F461728

General Info

Members Datasets Scaffolds Average Seq Length
544 223 544 163

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10756495|Ga0105249_107564952
Length 193
Sequence MEAIVQNCKIKSFSKPLPQRGFYIPKLCILLFMKEHKFEFQYEIYNDSSELKKEDAELLGKARAVTKYAYAPYSDFRVGAAGILVNGEIISGTNQENASFPVGICAERVLLGAAASMHPGIPIKTIAVSYDSDNVSTDHPISPCGMCRQALIEQETRFHQPIRLILSGQQGKVLIIRSAVSLLPFAFTGDELE

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
159 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
201 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 1.65
Rhizosphere 95.96
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3060620 2162886011 Bacteria 1019
2 MRS1b_contig_4234355 2162886011 Bacteria 1224
3 rootH2_10014715 3300003320 Bacteria 11737
4 Ga0065712_10001567 3300005290 Bacteria 12724
5 Ga0065712_10178720 3300005290 Bacteria 1174
6 Ga0065712_10230060 3300005290 Bacteria 1014
7 Ga0065715_10481615 3300005293 Bacteria 796
8 Ga0065707_10095485 3300005295 Bacteria 3374
9 Ga0065707_10204070 3300005295 Bacteria 1297
10 Ga0070658_10854429 3300005327 Bacteria 791
11 Ga0070676_10028466 3300005328 Bacteria 3173
12 Ga0070676_10057214 3300005328 Bacteria 2307
13 Ga0070676_10157646 3300005328 Bacteria 1458
14 Ga0070676_10248938 3300005328 Bacteria 1185
15 Ga0070683_100007696 3300005329 Bacteria 9117
16 Ga0070690_100027358 3300005330 Unclassified 3525
17 Ga0070690_100032740 3300005330 Bacteria 3249
18 Ga0070690_100658722 3300005330 Bacteria 800
19 Ga0070670_100159752 3300005331 Bacteria 1953
20 Ga0070670_100196739 3300005331 Bacteria 1751
21 Ga0070670_100323070 3300005331 Bacteria 1352
22 Ga0070670_100426597 3300005331 Bacteria 1173
23 Ga0070677_10299603 3300005333 Bacteria 816
24 Ga0068869_100001850 3300005334 Bacteria 12717
25 Ga0068869_100009539 3300005334 Bacteria 6300
26 Ga0068869_100016622 3300005334 Bacteria 4962
27 Ga0068869_100037747 3300005334 Bacteria 3436
28 Ga0068869_100234083 3300005334 Bacteria 1461
29 Ga0068869_100416538 3300005334 Bacteria 1108
30 Ga0068869_101623318 3300005334 Unclassified 576
31 Ga0070666_10000127 3300005335 Bacteria 53362
32 Ga0070666_10014370 3300005335 Bacteria 5039
33 Ga0070666_10041325 3300005335 Bacteria 3081
34 Ga0070666_10268305 3300005335 Bacteria 1211
35 Ga0070666_10310223 3300005335 Bacteria 1124
36 Ga0070666_10400568 3300005335 Bacteria 987
37 Ga0070682_100771364 3300005337 Bacteria 778
38 Ga0068868_100005670 3300005338 Bacteria 8788
39 Ga0068868_100007552 3300005338 Bacteria 7745
40 Ga0068868_100013219 3300005338 Bacteria 6047
41 Ga0068868_100030307 3300005338 Bacteria 4148
42 Ga0068868_100166603 3300005338 Bacteria 1823
43 Ga0068868_100332300 3300005338 Bacteria 1297
44 Ga0070660_100007829 3300005339 Bacteria 7451
45 Ga0070689_100004423 3300005340 Bacteria 9490
46 Ga0070689_100036841 3300005340 Bacteria 3741
47 Ga0070689_100239541 3300005340 Bacteria 1494
48 Ga0070689_100321672 3300005340 Bacteria 1292
49 Ga0070687_100006493 3300005343 Bacteria 4796
50 Ga0070661_100080351 3300005344 Bacteria 2407
