 | Bacteria | 1560 |
| 23 | Ga0070661_100069701 | 3300005344 | Bacteria | 2585 |
| 24 | Ga0070668_100021462 | 3300005347 | Bacteria | 4879 |
| 25 | Ga0070669_100038187 | 3300005353 | Bacteria | 3486 |
| 26 | Ga0070667_100145659 | 3300005367 | Bacteria | 2077 |
| 27 | Ga0070709_10001996 | 3300005434 | Bacteria | 11106 |
| 28 | Ga0070714_100004583 | 3300005435 | Bacteria | 10423 |
| 29 | Ga0070714_100122468 | 3300005435 | Bacteria | 2315 |
| 30 | Ga0070714_100265244 | 3300005435 | Bacteria | 1591 |
| 31 | Ga0070713_100002844 | 3300005436 | Bacteria | 11319 |
| 32 | Ga0070710_10069517 | 3300005437 | Bacteria | 2026 |
| 33 | Ga0070705_100065804 | 3300005440 | Bacteria | 2171 |
| 34 | Ga0070708_100003698 | 3300005445 | Bacteria | 11991 |
| 35 | Ga0070706_100002705 | 3300005467 | Bacteria | 17737 |
| 36 | Ga0070706_100011416 | 3300005467 | Bacteria | 8253 |
| 37 | Ga0070707_100030492 | 3300005468 | Bacteria | 5134 |
| 38 | Ga0070707_100087156 | 3300005468 | Bacteria | 3020 |
| 39 | Ga0070679_100258733 | 3300005530 | Bacteria | 1696 |
| 40 | Ga0070684_100028002 | 3300005535 | Bacteria | 4763 |
| 41 | Ga0070672_100208754 | 3300005543 | Bacteria | 1635 |
| 42 | Ga0070696_100091525 | 3300005546 | Bacteria | 2166 |
| 43 | Ga0068855_100011303 | 3300005563 | Bacteria | 10780 |
| 44 | Ga0070664_100033648 | 3300005564 | Bacteria | 4295 |
| 45 | Ga0068857_100057683 | 3300005577 | Bacteria | 3446 |
| 46 | Ga0068857_100337337 | 3300005577 | Bacteria | 1394 |
| 47 | Ga0068854_100078672 | 3300005578 | Bacteria | 2430 |
| 48 | Ga0068856_100016257 | 3300005614 | Bacteria | 7199 |
| 49 | Ga0068856_100069074 | 3300005614 | Bacteria | 3493 |
| 50 | Ga0068864_100011366 | 3300005618 | Bacteria | 7357 |
| 51 | Ga0068861_100094499 | 3300005719 | Unclassified | 2366 |
| 52 | Ga0068863_100085245 | 3300005841 | Bacteria | 2994 |
| 53 | Ga0068863_100100708 | 3300005841 | Bacteria | 2746 |
| 54 | Ga0081540_1000070 | 3300005983 | Bacteria | 111392 |
| 55 | Ga0081539_10000756 | 3300005985 | Bacteria | 64265 |
| 56 | Ga0070717_10364854 | 3300006028 | Bacteria | 1293 |
| 57 | Ga0070715_10013103 | 3300006163 | Bacteria | 3036 |
| 58 | Ga0097621_100023930 | 3300006237 | Bacteria | 4761 |
| 59 | Ga0097621_100104987 | 3300006237 | Bacteria | 2381 |
| 60 | Ga0075434_100047605 | 3300006871 | Bacteria | 4255 |
| 61 | Ga0075435_100101822 | 3300007076 | Bacteria | 2380 |
| 62 | Ga0075435_100215726 | 3300007076 | Bacteria | 1628 |
| 63 | Ga0099794_10025272 | 3300007265 | Bacteria | 2734 |
| 64 | Ga0105244_10076485 | 3300009036 | Bacteria | 1662 |
| 65 | Ga0105250_10034177 | 3300009092 | Bacteria | 2041 |
| 66 | Ga0105240_10069069 | 3300009093 | Bacteria | 4374 |
| 67 | Ga0105240_10195420 | 3300009093 | Bacteria | 2376 |
| 68 | Ga0105245_10025798 | 3300009098 | Bacteria | 5169 |
| 69 | Ga0105245_10097784 | 3300009098 | Bacteria | 2711 |
| 70 | Ga0105245_10154695 | 3300009098 | Bacteria | 2171 |
| 71 | Ga0114129_10013562 | 3300009147 | Bacteria | 11612 |
| 72 | Ga0114129_10020859 | 3300009147 | Bacteria | 9309 |
| 73 | Ga0105241_10041754 | 3300009174 | Bacteria | 3467 |
| 74 | Ga0105242_10199980 | 3300009176 | Bacteria | 1774 |
| 75 | Ga0105248_10183135 | 3300009177 | Bacteria | 2360 |
| 76 | Ga0105237_10194879 | 3300009545 | Bacteria | 2026 |
| 77 | Ga0105238_10267618 | 3300009551 | Bacteria | 1689 |
| 78 | Ga0105249_10010274 | 3300009553 | Bacteria | 8222 |
| 79 | Ga0157370_10004246 | 3300013104 | Bacteria | 16554 |
| 80 | Ga0157370_10147161 | 3300013104 | Bacteria | 2193 |
| 81 | Ga0157369_10062328 | 3300013105 | Bacteria | 4019 |
| 82 | Ga0157374_10000412 | 3300013296 | Bacteria | 38781 |
| 83 | Ga0163162_10011755 | 3300013306 | Bacteria | 8539 |
| 84 | Ga0163162_10178099 | 3300013306 | Bacteria | 2252 |
| 85 | Ga0157372_10282906 | 3300013307 | Bacteria | 1928 |
| 86 | Ga0157372_10349549 | 3300013307 | Bacteria | 1722 |
| 87 | Ga0157375_10025617 | 3300013308 | Bacteria | 5485 |
| 88 | Ga0163163_10004929 | 3300014325 | Bacteria | 11482 |
| 89 | Ga0157380_10272880 | 3300014326 | Bacteria | 1543 |
| 90 | Ga0157379_10000595 | 3300014968 | Bacteria | 29273 |
| 91 | Ga0157379_10108751 | 3300014968 | Bacteria | 2490 |
| 92 | Ga0157376_10005066 | 3300014969 | Bacteria | 9191 |
| 93 | Ga0157376_10049561 | 3300014969 | Bacteria | 3479 |
| 94 | Ga0163161_10241890 | 3300017792 | Bacteria | 1404 |
| 95 | Ga0206356_11835610 | 3300020070 | Bacteria | 1521 |
| 96 | Ga0206349_1614230 | 3300020075 | Bacteria | 1624 |
| 97 | Ga0206351_10093362 | 3300020077 | Bacteria | 1358 |
| 98 | Ga0206354_10898310 | 3300020081 | Bacteria | 1383 |
| 99 | Ga0224712_10136344 | 3300022467 | Bacteria | 1076 |
| 100 | Ga0209148_1000920 | 3300025254 | Bacteria | 19634 |
| 101 | Ga0209455_1001257 | 3300025272 | Bacteria | 11896 |
| 102 | Ga0209050_1005166 | 3300025298 | Bacteria | 8359 |
| 103 | Ga0209051_1000078 | 3300025303 | Bacteria | 201965 |
| 104 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 105 | Ga0209257_1002037 | 3300025304 | Bacteria | 21530 |
| 106 | Ga0209257_1007974 | 3300025304 | Bacteria | 6194 |
| 107 | Ga0207655_1064747 | 3300025728 | Bacteria | 1392 |
| 108 | Ga0207692_10022436 | 3300025898 | Bacteria | 2904 |
| 109 | Ga0207692_10055634 | 3300025898 | Bacteria | 2026 |
| 110 | Ga0207647_10020780 | 3300025904 | Bacteria | 4397 |
| 111 | Ga0207699_10007582 | 3300025906 | Bacteria | 5312 |
| 112 | Ga0207699_10016958 | 3300025906 | Bacteria | 3822 |
| 113 | Ga0207684_10001819 | 3300025910 | Bacteria | 22280 |
| 114 | Ga0207684_10044060 | 3300025910 | Bacteria | 3784 |
| 115 | Ga0207654_10034099 | 3300025911 | Bacteria | 2826 |
| 116 | Ga0207693_10021819 | 3300025915 | Bacteria | 5092 |
| 117 | Ga0207660_10045821 | 3300025917 | Bacteria | 3083 |
| 118 | Ga0207657_10040476 | 3300025919 | Bacteria | 4129 |
| 119 | Ga0207646_10039662 | 3300025922 | Bacteria | 4238 |
| 120 | Ga0207646_10292260 | 3300025922 | Bacteria | 1473 |
| 121 | Ga0207650_10198109 | 3300025925 | Bacteria | 1607 |
| 122 | Ga0207659_10024861 | 3300025926 | Bacteria | 4020 |
| 123 | Ga0207687_10089183 | 3300025927 | Bacteria | 2245 |
| 124 | Ga0207700_10077355 | 3300025928 | Bacteria | 2584 |
| 125 | Ga0207664_10006658 | 3300025929 | Bacteria | 7964 |
| 126 | Ga0207664_10023522 | 3300025929 | Bacteria | 4618 |
| 127 | Ga0207661_10017030 | 3300025944 | Bacteria | 5368 |
| 128 | Ga0207679_10021940 | 3300025945 | Bacteria | 4339 |
| 129 | Ga0207667_10005945 | 3300025949 | Bacteria | 14859 |
| 130 | Ga0207668_10038263 | 3300025972 | Bacteria | 3218 |
| 131 | Ga0207677_10120599 | 3300026023 | Bacteria | 1972 |
| 132 | Ga0207639_10235726 | 3300026041 | Bacteria | 1589 |
| 133 | Ga0207678_10207883 | 3300026067 | Bacteria | 1674 |
| 134 | Ga0207702_10004539 | 3300026078 | Bacteria | 12304 |
| 135 | Ga0207641_10005846 | 3300026088 | Bacteria | 10439 |
| 136 | Ga0207641_10020773 | 3300026088 | Bacteria | 5397 |
| 137 | Ga0207641_10107703 | 3300026088 | Bacteria | 2465 |
| 138 | Ga0207641_10201317 | 3300026088 | Bacteria | 1836 |
| 139 | Ga0207676_10157383 | 3300026095 | Bacteria | 1964 |
| 140 | Ga0207674_10023156 | 3300026116 | Bacteria | 6659 |
| 141 | Ga0207674_10093828 | 3300026116 | Bacteria | 2989 |
| 142 | Ga0209974_10027691 | 3300027876 | Bacteria | 1875 |
| 143 | Ga0268266_10014137 | 3300028379 | Bacteria | 6869 |
| 144 | Ga0307515_10009264 | 3300028794 | Bacteria | 19057 |
| 145 | Ga0265327_10040353 | 3300031251 | Bacteria | 2526 |
| 146 | Ga0307513_10002444 | 3300031456 | Bacteria | 25765 |
| 147 | Ga0307513_10024629 | 3300031456 | Bacteria | 6997 |
| 148 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 149 | Ga0316575_10053284 | 3300031665 | Bacteria | 1611 |
| 150 | Ga0316576_10086574 | 3300031727 | Bacteria | 2330 |
| 151 | Ga0316578_10011028 | 3300031728 | Bacteria | 4709 |
| 152 | Ga0307516_10000124 | 3300031730 | Bacteria | 90831 |
| 153 | Ga0316577_10004706 | 3300031733 | Bacteria | 7086 |
| 154 | Ga0307413_10194410 | 3300031824 | Bacteria | 1459 |
| 155 | Ga0307415_100252533 | 3300032126 | Bacteria | 1434 |
| 156 | Ga0316585_10019216 | 3300032137 | Bacteria | 2081 |
| 157 | Ga0307510_10000005 | 3300033180 | Bacteria | 633068 |
| 158 | Ga0373959_0004769 | 3300034820 | Bacteria | 2202 |
| 159 | Ga0373934_0000130 | 3300035086 | Bacteria | 27677 |
| 160 | Ga0373934_0004921 | 3300035086 | Bacteria | 4945 |
| 161 | Ga0373940_0004805 | 3300035088 | Bacteria | 2881 |
| 162 | Ga0373951_0013589 | 3300035091 | Bacteria | 1829 |
| 163 | Ga0373923_0006523 | 3300035111 | Bacteria | 4041 |
| 164 | Ga0373939_0004318 | 3300035114 | Bacteria | 3357 |
| 165 | Ga0373945_0026495 | 3300035116 | Bacteria | 2019 |
| 166 | Ga0373953_0002767 | 3300035117 | Bacteria | 5330 |
| 167 | Ga0373953_0007839 | 3300035117 | Bacteria | 3598 |
| 168 | Ga0373954_0002741 | 3300035118 | Bacteria | 7414 |
| 169 | Ga0373954_0080653 | 3300035118 | Bacteria | 1554 |
| 170 | Ga0373956_0005031 | 3300035119 | Bacteria | 5298 |
| 171 | Ga0373957_0000470 | 3300035120 | Bacteria | 10181 |
| 172 | Ga0373960_0006967 | 3300035121 | Bacteria | 2666 |
| 173 | Ga0373943_0124430 | 3300035170 | Bacteria | 1373 |
| 174 | Ga0373946_0023049 | 3300035171 | Bacteria | 2429 |
| 175 | Ga0373955_0000232 | 3300035172 | Bacteria | 23186 |
| 176 | Ga0373955_0003806 | 3300035172 | Bacteria | 6645 |
| 177 | Ga0373955_0026220 | 3300035172 | Bacteria | 3000 |
| 178 | Ga0373962_0010931 | 3300035242 | Bacteria | 2270 |
| 179 | Ga0316574_0204878 | 3300035398 | Bacteria | 1266 |
| 180 | Ga0373924_0001616 | 3300035410 | Bacteria | 7391 |
| 181 | Ga0373924_0039634 | 3300035410 | Bacteria | 1925 |
| 182 | Ga0373931_0007792 | 3300035691 | Bacteria | 5059 |
| 183 | Ga0373935_0091660 | 3300035692 | Bacteria | 1990 |
| 184 | Ga0373927_0066748 | 3300035695 | Bacteria | 2327 |
| 185 | Ga0373933_0000056 | 3300035724 | Bacteria | 66983 |
| 186 | Ga0373933_0030617 | 3300035724 | Bacteria | 3116 |
| 187 | Ga0373933_0151355 | 3300035724 | Bacteria | 1469 |
| 188 | Ga0373937_0000152 | 3300036401 | Bacteria | 66956 |
| 189 | Ga0373937_0036797 | 3300036401 | Bacteria | 4460 |
| 190 | Ga0373937_0126816 | 3300036401 | Bacteria | 2381 |
| 191 | Ga0316584_0045244 | 3300036712 | Bacteria | 3285 |
| 192 | Ga0316584_0062949 | 3300036712 | Bacteria | 2778 |
| 193 | Ga0373925_0011658 | 3300037068 | Bacteria | 6357 |
| 194 | Ga0373925_0096926 | 3300037068 | Bacteria | 2261 |
| 195 | Ga0395899_0001479 | 3300037312 | Bacteria | 19996 |
| 196 | Ga0395899_0004051 | 3300037312 | Bacteria | 11556 |
| 197 | Ga0395899_0040268 | 3300037312 | Bacteria | 3495 |
| 198 | Ga0395899_0233407 | 3300037312 | Bacteria | 1269 |
| 199 | Ga0395900_0000021 | 3300037418 | Bacteria | 351144 |
| 200 | Ga0395900_0033580 | 3300037418 | Bacteria | 5280 |
| 201 | Ga0395900_0051229 | 3300037418 | Bacteria | 4253 |
| 202 | Ga0395898_0001024 | 3300037466 | Bacteria | 43550 |
| 203 | Ga0395898_0014460 | 3300037466 | Bacteria | 8106 |
| 204 | Ga0395898_0019040 | 3300037466 | Bacteria | 6990 |
| 205 | Ga0395898_0050997 | 3300037466 | Bacteria | 4047 |
| 206 | Ga0395905_0000551 | 3300037471 | Bacteria | 51169 |
| 207 | Ga0395905_0006370 | 3300037471 | Bacteria | 11895 |
| 208 | Ga0395905_0054506 | 3300037471 | Bacteria | 3742 |
| 209 | Ga0395901_0013399 | 3300038443 | Bacteria | 8333 |
| 210 | Ga0395901_0042062 | 3300038443 | Bacteria | 4736 |
| 211 | Ga0395901_0141402 | 3300038443 | Bacteria | 2529 |
| 212 | Ga0400483_155706 | 3300039062 | Bacteria | 2398 |
| 213 | Ga0439436_0000469 | 3300041404 | Bacteria | 10388 |
| 214 | Ga0439436_0027719 | 3300041404 | Bacteria | 1656 |
| 215 | Ga0439438_000423 | 3300041405 | Bacteria | 19119 |
| 216 | Ga0439447_000080 | 3300041407 | Bacteria | 34054 |
| 217 | Ga0439466_0008067 | 3300041411 | Bacteria | 3970 |
| 218 | Ga0439466_0034649 | 3300041411 | Bacteria | 1711 |
| 219 | Ga0451804_0502709 | 3300041463 | Bacteria | 834 |
| 220 | Ga0439449_0109484 | 3300042007 | Bacteria | 1023 |
| 221 | Ga0439462_0007240 | 3300042015 | Bacteria | 2774 |
| 222 | Ga0439434_0000994 | 3300042435 | Bacteria | 8185 |
| 223 | Ga0466972_0000396 | 3300044658 | Bacteria | 23138 |
| 224 | Ga0466967_0292245 | 3300045976 | Bacteria | 1566 |
| 225 | Ga0495592_0000129 | 3300046454 | Bacteria | 66962 |
| 226 | Ga0495592_0030087 | 3300046454 | Bacteria | 4106 |
| 227 | Ga0495603_0010644 | 3300046455 | Bacteria | 5576 |
| 228 | Ga0495629_0063082 | 3300046459 | Bacteria | 2587 |
| 229 | Ga0495629_0112761 | 3300046459 | Bacteria | 1895 |
| 230 | Ga0495638_0116275 | 3300046460 | Bacteria | 1584 |
| 231 | Ga0495638_0140811 | 3300046460 | Bacteria | 1408 |
| 232 | Ga0495641_0032123 | 3300046461 | Bacteria | 2501 |
| 233 | Ga0495641_0038294 | 3300046461 | Bacteria | 2240 |
| 234 | Ga0495651_0000089 | 3300046462 | Bacteria | 66983 |
| 235 | Ga0495651_0012375 | 3300046462 | Bacteria | 6577 |
| 236 | Ga0495651_0022915 | 3300046462 | Bacteria | 4856 |
| 237 | Ga0495653_0036492 | 3300046463 | Bacteria | 3871 |
| 238 | Ga0495653_0088381 | 3300046463 | Bacteria | 2273 |
| 239 | Ga0495653_0227023 | 3300046463 | Bacteria | 1252 |
| 240 | Ga0495580_0070186 | 3300046472 | Bacteria | 2447 |
| 241 | Ga0495582_0037468 | 3300046473 | Bacteria | 2667 |
| 242 | Ga0495639_0051000 | 3300046475 | Bacteria | 1880 |
| 243 | Ga0495639_0120861 | 3300046475 | Bacteria | 1249 |
| 244 | Ga0495662_0061955 | 3300046476 | Bacteria | 1807 |
| 245 | Ga0495664_0008812 | 3300046477 | Bacteria | 5635 |
| 246 | Ga0495608_0000086 | 3300046511 | Bacteria | 67464 |
| 247 | Ga0495608_0189849 | 3300046511 | Bacteria | 1297 |
| 248 | Ga0495610_0015125 | 3300046512 | Bacteria | 4499 |
| 249 | Ga0495618_0025866 | 3300046514 | Bacteria | 3645 |
| 250 | Ga0495620_0002623 | 3300046515 | Bacteria | 10405 |
| 251 | Ga0495628_0003130 | 3300046516 | Bacteria | 14861 |
| 252 | Ga0495630_0048631 | 3300046517 | Bacteria | 3174 |
| 253 | Ga0495630_0105434 | 3300046517 | Bacteria | 2134 |
| 254 | Ga0495632_0021591 | 3300046519 | Bacteria | 3467 |
| 255 | Ga0495648_0151239 | 3300046524 | Bacteria | 1211 |
| 256 | Ga0495666_0137397 | 3300046526 | Bacteria | 1140 |
| 257 | Ga0495652_0000221 | 3300046529 | Bacteria | 66315 |
| 258 | Ga0495652_0069917 | 3300046529 | Bacteria | 2936 |
| 259 | Ga0495652_0090260 | 3300046529 | Bacteria | 2507 |
| 260 | Ga0495654_0001503 | 3300046530 | Bacteria | 15943 |
| 261 | Ga0495665_0006230 | 3300046531 | Bacteria | 6438 |
| 262 | Ga0495640_0027380 | 3300046533 | Bacteria | 4111 |
| 263 | Ga0495640_0114213 | 3300046533 | Bacteria | 1761 |
| 264 | Ga0495586_0007075 | 3300046535 | Bacteria | 5981 |
| 265 | Ga0495586_0115192 | 3300046535 | Bacteria | 1498 |
| 266 | Ga0495587_0000099 | 3300046536 | Bacteria | 67448 |
| 267 | Ga0495587_0008394 | 3300046536 | Bacteria | 6646 |
| 268 | Ga0495609_0011191 | 3300046538 | Bacteria | 4281 |
| 269 | Ga0495645_0033608 | 3300046543 | Bacteria | 3741 |
| 270 | Ga0495645_0101453 | 3300046543 | Bacteria | 2046 |
| 271 | Ga0495645_0124538 | 3300046543 | Bacteria | 1812 |
| 272 | Ga0495667_0000088 | 3300046559 | Bacteria | 66785 |
| 273 | Ga0495667_0073525 | 3300046559 | Bacteria | 2226 |
| 274 | Ga0495667_0163211 | 3300046559 | Bacteria | 1433 |
| 275 | Ga0495667_0215162 | 3300046559 | Bacteria | 1227 |
| 276 | Ga0495634_0030721 | 3300046642 | Bacteria | 3706 |
| 277 | Ga0495634_0066946 | 3300046642 | Bacteria | 2377 |
| 278 | Ga0495634_0124610 | 3300046642 | Bacteria | 1647 |
| 279 | Ga0495635_0006553 | 3300046663 | Bacteria | 8125 |
| 280 | Ga0495657_0000130 | 3300046675 | Bacteria | 66983 |
| 281 | Ga0495657_0008081 | 3300046675 | Bacteria | 8068 |
| 282 | Ga0495599_0000190 | 3300046678 | Bacteria | 40649 |
| 283 | Ga0495623_0006721 | 3300046679 | Bacteria | 7486 |
| 284 | Ga0495623_0020925 | 3300046679 | Bacteria | 4226 |
| 285 | Ga0495623_0058929 | 3300046679 | Bacteria | 2413 |
| 286 | Ga0495646_0022185 | 3300046680 | Bacteria | 4005 |
| 287 | Ga0495646_0029377 | 3300046680 | Bacteria | 3436 |
| 288 | Ga0495647_0026697 | 3300046681 | Bacteria | 2117 |
| 289 | Ga0495658_0016791 | 3300046683 | Bacteria | 3772 |
| 290 | Ga0495658_0037020 | 3300046683 | Bacteria | 2695 |
| 291 | Ga0495658_0080652 | 3300046683 | Bacteria | 1909 |
| 292 | Ga0495669_0227676 | 3300046684 | Bacteria | 894 |
| 293 | Ga0495613_0084744 | 3300046689 | Bacteria | 2300 |
| 294 | Ga0495613_0158095 | 3300046689 | Bacteria | 1613 |
| 295 | Ga0495624_0053832 | 3300046690 | Bacteria | 2539 |
| 296 | Ga0495624_0157992 | 3300046690 | Bacteria | 1385 |
| 297 | Ga0495670_0000622 | 3300046691 | Bacteria | 16978 |
| 298 | Ga0495671_0034947 | 3300046692 | Bacteria | 2554 |
| 299 | Ga0495649_0189123 | 3300046694 | Bacteria | 1072 |
| 300 | Ga0495600_0031134 | 3300046809 | Bacteria | 3455 |
| 301 | Ga0495600_0105635 | 3300046809 | Bacteria | 1835 |
| 302 | Ga0495600_0166927 | 3300046809 | Bacteria | 1421 |
| 303 | Ga0495600_0188147 | 3300046809 | Unclassified | 1329 |
| 304 | Ga0495581_0016108 | 3300047315 | Bacteria | 4345 |
| 305 | Ga0495581_0037108 | 3300047315 | Bacteria | 2819 |
| 306 | Ga0495604_0000117 | 3300047317 | Bacteria | 66983 |
| 307 | Ga0495604_0060316 | 3300047317 | Bacteria | 2906 |
| 308 | Ga0495674_0023556 | 3300047319 | Bacteria | 5673 |
| 309 | Ga0495674_0114496 | 3300047319 | Bacteria | 2283 |
| 310 | Ga0495674_0149407 | 3300047319 | Bacteria | 1960 |
| 311 | Ga0495672_0002434 | 3300047320 | Bacteria | 17144 |
| 312 | Ga0495672_0010322 | 3300047320 | Bacteria | 6670 |
| 313 | Ga0495676_0188995 | 3300047321 | Bacteria | 1438 |
| 314 | Ga0495680_0004248 | 3300047322 | Bacteria | 13751 |
| 315 | Ga0495680_0104902 | 3300047322 | Bacteria | 2102 |
| 316 | Ga0495680_0144936 | 3300047322 | Bacteria | 1735 |
| 317 | Ga0495675_0007540 | 3300047444 | Bacteria | 6706 |
| 318 | Ga0495675_0020240 | 3300047444 | Bacteria | 4230 |
| 319 | Ga0495684_0078599 | 3300047471 | Bacteria | 2504 |
| 320 | Ga0495684_0084616 | 3300047471 | Unclassified | 2406 |
| 321 | Ga0495684_0093931 | 3300047471 | Bacteria | 2271 |
| 322 | Ga0495593_0045507 | 3300047673 | Bacteria | 2341 |
| 323 | Ga0495602_0000424 | 3300048088 | Bacteria | 39603 |
| 324 | Ga0495602_0042960 | 3300048088 | Bacteria | 4114 |
| 325 | Ga0495602_0085854 | 3300048088 | Bacteria | 2628 |