51 Ga0070661_100095021 3300005344 Bacteria 2210
52 Ga0070661_100319900 3300005344 Unclassified 1212
53 Ga0070692_10560040 3300005345 Bacteria 750
54 Ga0070668_100058326 3300005347 Bacteria 2986
55 Ga0070669_100035285 3300005353 Bacteria 3623
56 Ga0070669_100218612 3300005353 Unclassified 1506
57 Ga0070675_100022380 3300005354 Bacteria 5051
58 Ga0070675_100076631 3300005354 Bacteria 2782
59 Ga0070675_100163676 3300005354 Bacteria 1915
60 Ga0070675_100196652 3300005354 Bacteria 1749
61 Ga0070675_100211289 3300005354 Bacteria 1686
62 Ga0070675_100764682 3300005354 Bacteria 882
63 Ga0070675_101406229 3300005354 Bacteria 643
64 Ga0070671_100018592 3300005355 Bacteria 5646
65 Ga0070671_100063111 3300005355 Bacteria 3085
66 Ga0070671_100650581 3300005355 Bacteria 912
67 Ga0070674_100108438 3300005356 Unclassified 2035
68 Ga0070674_100443426 3300005356 Bacteria 1070
69 Ga0070674_100695465 3300005356 Bacteria 869
70 Ga0070673_100010606 3300005364 Bacteria 6244
71 Ga0070673_100037208 3300005364 Bacteria 3707
72 Ga0070673_100043345 3300005364 Bacteria 3476
73 Ga0070673_100190631 3300005364 Bacteria 1761
74 Ga0070688_100057889 3300005365 Bacteria 2438
75 Ga0070688_100062103 3300005365 Bacteria 2364
76 Ga0070659_100014717 3300005366 Bacteria 5850
77 Ga0070659_100213813 3300005366 Bacteria 1589
78 Ga0070659_100642257 3300005366 Bacteria 915
79 Ga0070667_100007591 3300005367 Bacteria 8994
80 Ga0070667_100013534 3300005367 Bacteria 6741
81 Ga0070667_100063851 3300005367 Bacteria 3122
82 Ga0070667_100079184 3300005367 Bacteria 2809
83 Ga0070667_100094694 3300005367 Bacteria 2573
84 Ga0070667_100235083 3300005367 Bacteria 1635
85 Ga0070667_100905920 3300005367 Bacteria 821
86 Ga0070667_102121377 3300005367 Bacteria 529
87 Ga0070709_11300772 3300005434 Bacteria 586
88 Ga0070700_100040779 3300005441 Bacteria 2844
89 Ga0070694_100241642 3300005444 Bacteria 1362
90 Ga0070663_100267403 3300005455 Bacteria 1358
91 Ga0070663_100953625 3300005455 Bacteria 744
92 Ga0070678_100188610 3300005456 Bacteria 1693
93 Ga0070678_100431151 3300005456 Bacteria 1151
94 Ga0070678_100832695 3300005456 Bacteria 840
95 Ga0070678_100864455 3300005456 Bacteria 825
96 Ga0070662_100029275 3300005457 Bacteria 3843
97 Ga0070662_100048370 3300005457 Bacteria 3063
98 Ga0070662_100051142 3300005457 Bacteria 2983
99 Ga0070662_100183776 3300005457 Bacteria 1650
100 Ga0070681_10968836 3300005458 Bacteria 770
101 Ga0068867_100013723 3300005459 Bacteria 5738
102 Ga0068867_100028976 3300005459 Bacteria 3987
103 Ga0068867_100055781 3300005459 Bacteria 2922
104 Ga0068867_100116619 3300005459 Bacteria 2058
105 Ga0068867_100152741 3300005459 Bacteria 1815
106 Ga0068867_100190003 3300005459 Bacteria 1638
107 Ga0068867_100436386 3300005459 Bacteria 1113
108 Ga0068867_100573899 3300005459 Bacteria 980
109 Ga0070685_10252918 3300005466 Bacteria 1168
110 Ga0070685_10290596 3300005466 Bacteria 1098
111 Ga0070684_100003930 3300005535 Bacteria 11259
112 Ga0070684_100111498 3300005535 Bacteria 2453
113 Ga0070684_100304324 3300005535 Bacteria 1463
114 Ga0070684_100454591 3300005535 Bacteria 1184
115 Ga0068853_100007598 3300005539 Bacteria 8682
116 Ga0068853_100141363 3300005539 Bacteria 2161
117 Ga0068853_100572461 3300005539 Bacteria 1071
118 Ga0068853_100885542 3300005539 Bacteria 857
119 Ga0068853_101400598 3300005539 Unclassified 676
120 Ga0070672_100013498 3300005543 Bacteria 5773
121 Ga0070672_100084057 3300005543 Bacteria 2555
122 Ga0070672_101652348 3300005543 Unclassified 575
123 Ga0070686_100016237 3300005544 Bacteria 4327
124 Ga0070686_100341985 3300005544 Bacteria 1121
125 Ga0070686_100899827 3300005544 Bacteria 720
126 Ga0070686_100941153 3300005544 Bacteria 705
127 Ga0070665_100153414 3300005548 Bacteria 2305
128 Ga0070665_100993639 3300005548 Bacteria 851
129 Ga0068855_100859577 3300005563 Unclassified 961
130 Ga0070664_100023253 3300005564 Bacteria 5118
131 Ga0070664_100029660 3300005564 Bacteria 4562
132 Ga0070664_100141033 3300005564 Bacteria 2122
133 Ga0070664_100143176 3300005564 Bacteria 2106
134 Ga0070664_100146336 3300005564 Bacteria 2084
135 Ga0070664_100415753 3300005564 Bacteria 1231
136 Ga0070664_100487530 3300005564 Bacteria 1135
137 Ga0070664_100716877 3300005564 Bacteria 933
138 Ga0068857_100012224 3300005577 Bacteria 7468
139 Ga0068857_100024477 3300005577 Bacteria 5315
140 Ga0068857_100063896 3300005577 Bacteria 3272
141 Ga0068854_100019390 3300005578 Bacteria 4582
142 Ga0068854_100049871 3300005578 Bacteria 2993
143 Ga0068854_100342457 3300005578 Unclassified 1221
144 Ga0068854_100555320 3300005578 Bacteria 975
145 Ga0068852_100033780 3300005616 Unclassified 4251
146 Ga0068852_100044139 3300005616 Bacteria 3784
147 Ga0068852_100045895 3300005616 Bacteria 3720
148 Ga0068852_100049011 3300005616 Bacteria 3612
149 Ga0068852_100356097 3300005616 Bacteria 1430
150 Ga0068852_100468346 3300005616 Bacteria 1250
151 Ga0068859_100000098 3300005617 Bacteria 80555
152 Ga0068859_100017189 3300005617 Bacteria 7262
153 Ga0068859_100029305 3300005617 Bacteria 5523
154 Ga0068859_100107032 3300005617 Bacteria 2856
155 Ga0068864_100034536 3300005618 Bacteria 4301
156 Ga0068864_100068541 3300005618 Bacteria 3082
157 Ga0068864_100098437 3300005618 Bacteria 2590
158 Ga0068861_100022702 3300005719 Bacteria 4524
159 Ga0068861_100477332 3300005719 Bacteria 1123
160 Ga0068861_100597558 3300005719 Bacteria 1012
161 Ga0068861_102378304 3300005719 Unclassified 532
162 Ga0068851_10084974 3300005834 Bacteria 1658
163 Ga0068851_10103289 3300005834 Bacteria 1514
164 Ga0068851_10256551 3300005834 Bacteria 993
165 Ga0068851_10294544 3300005834 Unclassified 931
166 Ga0068851_10326306 3300005834 Bacteria 888
167 Ga0068851_10575016 3300005834 Unclassified 683
168 Ga0068851_10677452 3300005834 Bacteria 633
169 Ga0068870_10032627 3300005840 Bacteria 2650
170 Ga0068870_10692720 3300005840 Unclassified 702
171 Ga0068863_100002114 3300005841 Bacteria 19700
172 Ga0068863_100097781 3300005841 Bacteria 2788
173 Ga0068863_100254405 3300005841 Unclassified 1697