| 326 | Ga0496100_0009470 | 3300048903 | Bacteria | 5473 |
| 327 | Ga0496100_0020777 | 3300048903 | Bacteria | 3943 |
| 328 | Ga0496100_0089461 | 3300048903 | Bacteria | 2097 |
| 329 | Ga0496101_0011202 | 3300048904 | Bacteria | 5942 |
| 330 | Ga0496101_0094973 | 3300048904 | Bacteria | 2223 |
| 331 | Ga0496101_0115232 | 3300048904 | Bacteria | 2027 |
| 332 | Ga0496102_0001941 | 3300048905 | Bacteria | 17816 |
| 333 | Ga0496102_0153248 | 3300048905 | Bacteria | 2166 |
| 334 | Ga0496102_0376887 | 3300048905 | Bacteria | 1335 |
| 335 | Ga0496103_0006316 | 3300048906 | Bacteria | 7084 |
| 336 | Ga0496103_0021858 | 3300048906 | Bacteria | 3850 |
| 337 | Ga0496104_0031584 | 3300048907 | Bacteria | 4926 |
| 338 | Ga0496104_0031597 | 3300048907 | Bacteria | 4924 |
| 339 | Ga0496104_0046549 | 3300048907 | Bacteria | 4085 |
| 340 | Ga0496104_0137102 | 3300048907 | Bacteria | 2351 |
| 341 | Ga0496104_0213825 | 3300048907 | Bacteria | 1840 |
| 342 | Ga0496105_0011011 | 3300048908 | Bacteria | 7128 |
| 343 | Ga0496105_0109617 | 3300048908 | Bacteria | 2279 |
| 344 | Ga0496105_0381728 | 3300048908 | Bacteria | 1121 |
| 345 | Ga0496106_0020846 | 3300048909 | Bacteria | 4864 |
| 346 | Ga0496106_0167214 | 3300048909 | Bacteria | 1741 |
| 347 | Ga0496106_0175836 | 3300048909 | Bacteria | 1698 |
| 348 | Ga0496106_0313086 | 3300048909 | Bacteria | 1260 |
| 349 | Ga0496107_0011421 | 3300048910 | Bacteria | 6186 |
| 350 | Ga0496107_0037990 | 3300048910 | Bacteria | 3456 |
| 351 | Ga0496108_0151947 | 3300048911 | Bacteria | 1998 |
| 352 | Ga0496109_0018589 | 3300048912 | Bacteria | 6106 |
| 353 | Ga0496109_0264046 | 3300048912 | Bacteria | 1622 |
| 354 | Ga0496109_0318551 | 3300048912 | Bacteria | 1467 |
| 355 | Ga0496110_0164211 | 3300048913 | Bacteria | 2013 |
| 356 | Ga0496111_0182641 | 3300048914 | Bacteria | 1559 |
| 357 | Ga0496112_0035671 | 3300048915 | Bacteria | 4847 |
| 358 | Ga0496112_0118298 | 3300048915 | Bacteria | 2620 |
| 359 | Ga0496112_0149627 | 3300048915 | Bacteria | 2302 |
| 360 | Ga0496112_0169299 | 3300048915 | Bacteria | 2150 |
| 361 | Ga0496112_0204101 | 3300048915 | Bacteria | 1935 |
| 362 | Ga0496113_0052722 | 3300048916 | Bacteria | 3039 |
| 363 | Ga0496113_0065196 | 3300048916 | Bacteria | 2756 |
| 364 | Ga0496113_0153015 | 3300048916 | Bacteria | 1821 |
| 365 | Ga0496113_0460087 | 3300048916 | Bacteria | 1022 |
| 366 | Ga0496114_0000881 | 3300048917 | Bacteria | 22473 |
| 367 | Ga0496114_0022499 | 3300048917 | Bacteria | 5138 |
| 368 | Ga0496114_0038736 | 3300048917 | Bacteria | 3944 |
| 369 | Ga0496114_0136177 | 3300048917 | Bacteria | 2124 |
| 370 | Ga0496114_0260276 | 3300048917 | Bacteria | 1527 |
| 371 | Ga0496114_0322937 | 3300048917 | Bacteria | 1364 |
| 372 | Ga0496115_0244214 | 3300048918 | Bacteria | 1479 |
| 373 | Ga0496125_0009117 | 3300048928 | Bacteria | 10263 |
| 374 | Ga0495682_0015816 | 3300049460 | Bacteria | 2857 |
| 375 | Ga0501312_008033 | 3300049528 | Bacteria | 1361 |
| 376 | Ga0501031_0001766 | 3300049568 | Bacteria | 13562 |
| 377 | Ga0501031_0002099 | 3300049568 | Bacteria | 12563 |
| 378 | Ga0501031_0060385 | 3300049568 | Bacteria | 2471 |
| 379 | Ga0501032_0018468 | 3300049569 | Bacteria | 4885 |
| 380 | Ga0501032_0241860 | 3300049569 | Bacteria | 1172 |
| 381 | Ga0501033_0063409 | 3300049570 | Bacteria | 2720 |
| 382 | Ga0501033_0201672 | 3300049570 | Bacteria | 1421 |
| 383 | Ga0501034_0009097 | 3300049571 | Bacteria | 10433 |
| 384 | Ga0501034_0040541 | 3300049571 | Bacteria | 4713 |
| 385 | Ga0501036_0002998 | 3300049572 | Bacteria | 13432 |
| 386 | Ga0501036_0007365 | 3300049572 | Bacteria | 8968 |
| 387 | Ga0501036_0014768 | 3300049572 | Bacteria | 6514 |
| 388 | Ga0501036_0029536 | 3300049572 | Bacteria | 4631 |
| 389 | Ga0501036_0042236 | 3300049572 | Bacteria | 3861 |
| 390 | Ga0501036_0073975 | 3300049572 | Bacteria | 2881 |
| 391 | Ga0501036_0084349 | 3300049572 | Bacteria | 2686 |
| 392 | Ga0501037_0012789 | 3300049573 | Bacteria | 6184 |
| 393 | Ga0501037_0026963 | 3300049573 | Bacteria | 4245 |
| 394 | Ga0501037_0043477 | 3300049573 | Bacteria | 3301 |
| 395 | Ga0501037_0077793 | 3300049573 | Bacteria | 2407 |
| 396 | Ga0501037_0280107 | 3300049573 | Bacteria | 1162 |
| 397 | Ga0501038_0001209 | 3300049574 | Bacteria | 23407 |
| 398 | Ga0501038_0012377 | 3300049574 | Bacteria | 7798 |
| 399 | Ga0501038_0060494 | 3300049574 | Bacteria | 3242 |
| 400 | Ga0501038_0145494 | 3300049574 | Bacteria | 1935 |
| 401 | Ga0501039_0003892 | 3300049575 | Bacteria | 11208 |
| 402 | Ga0501039_0051877 | 3300049575 | Bacteria | 3173 |
| 403 | Ga0501039_0086781 | 3300049575 | Bacteria | 2437 |
| 404 | Ga0501039_0185688 | 3300049575 | Bacteria | 1635 |
| 405 | Ga0501040_0000014 | 3300049576 | Archaea | 76174 |
| 406 | Ga0501040_0007863 | 3300049576 | Bacteria | 6910 |
| 407 | Ga0501040_0010694 | 3300049576 | Bacteria | 6001 |
| 408 | Ga0501040_0034901 | 3300049576 | Bacteria | 3409 |
| 409 | Ga0501040_0039399 | 3300049576 | Bacteria | 3213 |
| 410 | Ga0501040_0067975 | 3300049576 | Bacteria | 2457 |
| 411 | Ga0501040_0078626 | 3300049576 | Bacteria | 2282 |
| 412 | Ga0501040_0299843 | 3300049576 | Archaea | 1149 |
| 413 | Ga0501041_0001368 | 3300049577 | Bacteria | 13457 |
| 414 | Ga0501041_0026616 | 3300049577 | Bacteria | 3480 |
| 415 | Ga0501041_0028612 | 3300049577 | Bacteria | 3361 |
| 416 | Ga0501042_0006968 | 3300049578 | Bacteria | 7375 |
| 417 | Ga0501042_0016652 | 3300049578 | Bacteria | 5052 |
| 418 | Ga0501042_0022756 | 3300049578 | Bacteria | 4379 |
| 419 | Ga0501042_0030658 | 3300049578 | Bacteria | 3800 |
| 420 | Ga0501042_0039389 | 3300049578 | Bacteria | 3358 |
| 421 | Ga0501042_0252104 | 3300049578 | Bacteria | 1274 |
| 422 | Ga0501043_0008874 | 3300049579 | Bacteria | 7911 |
| 423 | Ga0501043_0031354 | 3300049579 | Bacteria | 4179 |
| 424 | Ga0501043_0039779 | 3300049579 | Bacteria | 3696 |
| 425 | Ga0501043_0096590 | 3300049579 | Bacteria | 2322 |
| 426 | Ga0501043_0145685 | 3300049579 | Bacteria | 1854 |
| 427 | Ga0501046_0010232 | 3300049580 | Bacteria | 8071 |
| 428 | Ga0501046_0016295 | 3300049580 | Bacteria | 6229 |
| 429 | Ga0501046_0122606 | 3300049580 | Bacteria | 1977 |
| 430 | Ga0501046_0217300 | 3300049580 | Bacteria | 1417 |
| 431 | Ga0501047_0019820 | 3300049581 | Bacteria | 6455 |
| 432 | Ga0501047_0448880 | 3300049581 | Bacteria | 1119 |
| 433 | Ga0501048_0005060 | 3300049582 | Bacteria | 10047 |
| 434 | Ga0501048_0006036 | 3300049582 | Bacteria | 9225 |
| 435 | Ga0501048_0007085 | 3300049582 | Bacteria | 8515 |
| 436 | Ga0501068_0065812 | 3300049584 | Bacteria | 2207 |
| 437 | Ga0501068_0079020 | 3300049584 | Bacteria | 2017 |
| 438 | Ga0501069_0039781 | 3300049585 | Bacteria | 2598 |
| 439 | Ga0501069_0045706 | 3300049585 | Bacteria | 2426 |
| 440 | Ga0501071_0007540 | 3300049587 | Bacteria | 7159 |
| 441 | Ga0501071_0019782 | 3300049587 | Bacteria | 4674 |
| 442 | Ga0501071_0023579 | 3300049587 | Bacteria | 4298 |
| 443 | Ga0501071_0129588 | 3300049587 | Bacteria | 1873 |
| 444 | Ga0501071_0196153 | 3300049587 | Bacteria | 1516 |
| 445 | Ga0501072_0031709 | 3300049588 | Bacteria | 4139 |
| 446 | Ga0501072_0045112 | 3300049588 | Bacteria | 3465 |
| 447 | Ga0501072_0048592 | 3300049588 | Bacteria | 3341 |
| 448 | Ga0501072_0104872 | 3300049588 | Bacteria | 2248 |
| 449 | Ga0501073_0023822 | 3300049589 | Bacteria | 4396 |
| 450 | Ga0501073_0033373 | 3300049589 | Bacteria | 3665 |
| 451 | Ga0501074_0001599 | 3300049590 | Bacteria | 15367 |
| 452 | Ga0501074_0004070 | 3300049590 | Bacteria | 10431 |
| 453 | Ga0501074_0009651 | 3300049590 | Bacteria | 7005 |
| 454 | Ga0501074_0014129 | 3300049590 | Bacteria | 5805 |
| 455 | Ga0501074_0098986 | 3300049590 | Bacteria | 2087 |
| 456 | Ga0501075_0047228 | 3300049591 | Bacteria | 3235 |
| 457 | Ga0501075_0057652 | 3300049591 | Bacteria | 2924 |
| 458 | Ga0501075_0068126 | 3300049591 | Bacteria | 2688 |
| 459 | Ga0501075_0120944 | 3300049591 | Bacteria | 1993 |
| 460 | Ga0501075_0244211 | 3300049591 | Bacteria | 1369 |
| 461 | Ga0501076_0002222 | 3300049592 | Bacteria | 13300 |
| 462 | Ga0501076_0047403 | 3300049592 | Bacteria | 3397 |
| 463 | Ga0501076_0160425 | 3300049592 | Bacteria | 1832 |
| 464 | Ga0501077_0047832 | 3300049593 | Bacteria | 2717 |
| 465 | Ga0501077_0076365 | 3300049593 | Bacteria | 2122 |
| 466 | Ga0501079_0002277 | 3300049741 | Bacteria | 13860 |
| 467 | Ga0501079_0068286 | 3300049741 | Bacteria | 2744 |
| 468 | Ga0501079_0194308 | 3300049741 | Bacteria | 1584 |
| 469 | Ga0501079_0223030 | 3300049741 | Bacteria | 1473 |
| 470 | Ga0501080_0098558 | 3300049742 | Bacteria | 2713 |
| 471 | Ga0501080_0560882 | 3300049742 | Bacteria | 1017 |
| 472 | Ga0501081_0008633 | 3300049743 | Bacteria | 6619 |
| 473 | Ga0501081_0011026 | 3300049743 | Bacteria | 5910 |
| 474 | Ga0501081_0053212 | 3300049743 | Bacteria | 2795 |
| 475 | Ga0501081_0183230 | 3300049743 | Bacteria | 1515 |
| 476 | Ga0501083_0046497 | 3300049744 | Bacteria | 2934 |
| 477 | Ga0501035_0027279 | 3300049822 | Bacteria | 5220 |
| 478 | Ga0501035_0030510 | 3300049822 | Bacteria | 4913 |