174 Ga0068863_100716373 3300005841 Bacteria 995
175 Ga0068863_100891173 3300005841 Bacteria 890
176 Ga0068863_101227699 3300005841 Unclassified 756
177 Ga0068858_100004286 3300005842 Bacteria 14032
178 Ga0068858_100092637 3300005842 Bacteria 2813
179 Ga0068858_100864207 3300005842 Bacteria 884
180 Ga0068858_100880210 3300005842 Unclassified 875
181 Ga0068860_100002611 3300005843 Bacteria 18829
182 Ga0068860_100008715 3300005843 Bacteria 10101
183 Ga0068860_100026008 3300005843 Bacteria 5645
184 Ga0068860_100045977 3300005843 Bacteria 4163
185 Ga0068860_100134942 3300005843 Bacteria 2370
186 Ga0068860_100454837 3300005843 Bacteria 1273
187 Ga0068860_100615053 3300005843 Bacteria 1093
188 Ga0068862_100021507 3300005844 Bacteria 5391
189 Ga0068862_100303002 3300005844 Unclassified 1471
190 Ga0068862_100460941 3300005844 Bacteria 1200
191 Ga0068862_100764600 3300005844 Unclassified 941
192 Ga0068862_100855000 3300005844 Bacteria 892
193 Ga0068862_101703507 3300005844 Bacteria 639
194 Ga0081539_10051231 3300005985 Bacteria 2329
195 Ga0097621_100016333 3300006237 Bacteria 5609
196 Ga0097621_100051706 3300006237 Bacteria 3344
197 Ga0097621_100223238 3300006237 Bacteria 1642
198 Ga0097621_100430398 3300006237 Bacteria 1186
199 Ga0068871_100008063 3300006358 Bacteria 7559
200 Ga0068871_100020720 3300006358 Bacteria 5042
201 Ga0068871_100140045 3300006358 Bacteria 2057
202 Ga0068871_100295650 3300006358 Bacteria 1420
203 Ga0068871_100401329 3300006358 Bacteria 1221
204 Ga0068871_100878430 3300006358 Bacteria 830
205 Ga0068871_101234288 3300006358 Bacteria 702
206 Ga0075434_100037201 3300006871 Bacteria 4818
207 Ga0075434_100235685 3300006871 Bacteria 1850
208 Ga0068865_100020121 3300006881 Bacteria 4328
209 Ga0068865_100124096 3300006881 Unclassified 1925
210 Ga0068865_100379989 3300006881 Bacteria 1152
211 Ga0068865_100441889 3300006881 Bacteria 1074
212 Ga0097620_100000098 3300006931 Bacteria 80555
213 Ga0097620_100017190 3300006931 Bacteria 7262
214 Ga0097620_100029305 3300006931 Bacteria 5523
215 Ga0097620_100107033 3300006931 Bacteria 2856
216 Ga0105251_10090997 3300009011 Bacteria 1402
217 Ga0105240_10048921 3300009093 Bacteria 5341
218 Ga0105240_10961135 3300009093 Unclassified 916
219 Ga0111539_10005240 3300009094 Bacteria 16795
220 Ga0111539_12463630 3300009094 Bacteria 603
221 Ga0105247_10001541 3300009101 Bacteria 16441
222 Ga0105247_10013490 3300009101 Bacteria 4900
223 Ga0105247_10412456 3300009101 Unclassified 965
224 Ga0114129_11345854 3300009147 Bacteria 883
225 Ga0105243_11268000 3300009148 Bacteria 753
226 Ga0105243_11790766 3300009148 Bacteria 645
227 Ga0105241_10000426 3300009174 Bacteria 31864
228 Ga0105241_11872309 3300009174 Bacteria 587
229 Ga0105242_10166195 3300009176 Bacteria 1936
230 Ga0105242_10280303 3300009176 Bacteria 1514
231 Ga0105242_11197425 3300009176 Bacteria 779
232 Ga0105248_10398613 3300009177 Bacteria 1549
233 Ga0105248_11149122 3300009177 Bacteria 878