| 479 | Ga0501044_0006290 | 3300049823 | Bacteria | 13124 |
| 480 | Ga0501044_0036424 | 3300049823 | Bacteria | 5148 |
| 481 | Ga0501044_0080169 | 3300049823 | Bacteria | 3307 |
| 482 | Ga0501044_0086489 | 3300049823 | Bacteria | 3167 |
| 483 | Ga0501044_0146296 | 3300049823 | Bacteria | 2348 |
| 484 | Ga0501044_0364425 | 3300049823 | Bacteria | 1363 |
| 485 | Ga0501044_0455422 | 3300049823 | Bacteria | 1185 |
| 486 | Ga0501045_0004554 | 3300049824 | Bacteria | 9576 |
| 487 | Ga0501045_0012593 | 3300049824 | Bacteria | 5954 |
| 488 | Ga0501045_0029334 | 3300049824 | Bacteria | 3976 |
| 489 | Ga0501045_0041206 | 3300049824 | Bacteria | 3360 |
| 490 | Ga0501045_0046908 | 3300049824 | Bacteria | 3146 |
| 491 | Ga0501045_0069052 | 3300049824 | Bacteria | 2597 |
| 492 | nmdc:mga0n895_124803_c1 | 3300050512 | Bacteria | 2598 |
| 493 | nmdc:mga0n895_56920_c1 | 3300050512 | Bacteria | 3854 |
| 494 | nmdc:mga0rr50_29731_c1 | 3300050513 | Bacteria | 3858 |
| 495 | nmdc:mga0rr50_32571_c1 | 3300050513 | Bacteria | 3715 |
| 496 | nmdc:mga0a205_22836_c1 | 3300050515 | Bacteria | 5931 |
| 497 | Ga0495612_0026636 | 3300053078 | Bacteria | 2323 |
| 498 | Ga0495595_0020497 | 3300053084 | Bacteria | 2878 |
| 499 | Ga0495595_0063047 | 3300053084 | Bacteria | 1739 |
| 500 | Ga0495619_0045575 | 3300053085 | Bacteria | 2881 |
| 501 | Ga0495619_0050130 | 3300053085 | Bacteria | 2755 |
| 502 | Ga0500643_000603 | 3300053087 | Bacteria | 24488 |
| 503 | Ga0500644_0017847 | 3300053088 | Bacteria | 2068 |
| 504 | Ga0500583_0053884 | 3300053092 | Bacteria | 1877 |
| 505 | Ga0500651_0115914 | 3300053093 | Bacteria | 1631 |
| 506 | Ga0500568_0000220 | 3300053139 | Bacteria | 48991 |
| 507 | Ga0500568_0011394 | 3300053139 | Bacteria | 4131 |
| 508 | Ga0500588_0028308 | 3300053146 | Bacteria | 1588 |
| 509 | Ga0500604_0000016 | 3300053151 | Bacteria | 91519 |
| 510 | Ga0500616_0000142 | 3300053153 | Bacteria | 122026 |
| 511 | Ga0500616_0002749 | 3300053153 | Bacteria | 14222 |
| 512 | Ga0500622_0005299 | 3300053156 | Bacteria | 7780 |
| 513 | Ga0500622_0012327 | 3300053156 | Bacteria | 4630 |
| 514 | Ga0500587_002760 | 3300053739 | Bacteria | 2481 |
| 515 | Ga0501084_0008104 | 3300054114 | Bacteria | 8655 |
| 516 | Ga0501084_0032643 | 3300054114 | Bacteria | 4354 |
| 517 | Ga0501084_0047595 | 3300054114 | Bacteria | 3591 |
| 518 | Ga0501084_0158563 | 3300054114 | Bacteria | 1909 |
| 519 | Ga0501082_0003368 | 3300060353 | Bacteria | 13950 |
| 520 | Ga0501082_0010723 | 3300060353 | Bacteria | 7886 |
| 521 | Ga0501082_0035992 | 3300060353 | Bacteria | 4265 |
| 522 | Ga0501082_0078585 | 3300060353 | Bacteria | 2846 |
| 523 | Ga0530510_0004203 | 3300061734 | Bacteria | 9952 |
| 524 | Ga0530510_0012282 | 3300061734 | Bacteria | 6012 |
| 525 | Ga0530510_0036320 | 3300061734 | Bacteria | 3552 |
| 526 | Ga0530510_0067307 | 3300061734 | Bacteria | 2598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041463 | Ga0451804_0502709 | Ga0451804_0502709_58_819 | 241 |
| 2 | 3300049581 | Ga0501047_0448880 | Ga0501047_0448880_264_1097 | 265 |
| 3 | 3300046684 | Ga0495669_0227676 | Ga0495669_0227676_26_877 | 278 |
| 4 | 3300036401 | Ga0373937_0126816 | Ga0373937_0126816_1523_2362 | 279 |
| 5 | 3300050513 | nmdc:mga0rr50_29731_c1 | nmdc:mga0rr50_29731_c1_11_850 | 279 |
| 6 | 3300020077 | Ga0206351_10093362 | Ga0206351_100933622 | 286 |
| 7 | 3300049574 | Ga0501038_0060494 | Ga0501038_0060494_2332_3231 | 287 |
| 8 | 3300009147 | Ga0114129_10020859 | Ga0114129_1002085912 | 288 |
| 9 | 3300048909 | Ga0496106_0020846 | Ga0496106_0020846_3919_4845 | 293 |
| 10 | 3300005331 | Ga0070670_100069755 | Ga0070670_1000697551 | 295 |
| 11 | 3300049589 | Ga0501073_0033373 | Ga0501073_0033373_2286_3233 | 297 |
| 12 | 3300049823 | Ga0501044_0146296 | Ga0501044_0146296_908_1855 | 297 |
| 13 | 3300007265 | Ga0099794_10025272 | Ga0099794_100252722 | 299 |
| 14 | 3300048916 | Ga0496113_0460087 | Ga0496113_0460087_23_961 | 299 |
| 15 | 3300053139 | Ga0500568_0000220 | Ga0500568_0000220_21399_22352 | 299 |
| 16 | 3300053153 | Ga0500616_0000142 | Ga0500616_0000142_83836_84789 | 299 |
| 17 | 3300054114 | Ga0501084_0047595 | Ga0501084_0047595_2670_3578 | 302 |
| 18 | 3300005543 | Ga0070672_100208754 | Ga0070672_1002087541 | 303 |
| 19 | 3300006237 | Ga0097621_100023930 | Ga0097621_1000239304 | 303 |
| 20 | 3300009553 | Ga0105249_10010274 | Ga0105249_100102747 | 303 |
| 21 | 3300014968 | Ga0157379_10108751 | Ga0157379_101087512 | 303 |
| 22 | 3300014969 | Ga0157376_10005066 | Ga0157376_100050669 | 303 |
| 23 | 3300014969 | Ga0157376_10049561 | Ga0157376_100495613 | 303 |
| 24 | 3300025304 | Ga0209257_1002037 | Ga0209257_100203710 | 303 |
| 25 | 3300025926 | Ga0207659_10024861 | Ga0207659_100248614 | 303 |
| 26 | 3300035724 | Ga0373933_0151355 | Ga0373933_0151355_342_1289 | 303 |
| 27 | 3300041404 | Ga0439436_0027719 | Ga0439436_0027719_424_1371 | 303 |
| 28 | 3300042007 | Ga0439449_0109484 | Ga0439449_0109484_62_1009 | 303 |
| 29 | 3300042015 | Ga0439462_0007240 | Ga0439462_0007240_1543_2490 | 303 |
| 30 | 3300044658 | Ga0466972_0000396 | Ga0466972_0000396_26_973 | 303 |
| 31 | 3300046460 | Ga0495638_0140811 | Ga0495638_0140811_157_1104 | 303 |
| 32 | 3300046517 | Ga0495630_0048631 | Ga0495630_0048631_65_1012 | 303 |
| 33 | 3300046533 | Ga0495640_0114213 | Ga0495640_0114213_80_1027 | 303 |
| 34 | 3300046535 | Ga0495586_0007075 | Ga0495586_0007075_2360_3307 | 303 |
| 35 | 3300046642 | Ga0495634_0066946 | Ga0495634_0066946_232_1179 | 303 |
| 36 | 3300046683 | Ga0495658_0016791 | Ga0495658_0016791_1490_2437 | 303 |
| 37 | 3300046694 | Ga0495649_0189123 | Ga0495649_0189123_35_982 | 303 |
| 38 | 3300046809 | Ga0495600_0188147 | Ga0495600_0188147_164_1111 | 303 |
| 39 | 3300047319 | Ga0495674_0023556 | Ga0495674_0023556_624_1571 | 303 |
| 40 | 3300047471 | Ga0495684_0084616 | Ga0495684_0084616_260_1207 | 303 |
| 41 | 3300049528 | Ga0501312_008033 | Ga0501312_008033_108_1055 | 303 |
| 42 | 3300049569 | Ga0501032_0241860 | Ga0501032_0241860_112_1059 | 303 |
| 43 | 3300049571 | Ga0501034_0009097 | Ga0501034_0009097_7967_8914 | 303 |
| 44 | 3300049572 | Ga0501036_0014768 | Ga0501036_0014768_5163_6110 | 303 |
| 45 | 3300049573 | Ga0501037_0012789 | Ga0501037_0012789_1470_2417 | 303 |
| 46 | 3300049579 | Ga0501043_0096590 | Ga0501043_0096590_625_1572 | 303 |
| 47 | 3300049580 | Ga0501046_0217300 | Ga0501046_0217300_149_1096 | 303 |
| 48 | 3300049822 | Ga0501035_0030510 | Ga0501035_0030510_1836_2783 | 303 |
| 49 | 3300049823 | Ga0501044_0006290 | Ga0501044_0006290_7968_8915 | 303 |
| 50 | 3300053085 | Ga0495619_0050130 | Ga0495619_0050130_1682_2629 | 303 |
| 51 | 3300049576 | Ga0501040_0000014 | Ga0501040_0000014_61400_62446 | 304 |
| 52 | 3300053739 | Ga0500587_002760 | Ga0500587_002760_609_1562 | 304 |
| 53 | 3300005367 | Ga0070667_100145659 | Ga0070667_1001456592 | 305 |
| 54 | 3300006237 | Ga0097621_100104987 | Ga0097621_1001049872 | 305 |
| 55 | 3300009098 | Ga0105245_10097784 | Ga0105245_100977842 | 305 |
| 56 | 3300009174 | Ga0105241_10041754 | Ga0105241_100417541 | 305 |
| 57 | 3300009177 | Ga0105248_10183135 | Ga0105248_101831353 | 305 |
| 58 | 3300009545 | Ga0105237_10194879 | Ga0105237_101948792 | 305 |
| 59 | 3300013306 | Ga0163162_10178099 | Ga0163162_101780992 | 305 |
| 60 | 3300014968 | Ga0157379_10000595 | Ga0157379_1000059523 | 305 |
| 61 | 3300048905 | Ga0496102_0001941 | Ga0496102_0001941_15684_16646 | 305 |
| 62 | 3300048906 | Ga0496103_0006316 | Ga0496103_0006316_5088_6050 | 305 |
| 63 | 3300025911 | Ga0207654_10034099 | Ga0207654_100340992 | 306 |
| 64 | 3300046692 | Ga0495671_0034947 | Ga0495671_0034947_617_1615 | 306 |
| 65 | 3300048904 | Ga0496101_0115232 | Ga0496101_0115232_742_1704 | 306 |
| 66 | 3300048907 | Ga0496104_0031584 | Ga0496104_0031584_1366_2328 | 306 |
| 67 | 3300026088 | Ga0207641_10005846 | Ga0207641_100058465 | 307 |
| 68 | 3300031456 | Ga0307513_10024629 | Ga0307513_100246296 | 307 |
| 69 | 3300003203 | JGI25406J46586_10004744 | JGI25406J46586_100047445 | 308 |
| 70 | 3300005985 | Ga0081539_10000756 | Ga0081539_1000075631 | 308 |
| 71 | 3300014326 | Ga0157380_10272880 | Ga0157380_102728801 | 308 |
| 72 | 3300046460 | Ga0495638_0116275 | Ga0495638_0116275_519_1517 | 309 |
| 73 | 3300053146 | Ga0500588_0028308 | Ga0500588_0028308_225_1223 | 309 |
| 74 | 3300005445 | Ga0070708_100003698 | Ga0070708_1000036987 | 311 |
| 75 | 3300005467 | Ga0070706_100011416 | Ga0070706_1000114162 | 311 |
| 76 | 3300005468 | Ga0070707_100087156 | Ga0070707_1000871563 | 311 |
| 77 | 3300025910 | Ga0207684_10044060 | Ga0207684_100440603 | 311 |
| 78 | 3300025922 | Ga0207646_10292260 | Ga0207646_102922601 | 311 |
| 79 | 3300005841 | Ga0068863_100085245 | Ga0068863_1000852452 | 312 |
| 80 | 3300009098 | Ga0105245_10154695 | Ga0105245_101546952 | 312 |
| 81 | 3300013296 | Ga0157374_10000412 | Ga0157374_100004126 | 312 |
| 82 | 3300013306 | Ga0163162_10011755 | Ga0163162_100117555 | 312 |
| 83 | 3300026088 | Ga0207641_10201317 | Ga0207641_102013172 | 312 |
| 84 | 3300037466 | Ga0395898_0014460 | Ga0395898_0014460_6515_7462 | 312 |
| 85 | 3300046459 | Ga0495629_0112761 | Ga0495629_0112761_400_1338 | 312 |
| 86 | 3300046463 | Ga0495653_0088381 | Ga0495653_0088381_1055_1993 | 312 |
| 87 | 3300046475 | Ga0495639_0051000 | Ga0495639_0051000_243_1181 | 312 |
| 88 | 3300046511 | Ga0495608_0189849 | Ga0495608_0189849_341_1279 | 312 |
| 89 | 3300046526 | Ga0495666_0137397 | Ga0495666_0137397_14_952 | 312 |
| 90 | 3300046535 | Ga0495586_0115192 | Ga0495586_0115192_120_1058 | 312 |
| 91 | 3300046559 | Ga0495667_0073525 | Ga0495667_0073525_726_1664 | 312 |
| 92 | 3300048903 | Ga0496100_0009470 | Ga0496100_0009470_1298_2275 | 312 |
| 93 | 3300048908 | Ga0496105_0381728 | Ga0496105_0381728_134_1111 | 312 |
| 94 | 3300048915 | Ga0496112_0118298 | Ga0496112_0118298_117_1094 | 312 |
| 95 | 3300048918 | Ga0496115_0244214 | Ga0496115_0244214_25_963 | 312 |
| 96 | 3300049572 | Ga0501036_0073975 | Ga0501036_0073975_1720_2658 | 312 |
| 97 | 3300049576 | Ga0501040_0078626 | Ga0501040_0078626_1314_2252 | 312 |
| 98 | 3300049587 | Ga0501071_0196153 | Ga0501071_0196153_43_981 | 312 |
| 99 | 3300049741 | Ga0501079_0223030 | Ga0501079_0223030_266_1204 | 312 |
| 100 | 3300049743 | Ga0501081_0183230 | Ga0501081_0183230_16_957 | 312 |
| 101 | 3300049823 | Ga0501044_0364425 | Ga0501044_0364425_227_1165 | 312 |
| 102 | 3300049824 | Ga0501045_0046908 | Ga0501045_0046908_1872_2810 | 312 |
| 103 | 3300053084 | Ga0495595_0063047 | Ga0495595_0063047_539_1477 | 312 |
| 104 | 3300005467 | Ga0070706_100002705 | Ga0070706_10000270515 | 313 |
| 105 | 3300005468 | Ga0070707_100030492 | Ga0070707_1000304925 | 313 |
| 106 | 3300025910 | Ga0207684_10001819 | Ga0207684_100018193 | 313 |
| 107 | 3300025922 | Ga0207646_10039662 | Ga0207646_100396622 | 313 |
| 108 | 3300039062 | Ga0400483_155706 | Ga0400483_155706_943_1917 | 313 |
| 109 | 3300046809 | Ga0495600_0105635 | Ga0495600_0105635_416_1426 | 313 |
| 110 | 3300005563 | Ga0068855_100011303 | Ga0068855_1000113035 | 314 |
| 111 | 3300005841 | Ga0068863_100100708 | Ga0068863_1001007082 | 314 |
| 112 | 3300009093 | Ga0105240_10195420 | Ga0105240_101954202 | 314 |
| 113 | 3300013104 | Ga0157370_10147161 | Ga0157370_101471613 | 314 |
| 114 | 3300025949 | Ga0207667_10005945 | Ga0207667_100059453 | 314 |
| 115 | 3300003794 | Ga0055531_10014077 | Ga0055531_100140773 | 315 |
| 116 | 3300009093 | Ga0105240_10069069 | Ga0105240_100690692 | 315 |
| 117 | 3300025298 | Ga0209050_1005166 | Ga0209050_10051665 | 315 |
| 118 | 3300025304 | Ga0209257_1007974 | Ga0209257_10079747 | 315 |
| 119 | 3300026088 | Ga0207641_10107703 | Ga0207641_101077032 | 315 |
| 120 | 3300046519 | Ga0495632_0021591 | Ga0495632_0021591_1197_2162 | 315 |
| 121 | 3300053093 | Ga0500651_0115914 | Ga0500651_0115914_494_1447 | 315 |
| 122 | 3300053156 | Ga0500622_0012327 | Ga0500622_0012327_846_1799 | 315 |
| 123 | 3300005335 | Ga0070666_10000024 | Ga0070666_1000002441 | 316 |
| 124 | 3300005353 | Ga0070669_100038187 | Ga0070669_1000381874 | 316 |
| 125 | 3300049742 | Ga0501080_0098558 | Ga0501080_0098558_154_1149 | 316 |
| 126 | 3300049742 | Ga0501080_0560882 | Ga0501080_0560882_18_992 | 316 |
| 127 | 3300031665 | Ga0316575_10053284 | Ga0316575_100532842 | 318 |
| 128 | 3300037312 | Ga0395899_0001479 | Ga0395899_0001479_18181_19167 | 318 |
| 129 | 3300037418 | Ga0395900_0033580 | Ga0395900_0033580_3026_4012 | 318 |
| 130 | 3300037471 | Ga0395905_0006370 | Ga0395905_0006370_9337_10323 | 318 |
| 131 | 3300049588 | Ga0501072_0104872 | Ga0501072_0104872_644_1609 | 318 |
| 132 | 3300003322 | rootL2_10148238 | rootL2_101482382 | 319 |
| 133 | 3300031727 | Ga0316576_10086574 | Ga0316576_100865742 | 319 |
| 134 | 3300036712 | Ga0316584_0062949 | Ga0316584_0062949_159_1154 | 319 |
| 135 | iso_pu_bacteria | 2899370129 | 2899372459 | 320 |
| 136 | iso_pu_bacteria | 2917736166 | 2917742495 | 320 |
| 137 | 3300005719 | Ga0068861_100094499 | Ga0068861_1000944991 | 321 |
| 138 | iso_pu_bacteria | 2881644220 | 2881646829 | 321 |
| 139 | 3300005336 | Ga0070680_100005203 | Ga0070680_1000052038 | 322 |
| 140 | iso_pu_bacteria | 2643221645 | 2644252021 | 322 |
| 141 | 3300048911 | Ga0496108_0151947 | Ga0496108_0151947_944_1966 | 323 |
| 142 | 3300049576 | Ga0501040_0299843 | Ga0501040_0299843_58_1083 | 323 |
| 143 | iso_pu_bacteria | 2728369097 | 2729146872 | 323 |
| 144 | iso_pu_bacteria | 2738543004 | 2739201655 | 323 |
| 145 | iso_pu_bacteria | 2738543015 | 2739262456 | 323 |
| 146 | iso_pu_bacteria | 2744054611 | 2744954560 | 323 |
| 147 | iso_pu_bacteria | 651053060 | 651176885 | 323 |
| 148 | iso_pu_bacteria | 8011350971 | 8011351461 | 323 |
| 149 | 3300003320 | rootH2_10113468 | rootH2_101134682 | 324 |
| 150 | 3300003322 | rootL2_10344459 | rootL2_103444592 | 324 |
| 151 | 3300003323 | rootH1_10159430 | rootH1_101594302 | 324 |
| 152 | 3300005327 | Ga0070658_10027659 | Ga0070658_100276593 | 324 |
| 153 | 3300005329 | Ga0070683_100183311 | Ga0070683_1001833112 | 324 |
| 154 | 3300005336 | Ga0070680_100091440 | Ga0070680_1000914402 | 324 |
| 155 | 3300005344 | Ga0070661_100069701 | Ga0070661_1000697012 | 324 |
| 156 | 3300005434 | Ga0070709_10001996 | Ga0070709_1000199612 | 324 |
| 157 | 3300005435 | Ga0070714_100122468 | Ga0070714_1001224682 | 324 |
| 158 | 3300005435 | Ga0070714_100265244 | Ga0070714_1002652442 | 324 |
| 159 | 3300005436 | Ga0070713_100002844 | Ga0070713_1000028447 | 324 |
| 160 | 3300005437 | Ga0070710_10069517 | Ga0070710_100695172 | 324 |
| 161 | 3300005440 | Ga0070705_100065804 | Ga0070705_1000658042 | 324 |
| 162 | 3300005530 | Ga0070679_100258733 | Ga0070679_1002587331 | 324 |
| 163 | 3300005546 | Ga0070696_100091525 | Ga0070696_1000915252 | 324 |
| 164 | 3300005564 | Ga0070664_100033648 | Ga0070664_1000336485 | 324 |
| 165 | 3300005577 | Ga0068857_100057683 | Ga0068857_1000576832 | 324 |
| 166 | 3300005578 | Ga0068854_100078672 | Ga0068854_1000786722 | 324 |
| 167 | 3300005614 | Ga0068856_100016257 | Ga0068856_1000162577 | 324 |
| 168 | 3300005614 | Ga0068856_100069074 | Ga0068856_1000690742 | 324 |
| 169 | 3300005983 | Ga0081540_1000070 | Ga0081540_100007028 | 324 |
| 170 | 3300006028 | Ga0070717_10364854 | Ga0070717_103648542 | 324 |
| 171 | 3300006163 | Ga0070715_10013103 | Ga0070715_100131034 | 324 |
| 172 | 3300006871 | Ga0075434_100047605 | Ga0075434_1000476055 | 324 |
| 173 | 3300007076 | Ga0075435_100101822 | Ga0075435_1001018222 | 324 |
| 174 | 3300007076 | Ga0075435_100215726 | Ga0075435_1002157261 | 324 |
| 175 | 3300009147 | Ga0114129_10013562 | Ga0114129_100135624 | 324 |
| 176 | 3300013105 | Ga0157369_10062328 | Ga0157369_100623284 | 324 |
| 177 | 3300013307 | Ga0157372_10349549 | Ga0157372_103495491 | 324 |
| 178 | 3300020081 | Ga0206354_10898310 | Ga0206354_108983102 | 324 |
| 179 | 3300025898 | Ga0207692_10022436 | Ga0207692_100224362 | 324 |
| 180 | 3300025898 | Ga0207692_10055634 | Ga0207692_100556341 | 324 |
| 181 | 3300025906 | Ga0207699_10007582 | Ga0207699_100075825 | 324 |
| 182 | 3300025906 | Ga0207699_10016958 | Ga0207699_100169583 | 324 |
| 183 | 3300025915 | Ga0207693_10021819 | Ga0207693_100218193 | 324 |
| 184 | 3300025917 | Ga0207660_10045821 | Ga0207660_100458212 | 324 |
| 185 | 3300025919 | Ga0207657_10040476 | Ga0207657_100404763 | 324 |
| 186 | 3300025925 | Ga0207650_10198109 | Ga0207650_101981092 | 324 |
| 187 | 3300025928 | Ga0207700_10077355 | Ga0207700_100773552 | 324 |
| 188 | 3300025929 | Ga0207664_10006658 | Ga0207664_100066584 | 324 |
| 189 | 3300025944 | Ga0207661_10017030 | Ga0207661_100170306 | 324 |
| 190 | 3300025945 | Ga0207679_10021940 | Ga0207679_100219403 | 324 |
| 191 | 3300026023 | Ga0207677_10120599 | Ga0207677_101205992 | 324 |
| 192 | 3300026078 | Ga0207702_10004539 | Ga0207702_1000453910 | 324 |
| 193 | 3300026116 | Ga0207674_10093828 | Ga0207674_100938282 | 324 |
| 194 | 3300028379 | Ga0268266_10014137 | Ga0268266_100141377 | 324 |
| 195 | 3300028794 | Ga0307515_10009264 | Ga0307515_1000926417 | 324 |
| 196 | 3300031507 | Ga0307509_10000003 | Ga0307509_10000003275 | 324 |
| 197 | 3300031730 | Ga0307516_10000124 | Ga0307516_1000012429 | 324 |
| 198 | 3300033180 | Ga0307510_10000005 | Ga0307510_10000005126 | 324 |
| 199 | 3300034820 | Ga0373959_0004769 | Ga0373959_0004769_104_1078 | 324 |
| 200 | 3300035086 | Ga0373934_0000130 | Ga0373934_0000130_1032_2006 | 324 |
| 201 | 3300035086 | Ga0373934_0004921 | Ga0373934_0004921_2538_3512 | 324 |
| 202 | 3300035088 | Ga0373940_0004805 | Ga0373940_0004805_1136_2110 | 324 |
| 203 | 3300035091 | Ga0373951_0013589 | Ga0373951_0013589_207_1181 | 324 |
| 204 | 3300035111 | Ga0373923_0006523 | Ga0373923_0006523_1065_2039 | 324 |
| 205 | 3300035114 | Ga0373939_0004318 | Ga0373939_0004318_759_1733 | 324 |
| 206 | 3300035116 | Ga0373945_0026495 | Ga0373945_0026495_16_990 | 324 |
| 207 | 3300035117 | Ga0373953_0002767 | Ga0373953_0002767_1074_2048 | 324 |
| 208 | 3300035117 | Ga0373953_0007839 | Ga0373953_0007839_1454_2428 | 324 |
| 209 | 3300035118 | Ga0373954_0002741 | Ga0373954_0002741_5963_6937 | 324 |
| 210 | 3300035118 | Ga0373954_0080653 | Ga0373954_0080653_269_1243 | 324 |