234 Ga0105237_10003853 3300009545 Bacteria 17642
235 Ga0105237_11575508 3300009545 Unclassified 664
236 Ga0105238_10684152 3300009551 Bacteria 1037
237 Ga0105238_12395115 3300009551 Bacteria 563
238 Ga0105249_10010747 3300009553 Bacteria 8043
239 Ga0105249_10130739 3300009553 Bacteria 2396
240 Ga0105249_10338112 3300009553 Bacteria 1521
241 Ga0105249_10533259 3300009553 Bacteria 1223
242 Ga0105249_10756495 3300009553 Bacteria 1034
243 Ga0105249_11369420 3300009553 Bacteria 779
244 Ga0105239_10068708 3300010375 Bacteria 3894
245 Ga0105239_10162361 3300010375 Unclassified 2497
246 Ga0105239_10995713 3300010375 Bacteria 964
247 Ga0105246_10114368 3300011119 Bacteria 1988
248 Ga0105246_10159395 3300011119 Bacteria 1717
249 Ga0105246_10189621 3300011119 Bacteria 1590
250 Ga0105246_10212276 3300011119 Bacteria 1511
251 Ga0157373_10198175 3300013100 Bacteria 1416
252 Ga0157371_10219816 3300013102 Bacteria 1364
253 Ga0157371_10252605 3300013102 Bacteria 1270
254 Ga0157370_10033924 3300013104 Bacteria 4973
255 Ga0157370_10122963 3300013104 Bacteria 2423
256 Ga0157369_10163444 3300013105 Bacteria 2349
257 Ga0157374_10001178 3300013296 Bacteria 22309
258 Ga0157374_10003276 3300013296 Bacteria 13602
259 Ga0157374_10016837 3300013296 Bacteria 6431
260 Ga0157374_10161296 3300013296 Bacteria 2184
261 Ga0157374_10330887 3300013296 Bacteria 1511
262 Ga0157374_10463820 3300013296 Bacteria 1269
263 Ga0157374_10513506 3300013296 Bacteria 1204
264 Ga0157378_10013365 3300013297 Bacteria 7174
265 Ga0157378_10039647 3300013297 Bacteria 4178
266 Ga0157378_10103242 3300013297 Bacteria 2604
267 Ga0157378_10140437 3300013297 Bacteria 2243
268 Ga0157378_10149757 3300013297 Bacteria 2173
269 Ga0157378_10175160 3300013297 Unclassified 2014
270 Ga0157378_10181199 3300013297 Bacteria 1982
271 Ga0157378_10982791 3300013297 Bacteria 878
272 Ga0157378_11427737 3300013297 Bacteria 735
273 Ga0163162_10000376 3300013306 Bacteria 40621
274 Ga0163162_10000736 3300013306 Bacteria 30393
275 Ga0163162_10010551 3300013306 Bacteria 8986
276 Ga0163162_10054037 3300013306 Bacteria 4038
277 Ga0163162_10481685 3300013306 Bacteria 1372
278 Ga0157372_10029125 3300013307 Bacteria 6026
279 Ga0157372_10330320 3300013307 Unclassified 1775
280 Ga0157375_10018253 3300013308 Bacteria 6358
281 Ga0157375_10058827 3300013308 Bacteria 3804
282 Ga0157375_10136843 3300013308 Bacteria 2574
283 Ga0157375_10690609 3300013308 Bacteria 1175
284 Ga0157375_10697553 3300013308 Bacteria 1169
285 Ga0157375_10771258 3300013308 Bacteria 1112
286 Ga0163163_10000803 3300014325 Bacteria 26650
287 Ga0163163_10020169 3300014325 Bacteria 6274
288 Ga0163163_10066461 3300014325 Bacteria 3581
289 Ga0163163_10311616 3300014325 Bacteria 1627
290 Ga0163163_10481930 3300014325 Unclassified 1301
291 Ga0157380_10001088 3300014326 Bacteria 17471
292 Ga0157380_10499069 3300014326 Bacteria 1182
293 Ga0157380_11149194 3300014326 Bacteria 818
294 Ga0157377_10003528 3300014745 Bacteria 7082
295 Ga0157377_10009333 3300014745 Bacteria 4807
296 Ga0157