| 211 | 3300035119 | Ga0373956_0005031 | Ga0373956_0005031_2923_3897 | 324 |
| 212 | 3300035120 | Ga0373957_0000470 | Ga0373957_0000470_7809_8783 | 324 |
| 213 | 3300035121 | Ga0373960_0006967 | Ga0373960_0006967_396_1370 | 324 |
| 214 | 3300035170 | Ga0373943_0124430 | Ga0373943_0124430_65_1039 | 324 |
| 215 | 3300035171 | Ga0373946_0023049 | Ga0373946_0023049_713_1687 | 324 |
| 216 | 3300035172 | Ga0373955_0000232 | Ga0373955_0000232_20786_21760 | 324 |
| 217 | 3300035172 | Ga0373955_0003806 | Ga0373955_0003806_1971_2945 | 324 |
| 218 | 3300035172 | Ga0373955_0026220 | Ga0373955_0026220_299_1273 | 324 |
| 219 | 3300035242 | Ga0373962_0010931 | Ga0373962_0010931_1116_2090 | 324 |
| 220 | 3300035410 | Ga0373924_0001616 | Ga0373924_0001616_1400_2374 | 324 |
| 221 | 3300035410 | Ga0373924_0039634 | Ga0373924_0039634_342_1316 | 324 |
| 222 | 3300035691 | Ga0373931_0007792 | Ga0373931_0007792_2966_3940 | 324 |
| 223 | 3300035692 | Ga0373935_0091660 | Ga0373935_0091660_371_1345 | 324 |
| 224 | 3300035695 | Ga0373927_0066748 | Ga0373927_0066748_402_1376 | 324 |
| 225 | 3300035724 | Ga0373933_0000056 | Ga0373933_0000056_1427_2401 | 324 |
| 226 | 3300035724 | Ga0373933_0030617 | Ga0373933_0030617_410_1384 | 324 |
| 227 | 3300036401 | Ga0373937_0000152 | Ga0373937_0000152_1400_2374 | 324 |
| 228 | 3300036401 | Ga0373937_0036797 | Ga0373937_0036797_1955_2929 | 324 |
| 229 | 3300037068 | Ga0373925_0096926 | Ga0373925_0096926_277_1251 | 324 |
| 230 | 3300046454 | Ga0495592_0000129 | Ga0495592_0000129_64583_65557 | 324 |
| 231 | 3300046454 | Ga0495592_0030087 | Ga0495592_0030087_1366_2340 | 324 |
| 232 | 3300046455 | Ga0495603_0010644 | Ga0495603_0010644_371_1345 | 324 |
| 233 | 3300046459 | Ga0495629_0063082 | Ga0495629_0063082_400_1374 | 324 |
| 234 | 3300046461 | Ga0495641_0032123 | Ga0495641_0032123_346_1320 | 324 |
| 235 | 3300046461 | Ga0495641_0038294 | Ga0495641_0038294_574_1548 | 324 |
| 236 | 3300046462 | Ga0495651_0000089 | Ga0495651_0000089_1427_2401 | 324 |
| 237 | 3300046462 | Ga0495651_0012375 | Ga0495651_0012375_2785_3759 | 324 |
| 238 | 3300046462 | Ga0495651_0022915 | Ga0495651_0022915_1893_2867 | 324 |
| 239 | 3300046463 | Ga0495653_0036492 | Ga0495653_0036492_1407_2381 | 324 |
| 240 | 3300046472 | Ga0495580_0070186 | Ga0495580_0070186_960_1934 | 324 |
| 241 | 3300046473 | Ga0495582_0037468 | Ga0495582_0037468_987_1961 | 324 |
| 242 | 3300046475 | Ga0495639_0120861 | Ga0495639_0120861_221_1195 | 324 |
| 243 | 3300046476 | Ga0495662_0061955 | Ga0495662_0061955_726_1700 | 324 |
| 244 | 3300046477 | Ga0495664_0008812 | Ga0495664_0008812_410_1384 | 324 |
| 245 | 3300046511 | Ga0495608_0000086 | Ga0495608_0000086_1423_2397 | 324 |
| 246 | 3300046514 | Ga0495618_0025866 | Ga0495618_0025866_2577_3551 | 324 |
| 247 | 3300046516 | Ga0495628_0003130 | Ga0495628_0003130_12511_13485 | 324 |
| 248 | 3300046517 | Ga0495630_0105434 | Ga0495630_0105434_26_1000 | 324 |
| 249 | 3300046529 | Ga0495652_0000221 | Ga0495652_0000221_1427_2401 | 324 |
| 250 | 3300046529 | Ga0495652_0069917 | Ga0495652_0069917_1514_2488 | 324 |
| 251 | 3300046529 | Ga0495652_0090260 | Ga0495652_0090260_1013_1987 | 324 |
| 252 | 3300046531 | Ga0495665_0006230 | Ga0495665_0006230_356_1330 | 324 |
| 253 | 3300046533 | Ga0495640_0027380 | Ga0495640_0027380_485_1459 | 324 |
| 254 | 3300046536 | Ga0495587_0000099 | Ga0495587_0000099_1407_2381 | 324 |
| 255 | 3300046536 | Ga0495587_0008394 | Ga0495587_0008394_5224_6198 | 324 |
| 256 | 3300046543 | Ga0495645_0033608 | Ga0495645_0033608_1067_2041 | 324 |
| 257 | 3300046543 | Ga0495645_0101453 | Ga0495645_0101453_341_1315 | 324 |
| 258 | 3300046559 | Ga0495667_0000088 | Ga0495667_0000088_64413_65387 | 324 |
| 259 | 3300046559 | Ga0495667_0215162 | Ga0495667_0215162_159_1133 | 324 |
| 260 | 3300046642 | Ga0495634_0030721 | Ga0495634_0030721_1211_2185 | 324 |
| 261 | 3300046642 | Ga0495634_0124610 | Ga0495634_0124610_25_999 | 324 |
| 262 | 3300046663 | Ga0495635_0006553 | Ga0495635_0006553_595_1569 | 324 |
| 263 | 3300046675 | Ga0495657_0000130 | Ga0495657_0000130_64583_65557 | 324 |
| 264 | 3300046675 | Ga0495657_0008081 | Ga0495657_0008081_838_1812 | 324 |
| 265 | 3300046678 | Ga0495599_0000190 | Ga0495599_0000190_38260_39234 | 324 |
| 266 | 3300046679 | Ga0495623_0006721 | Ga0495623_0006721_1425_2399 | 324 |
| 267 | 3300046679 | Ga0495623_0020925 | Ga0495623_0020925_472_1446 | 324 |
| 268 | 3300046679 | Ga0495623_0058929 | Ga0495623_0058929_521_1495 | 324 |
| 269 | 3300046680 | Ga0495646_0022185 | Ga0495646_0022185_1241_2215 | 324 |
| 270 | 3300046680 | Ga0495646_0029377 | Ga0495646_0029377_1874_2848 | 324 |
| 271 | 3300046681 | Ga0495647_0026697 | Ga0495647_0026697_376_1350 | 324 |
| 272 | 3300046683 | Ga0495658_0037020 | Ga0495658_0037020_1322_2296 | 324 |
| 273 | 3300046689 | Ga0495613_0084744 | Ga0495613_0084744_529_1503 | 324 |
| 274 | 3300046689 | Ga0495613_0158095 | Ga0495613_0158095_520_1494 | 324 |
| 275 | 3300046690 | Ga0495624_0053832 | Ga0495624_0053832_1166_2140 | 324 |
| 276 | 3300046690 | Ga0495624_0157992 | Ga0495624_0157992_30_1004 | 324 |
| 277 | 3300046809 | Ga0495600_0031134 | Ga0495600_0031134_1405_2379 | 324 |
| 278 | 3300046809 | Ga0495600_0166927 | Ga0495600_0166927_269_1243 | 324 |
| 279 | 3300047315 | Ga0495581_0016108 | Ga0495581_0016108_400_1374 | 324 |
| 280 | 3300047315 | Ga0495581_0037108 | Ga0495581_0037108_1446_2420 | 324 |
| 281 | 3300047317 | Ga0495604_0000117 | Ga0495604_0000117_64583_65557 | 324 |
| 282 | 3300047317 | Ga0495604_0060316 | Ga0495604_0060316_394_1368 | 324 |
| 283 | 3300047319 | Ga0495674_0114496 | Ga0495674_0114496_852_1826 | 324 |
| 284 | 3300047320 | Ga0495672_0010322 | Ga0495672_0010322_1372_2370 | 324 |
| 285 | 3300047322 | Ga0495680_0004248 | Ga0495680_0004248_18_992 | 324 |
| 286 | 3300047322 | Ga0495680_0104902 | Ga0495680_0104902_823_1797 | 324 |
| 287 | 3300047322 | Ga0495680_0144936 | Ga0495680_0144936_404_1378 | 324 |
| 288 | 3300047444 | Ga0495675_0007540 | Ga0495675_0007540_1427_2401 | 324 |
| 289 | 3300047444 | Ga0495675_0020240 | Ga0495675_0020240_1725_2699 | 324 |
| 290 | 3300047471 | Ga0495684_0078599 | Ga0495684_0078599_439_1413 | 324 |
| 291 | 3300047471 | Ga0495684_0093931 | Ga0495684_0093931_23_997 | 324 |
| 292 | 3300047673 | Ga0495593_0045507 | Ga0495593_0045507_72_1046 | 324 |
| 293 | 3300048088 | Ga0495602_0000424 | Ga0495602_0000424_1399_2373 | 324 |
| 294 | 3300048088 | Ga0495602_0042960 | Ga0495602_0042960_1938_2912 | 324 |
| 295 | 3300048088 | Ga0495602_0085854 | Ga0495602_0085854_1544_2518 | 324 |
| 296 | 3300048903 | Ga0496100_0020777 | Ga0496100_0020777_2538_3512 | 324 |
| 297 | 3300048904 | Ga0496101_0011202 | Ga0496101_0011202_3278_4252 | 324 |
| 298 | 3300048905 | Ga0496102_0153248 | Ga0496102_0153248_116_1090 | 324 |
| 299 | 3300048907 | Ga0496104_0031597 | Ga0496104_0031597_319_1293 | 324 |
| 300 | 3300048908 | Ga0496105_0011011 | Ga0496105_0011011_1757_2731 | 324 |
| 301 | 3300048910 | Ga0496107_0037990 | Ga0496107_0037990_1769_2743 | 324 |
| 302 | 3300048912 | Ga0496109_0318551 | Ga0496109_0318551_419_1393 | 324 |
| 303 | 3300048913 | Ga0496110_0164211 | Ga0496110_0164211_758_1732 | 324 |
| 304 | 3300048915 | Ga0496112_0035671 | Ga0496112_0035671_3632_4606 | 324 |
| 305 | 3300048915 | Ga0496112_0169299 | Ga0496112_0169299_666_1640 | 324 |
| 306 | 3300048916 | Ga0496113_0052722 | Ga0496113_0052722_1368_2342 | 324 |
| 307 | 3300048917 | Ga0496114_0260276 | Ga0496114_0260276_122_1096 | 324 |
| 308 | 3300049569 | Ga0501032_0018468 | Ga0501032_0018468_1937_2941 | 324 |
| 309 | 3300049571 | Ga0501034_0040541 | Ga0501034_0040541_3382_4359 | 324 |
| 310 | 3300049572 | Ga0501036_0007365 | Ga0501036_0007365_6157_7161 | 324 |
| 311 | 3300049572 | Ga0501036_0042236 | Ga0501036_0042236_2770_3747 | 324 |
| 312 | 3300049572 | Ga0501036_0084349 | Ga0501036_0084349_71_1048 | 324 |
| 313 | 3300049573 | Ga0501037_0026963 | Ga0501037_0026963_2171_3175 | 324 |
| 314 | 3300049573 | Ga0501037_0043477 | Ga0501037_0043477_265_1242 | 324 |
| 315 | 3300049574 | Ga0501038_0145494 | Ga0501038_0145494_231_1235 | 324 |
| 316 | 3300049575 | Ga0501039_0051877 | Ga0501039_0051877_879_1883 | 324 |
| 317 | 3300049576 | Ga0501040_0039399 | Ga0501040_0039399_729_1733 | 324 |
| 318 | 3300049576 | Ga0501040_0067975 | Ga0501040_0067975_1053_2030 | 324 |
| 319 | 3300049577 | Ga0501041_0001368 | Ga0501041_0001368_11852_12856 | 324 |
| 320 | 3300049578 | Ga0501042_0006968 | Ga0501042_0006968_4484_5488 | 324 |
| 321 | 3300049578 | Ga0501042_0016652 | Ga0501042_0016652_1060_2037 | 324 |
| 322 | 3300049578 | Ga0501042_0252104 | Ga0501042_0252104_228_1202 | 324 |
| 323 | 3300049579 | Ga0501043_0008874 | Ga0501043_0008874_2377_3354 | 324 |
| 324 | 3300049579 | Ga0501043_0031354 | Ga0501043_0031354_1324_2328 | 324 |
| 325 | 3300049580 | Ga0501046_0122606 | Ga0501046_0122606_882_1859 | 324 |
| 326 | 3300049581 | Ga0501047_0019820 | Ga0501047_0019820_2468_3445 | 324 |
| 327 | 3300049582 | Ga0501048_0005060 | Ga0501048_0005060_5972_6949 | 324 |
| 328 | 3300049582 | Ga0501048_0006036 | Ga0501048_0006036_6348_7352 | 324 |
| 329 | 3300049585 | Ga0501069_0045706 | Ga0501069_0045706_748_1752 | 324 |
| 330 | 3300049587 | Ga0501071_0007540 | Ga0501071_0007540_5535_6539 | 324 |
| 331 | 3300049588 | Ga0501072_0048592 | Ga0501072_0048592_857_1861 | 324 |
| 332 | 3300049589 | Ga0501073_0023822 | Ga0501073_0023822_1067_2044 | 324 |
| 333 | 3300049590 | Ga0501074_0009651 | Ga0501074_0009651_3388_4365 | 324 |
| 334 | 3300049590 | Ga0501074_0014129 | Ga0501074_0014129_3001_4005 | 324 |
| 335 | 3300049591 | Ga0501075_0120944 | Ga0501075_0120944_347_1324 | 324 |
| 336 | 3300049593 | Ga0501077_0047832 | Ga0501077_0047832_1181_2185 | 324 |
| 337 | 3300049741 | Ga0501079_0194308 | Ga0501079_0194308_237_1214 | 324 |
| 338 | 3300049743 | Ga0501081_0008633 | Ga0501081_0008633_4920_5924 | 324 |
| 339 | 3300049744 | Ga0501083_0046497 | Ga0501083_0046497_902_1906 | 324 |
| 340 | 3300049823 | Ga0501044_0036424 | Ga0501044_0036424_3976_4953 | 324 |
| 341 | 3300049823 | Ga0501044_0086489 | Ga0501044_0086489_1909_2913 | 324 |
| 342 | 3300049824 | Ga0501045_0029334 | Ga0501045_0029334_1483_2487 | 324 |
| 343 | 3300049824 | Ga0501045_0069052 | Ga0501045_0069052_566_1543 | 324 |
| 344 | 3300050512 | nmdc:mga0n895_124803_c1 | nmdc:mga0n895_124803_c1_1155_2129 | 324 |
| 345 | 3300050512 | nmdc:mga0n895_56920_c1 | nmdc:mga0n895_56920_c1_2212_3186 | 324 |
| 346 | 3300050513 | nmdc:mga0rr50_32571_c1 | nmdc:mga0rr50_32571_c1_1383_2357 | 324 |
| 347 | 3300050515 | nmdc:mga0a205_22836_c1 | nmdc:mga0a205_22836_c1_4130_5104 | 324 |
| 348 | 3300053078 | Ga0495612_0026636 | Ga0495612_0026636_1202_2176 | 324 |
| 349 | 3300053084 | Ga0495595_0020497 | Ga0495595_0020497_580_1554 | 324 |
| 350 | 3300053085 | Ga0495619_0045575 | Ga0495619_0045575_1459_2433 | 324 |
| 351 | 3300053139 | Ga0500568_0011394 | Ga0500568_0011394_2734_3732 | 324 |
| 352 | 3300053156 | Ga0500622_0005299 | Ga0500622_0005299_4792_5790 | 324 |
| 353 | 3300054114 | Ga0501084_0032643 | Ga0501084_0032643_1345_2349 | 324 |
| 354 | 3300054114 | Ga0501084_0158563 | Ga0501084_0158563_877_1854 | 324 |
| 355 | 3300060353 | Ga0501082_0003368 | Ga0501082_0003368_12197_13201 | 324 |
| 356 | 3300061734 | Ga0530510_0012282 | Ga0530510_0012282_2093_3097 | 324 |
| 357 | iso_pu_bacteria | 2675903059 | 2676485352 | 324 |
| 358 | 3300003794 | Ga0055531_10000625 | Ga0055531_1000062519 | 325 |
| 359 | 3300009036 | Ga0105244_10076485 | Ga0105244_100764852 | 325 |
| 360 | 3300009092 | Ga0105250_10034177 | Ga0105250_100341772 | 325 |
| 361 | 3300017792 | Ga0163161_10241890 | Ga0163161_102418902 | 325 |
| 362 | 3300025303 | Ga0209051_1000078 | Ga0209051_100007882 | 325 |
| 363 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012341 | 325 |
| 364 | 3300025728 | Ga0207655_1064747 | Ga0207655_10647472 | 325 |
| 365 | 3300027876 | Ga0209974_10027691 | Ga0209974_100276912 | 325 |
| 366 | 3300031251 | Ga0265327_10040353 | Ga0265327_100403532 | 325 |
| 367 | 3300031456 | Ga0307513_10002444 | Ga0307513_1000244412 | 325 |
| 368 | 3300031824 | Ga0307413_10194410 | Ga0307413_101944101 | 325 |
| 369 | 3300037312 | Ga0395899_0004051 | Ga0395899_0004051_10196_11182 | 325 |
| 370 | 3300037312 | Ga0395899_0233407 | Ga0395899_0233407_34_1044 | 325 |
| 371 | 3300037418 | Ga0395900_0000021 | Ga0395900_0000021_346350_347336 | 325 |
| 372 | 3300037466 | Ga0395898_0001024 | Ga0395898_0001024_38784_39770 | 325 |
| 373 | 3300037471 | Ga0395905_0000551 | Ga0395905_0000551_3809_4795 | 325 |
| 374 | 3300038443 | Ga0395901_0013399 | Ga0395901_0013399_3561_4547 | 325 |
| 375 | 3300041404 | Ga0439436_0000469 | Ga0439436_0000469_2696_3685 | 325 |
| 376 | 3300041405 | Ga0439438_000423 | Ga0439438_000423_3917_4906 | 325 |
| 377 | 3300041407 | Ga0439447_000080 | Ga0439447_000080_6140_7129 | 325 |
| 378 | 3300041411 | Ga0439466_0008067 | Ga0439466_0008067_1882_2871 | 325 |
| 379 | 3300041411 | Ga0439466_0034649 | Ga0439466_0034649_363_1352 | 325 |
| 380 | 3300042435 | Ga0439434_0000994 | Ga0439434_0000994_3608_4597 | 325 |
| 381 | 3300046512 | Ga0495610_0015125 | Ga0495610_0015125_703_1692 | 325 |
| 382 | 3300046515 | Ga0495620_0002623 | Ga0495620_0002623_3324_4313 | 325 |
| 383 | 3300046524 | Ga0495648_0151239 | Ga0495648_0151239_20_1009 | 325 |
| 384 | 3300046530 | Ga0495654_0001503 | Ga0495654_0001503_5896_6885 | 325 |
| 385 | 3300046538 | Ga0495609_0011191 | Ga0495609_0011191_2369_3358 | 325 |
| 386 | 3300046691 | Ga0495670_0000622 | Ga0495670_0000622_10290_11279 | 325 |
| 387 | 3300047320 | Ga0495672_0002434 | Ga0495672_0002434_7432_8421 | 325 |
| 388 | 3300048909 | Ga0496106_0313086 | Ga0496106_0313086_154_1131 | 325 |
| 389 | 3300048928 | Ga0496125_0009117 | Ga0496125_0009117_8556_9545 | 325 |
| 390 | 3300049460 | Ga0495682_0015816 | Ga0495682_0015816_662_1651 | 325 |
| 391 | 3300049568 | Ga0501031_0001766 | Ga0501031_0001766_6894_7880 | 325 |
| 392 | 3300049573 | Ga0501037_0280107 | Ga0501037_0280107_131_1120 | 325 |
| 393 | 3300049574 | Ga0501038_0001209 | Ga0501038_0001209_3735_4718 | 325 |
| 394 | 3300049575 | Ga0501039_0185688 | Ga0501039_0185688_539_1522 | 325 |
| 395 | 3300049576 | Ga0501040_0007863 | Ga0501040_0007863_2434_3417 | 325 |
| 396 | 3300049577 | Ga0501041_0026616 | Ga0501041_0026616_1443_2426 | 325 |
| 397 | 3300049578 | Ga0501042_0022756 | Ga0501042_0022756_1177_2160 | 325 |
| 398 | 3300049579 | Ga0501043_0145685 | Ga0501043_0145685_39_1022 | 325 |
| 399 | 3300049580 | Ga0501046_0010232 | Ga0501046_0010232_6156_7139 | 325 |
| 400 | 3300049587 | Ga0501071_0129588 | Ga0501071_0129588_858_1841 | 325 |
| 401 | 3300049590 | Ga0501074_0001599 | Ga0501074_0001599_14118_15101 | 325 |
| 402 | 3300049591 | Ga0501075_0068126 | Ga0501075_0068126_532_1515 | 325 |
| 403 | 3300049591 | Ga0501075_0244211 | Ga0501075_0244211_160_1143 | 325 |
| 404 | 3300049743 | Ga0501081_0053212 | Ga0501081_0053212_850_1833 | 325 |
| 405 | 3300049824 | Ga0501045_0004554 | Ga0501045_0004554_5511_6494 | 325 |
| 406 | 3300054114 | Ga0501084_0008104 | Ga0501084_0008104_6233_7216 | 325 |
| 407 | 3300060353 | Ga0501082_0035992 | Ga0501082_0035992_2296_3279 | 325 |
| 408 | 3300061734 | Ga0530510_0067307 | Ga0530510_0067307_1364_2347 | 325 |
| 409 | iso_pu_bacteria | 2523231044 | 2523384042 | 325 |
| 410 | iso_pu_bacteria | 2643221546 | 2643753849 | 325 |
| 411 | iso_pu_bacteria | 2738541278 | 2738730471 | 325 |
| 412 | 3300003763 | Ga0055529_1002807 | Ga0055529_10028073 | 326 |
| 413 | 3300025254 | Ga0209148_1000920 | Ga0209148_100092014 | 326 |
| 414 | 3300025272 | Ga0209455_1001257 | Ga0209455_10012578 | 326 |
| 415 | 3300026088 | Ga0207641_10020773 | Ga0207641_100207734 | 326 |
| 416 | 3300053088 | Ga0500644_0017847 | Ga0500644_0017847_886_1878 | 326 |
| 417 | 3300053092 | Ga0500583_0053884 | Ga0500583_0053884_287_1276 | 326 |
| 418 | 3300048907 | Ga0496104_0213825 | Ga0496104_0213825_546_1547 | 327 |
| 419 | 3300053087 | Ga0500643_000603 | Ga0500643_000603_20754_21755 | 327 |
| 420 | iso_pu_bacteria | 3006969106 | 3006971283 | 327 |
| 421 | 3300001989 | JGI24739J22299_10001076 | JGI24739J22299_100010768 | 328 |
| 422 | 3300001990 | JGI24737J22298_10002127 | JGI24737J22298_100021274 | 328 |
| 423 | 3300002067 | JGI24735J21928_10029712 | JGI24735J21928_100297122 | 328 |
| 424 | 3300005347 | Ga0070668_100021462 | Ga0070668_1000214624 | 328 |
| 425 | 3300005577 | Ga0068857_100337337 | Ga0068857_1003373372 | 328 |
| 426 | 3300025904 | Ga0207647_10020780 | Ga0207647_100207805 | 328 |
| 427 | 3300025972 | Ga0207668_10038263 | Ga0207668_100382635 | 328 |
| 428 | 3300026041 | Ga0207639_10235726 | Ga0207639_102357261 | 328 |
| 429 | 3300026116 | Ga0207674_10023156 | Ga0207674_100231562 | 328 |
| 430 | 3300048917 | Ga0496114_0000881 | Ga0496114_0000881_18693_19691 | 328 |
| 431 | 3300053151 | Ga0500604_0000016 | Ga0500604_0000016_57893_58888 | 328 |
| 432 | iso_pu_bacteria | 8004021418 | 8004024566 | 329 |
| 433 | iso_pu_bacteria | 8004025490 | 8004026878 | 329 |
| 434 | 3300009098 | Ga0105245_10025798 | Ga0105245_100257983 | 330 |
| 435 | 3300009176 | Ga0105242_10199980 | Ga0105242_101999802 | 330 |
| 436 | 3300009551 | Ga0105238_10267618 | Ga0105238_102676182 | 330 |
| 437 | 3300013104 | Ga0157370_10004246 | Ga0157370_100042468 | 330 |
| 438 | 3300013308 | Ga0157375_10025617 | Ga0157375_100256171 | 330 |
| 439 | 3300025927 | Ga0207687_10089183 | Ga0207687_100891832 | 330 |
| 440 | 3300031728 | Ga0316578_10011028 | Ga0316578_100110283 | 330 |
| 441 | 3300031733 | Ga0316577_10004706 | Ga0316577_100047066 | 330 |
| 442 | 3300032137 | Ga0316585_10019216 | Ga0316585_100192161 | 330 |
| 443 | 3300035398 | Ga0316574_0204878 | Ga0316574_0204878_41_1036 | 330 |
| 444 | 3300036712 | Ga0316584_0045244 | Ga0316584_0045244_484_1479 | 330 |
| 445 | 3300046463 | Ga0495653_0227023 | Ga0495653_0227023_138_1151 | 330 |
| 446 | 3300047319 | Ga0495674_0149407 | Ga0495674_0149407_152_1165 | 330 |
| 447 | 3300048905 | Ga0496102_0376887 | Ga0496102_0376887_230_1261 | 330 |
| 448 | 3300048917 | Ga0496114_0022499 | Ga0496114_0022499_2181_3212 | 330 |
| 449 | 3300048917 | Ga0496114_0136177 | Ga0496114_0136177_686_1699 | 330 |
| 450 | 3300049592 | Ga0501076_0160425 | Ga0501076_0160425_617_1645 | 331 |
| 451 | 3300037312 | Ga0395899_0040268 | Ga0395899_0040268_1466_2482 | 332 |
| 452 | 3300037466 | Ga0395898_0050997 | Ga0395898_0050997_1658_2674 | 332 |
| 453 | 3300038443 | Ga0395901_0042062 | Ga0395901_0042062_2083_3099 | 332 |
| 454 | 3300005327 | Ga0070658_10000359 | Ga0070658_1000035919 | 333 |
| 455 | 3300005618 | Ga0068864_100011366 | Ga0068864_1000113663 | 334 |
| 456 | 3300014325 | Ga0163163_10004929 | Ga0163163_1000492912 | 334 |
| 457 | 3300026095 | Ga0207676_10157383 | Ga0207676_101573832 | 334 |
| 458 | 3300037068 | Ga0373925_0011658 | Ga0373925_0011658_2681_3688 | 334 |
| 459 | 3300046559 | Ga0495667_0163211 | Ga0495667_0163211_315_1322 | 334 |
| 460 | 3300049568 | Ga0501031_0060385 | Ga0501031_0060385_553_1566 | 334 |
| 461 | 3300049570 | Ga0501033_0201672 | Ga0501033_0201672_74_1087 | 334 |
| 462 | 3300049572 | Ga0501036_0029536 | Ga0501036_0029536_2301_3314 | 334 |
| 463 | 3300049575 | Ga0501039_0086781 | Ga0501039_0086781_620_1633 | 334 |
| 464 | 3300049578 | Ga0501042_0039389 | Ga0501042_0039389_368_1381 | 334 |
| 465 | 3300049587 | Ga0501071_0023579 | Ga0501071_0023579_2756_3769 | 334 |
| 466 | 3300049588 | Ga0501072_0031709 | Ga0501072_0031709_2048_3061 | 334 |
| 467 | 3300049590 | Ga0501074_0098986 | Ga0501074_0098986_394_1407 | 334 |
| 468 | 3300049591 | Ga0501075_0057652 | Ga0501075_0057652_66_1079 | 334 |
| 469 | 3300049592 | Ga0501076_0047403 | Ga0501076_0047403_135_1148 | 334 |
| 470 | 3300049593 | Ga0501077_0076365 | Ga0501077_0076365_346_1359 | 334 |
| 471 | 3300049741 | Ga0501079_0068286 | Ga0501079_0068286_414_1427 | 334 |
| 472 | 3300049824 | Ga0501045_0041206 | Ga0501045_0041206_1927_2940 | 334 |
| 473 | 3300053153 | Ga0500616_0002749 | Ga0500616_0002749_5406_6524 | 334 |
| 474 | 3300060353 | Ga0501082_0078585 | Ga0501082_0078585_368_1381 | 334 |
| 475 | 3300061734 | Ga0530510_0036320 | Ga0530510_0036320_2468_3481 | 334 |
| 476 | iso_pu_bacteria | 2818991458 | 2819668381 | 334 |
| 477 | 3300026067 | Ga0207678_10207883 | Ga0207678_102078832 | 335 |
| 478 | 3300048909 | Ga0496106_0175836 | Ga0496106_0175836_217_1227 | 335 |
| 479 | 3300048916 | Ga0496113_0153015 | Ga0496113_0153015_205_1221 | 335 |
| 480 | iso_pu_bacteria | 2818991318 | 2819428081 | 336 |
| 481 | 3300049576 | Ga0501040_0034901 | Ga0501040_0034901_323_1342 | 337 |
| 482 | 3300048915 | Ga0496112_0149627 | Ga0496112_0149627_168_1193 | 338 |
| 483 | 3300005535 | Ga0070684_100028002 | Ga0070684_1000280022 | 339 |
| 484 | 3300047321 | Ga0495676_0188995 | Ga0495676_0188995_370_1395 | 339 |
| 485 | 3300049568 | Ga0501031_0002099 | Ga0501031_0002099_7169_8191 | 339 |
| 486 | 3300049570 | Ga0501033_0063409 | Ga0501033_0063409_1423_2445 | 339 |
| 487 | 3300049572 | Ga0501036_0002998 | Ga0501036_0002998_10450_11472 | 339 |
| 488 | 3300049573 | Ga0501037_0077793 | Ga0501037_0077793_958_1980 | 339 |
| 489 | 3300049574 | Ga0501038_0012377 | Ga0501038_0012377_4373_5395 | 339 |
| 490 | 3300049575 | Ga0501039_0003892 | Ga0501039_0003892_3310_4332 | 339 |
| 491 | 3300049576 | Ga0501040_0010694 | Ga0501040_0010694_3483_4505 | 339 |
| 492 | 3300049577 | Ga0501041_0028612 | Ga0501041_0028612_52_1074 | 339 |
| 493 | 3300049578 | Ga0501042_0030658 | Ga0501042_0030658_972_1994 | 339 |
| 494 | 3300049579 | Ga0501043_0039779 | Ga0501043_0039779_2606_3628 | 339 |
| 495 | 3300049580 | Ga0501046_0016295 | Ga0501046_0016295_808_1830 | 339 |
| 496 | 3300049582 | Ga0501048_0007085 | Ga0501048_0007085_3104_4126 | 339 |
| 497 | 3300049584 | Ga0501068_0079020 | Ga0501068_0079020_693_1715 | 339 |
| 498 | 3300049585 | Ga0501069_0039781 | Ga0501069_0039781_1446_2477 | 339 |
| 499 | 3300049587 | Ga0501071_0019782 | Ga0501071_0019782_1906_2928 | 339 |
| 500 | 3300049588 | Ga0501072_0045112 | Ga0501072_0045112_578_1600 | 339 |
| 501 | 3300049590 | Ga0501074_0004070 | Ga0501074_0004070_6038_7060 | 339 |
| 502 | 3300049591 | Ga0501075_0047228 | Ga0501075_0047228_252_1274 | 339 |
| 503 | 3300049592 | Ga0501076_0002222 | Ga0501076_0002222_5001_6023 | 339 |
| 504 | 3300049741 | Ga0501079_0002277 | Ga0501079_0002277_5982_7004 | 339 |
| 505 | 3300049743 | Ga0501081_0011026 | Ga0501081_0011026_3070_4092 | 339 |
| 506 | 3300049822 | Ga0501035_0027279 | Ga0501035_0027279_2516_3538 | 339 |
| 507 | 3300049823 | Ga0501044_0080169 | Ga0501044_0080169_1161_2183 | 339 |
| 508 | 3300049824 | Ga0501045_0012593 | Ga0501045_0012593_3232_4254 | 339 |
| 509 | 3300060353 | Ga0501082_0010723 | Ga0501082_0010723_2286_3308 | 339 |
| 510 | 3300061734 | Ga0530510_0004203 | Ga0530510_0004203_1679_2701 | 339 |
| 511 | 3300005338 | Ga0068868_100228617 | Ga0068868_1002286171 | 340 |
| 512 | 3300022467 | Ga0224712_10136344 | Ga0224712_101363441 | 340 |
| 513 | 3300032126 | Ga0307415_100252533 | Ga0307415_1002525332 | 340 |
| 514 | 3300048903 | Ga0496100_0089461 | Ga0496100_0089461_552_1616 | 340 |
| 515 | 3300048904 | Ga0496101_0094973 | Ga0496101_0094973_201_1265 | 340 |
| 516 | 3300048906 | Ga0496103_0021858 | Ga0496103_0021858_1378_2442 | 340 |
| 517 | 3300048907 | Ga0496104_0046549 | Ga0496104_0046549_658_1728 | 340 |
| 518 | 3300048907 | Ga0496104_0137102 | Ga0496104_0137102_1265_2329 | 340 |
| 519 | 3300048909 | Ga0496106_0167214 | Ga0496106_0167214_52_1116 | 340 |
| 520 | 3300048910 | Ga0496107_0011421 | Ga0496107_0011421_4680_5744 | 340 |
| 521 | 3300048912 | Ga0496109_0018589 | Ga0496109_0018589_4934_5998 | 340 |
| 522 | 3300048912 | Ga0496109_0264046 | Ga0496109_0264046_367_1437 | 340 |
| 523 | 3300048914 | Ga0496111_0182641 | Ga0496111_0182641_63_1133 | 340 |
| 524 | 3300048915 | Ga0496112_0204101 | Ga0496112_0204101_501_1553 | 340 |
| 525 | 3300048916 | Ga0496113_0065196 | Ga0496113_0065196_1167_2237 | 340 |
| 526 | 3300048917 | Ga0496114_0038736 | Ga0496114_0038736_1943_3007 | 340 |
| 527 | 3300049584 | Ga0501068_0065812 | Ga0501068_0065812_178_1242 | 340 |
| 528 | 3300045976 | Ga0466967_0292245 | Ga0466967_0292245_210_1259 | 341 |
| 529 | 3300048908 | Ga0496105_0109617 | Ga0496105_0109617_863_1897 | 341 |
| 530 | 3300048917 | Ga0496114_0322937 | Ga0496114_0322937_280_1314 | 341 |
| 531 | 3300001979 | JGI24740J21852_10025414 | JGI24740J21852_100254142 | 342 |
| 532 | 3300004799 | Ga0058863_10174367 | Ga0058863_101743671 | 342 |
| 533 | 3300005336 | Ga0070680_100236450 | Ga0070680_1002364502 | 342 |
| 534 | 3300005435 | Ga0070714_100004583 | Ga0070714_1000045833 | 342 |
| 535 | 3300013307 | Ga0157372_10282906 | Ga0157372_102829062 | 342 |
| 536 | 3300020070 | Ga0206356_11835610 | Ga0206356_118356102 | 342 |
| 537 | 3300020075 | Ga0206349_1614230 | Ga0206349_16142301 | 342 |
| 538 | 3300025929 | Ga0207664_10023522 | Ga0207664_100235222 | 342 |
| 539 | 3300037418 | Ga0395900_0051229 | Ga0395900_0051229_952_2013 | 342 |
| 540 | 3300037466 | Ga0395898_0019040 | Ga0395898_0019040_2157_3218 | 342 |
| 541 | 3300037471 | Ga0395905_0054506 | Ga0395905_0054506_2359_3420 | 342 |
| 542 | 3300038443 | Ga0395901_0141402 | Ga0395901_0141402_1323_2384 | 342 |
| 543 | 3300046543 | Ga0495645_0124538 | Ga0495645_0124538_474_1565 | 342 |
| 544 | 3300046683 | Ga0495658_0080652 | Ga0495658_0080652_371_1417 | 342 |
| 545 | 3300049823 | Ga0501044_0455422 | Ga0501044_0455422_18_1148 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cer-assembly2.cif.gz_G | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9279 | 19 | 334 |
| 1x7z-assembly1.cif.gz_A-2 | crystal structure of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase | 0.9276 | 16 | 340 |
| 6cer-assembly1.cif.gz_C | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9263 | 19 | 334 |
| 3exg-assembly4.cif.gz_O | crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex | 0.9261 | 19 | 334 |
| 2bff-assembly1.cif.gz_A-2 | reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch | 0.9226 | 16 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6GTY5_25_137_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9515 | 142 | 255 | 3.40.50.970 |
| af_Q2FY52_1_330_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.938 | 19 | 340 | 3.40.50.970 |
| af_F4KIN4_12_241_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9365 | 148 | 340 | 3.40.50.970 |
| af_A0A1D6GTY5_25_137_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9274 | 142 | 255 | 3.40.50.970 |
| af_B4FGJ4_23_381_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9212 | 19 | 341 | 3.40.50.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T2XDV0-F1-model_v4 | Pyruvate dehydrogenase (Acetyl-transferring) E1 component subunit alpha | 0.9846 | 33 | 163 |
GO:0004739
GO:0006086 |
| AF-A0A4Q9W2P6-F1-model_v4 | Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | 0.98 | 73 | 279 |
GO:0004739
GO:0006086 |
| AF-A0A151AI31-F1-model_v4 | Dehydrogenase E1 component | 0.9759 | 28 | 178 |
GO:0004739
GO:0006086 |
| AF-A0A7T4UPU2-F1-model_v4 | Thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | 0.9752 | 19 | 341 |
GO:0004739
GO:0006086 |
| AF-A0A059WH10-F1-model_v4 | Dehydrogenase E1 component | 0.972 | 60 | 285 |
GO:0004739
GO:0006086 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar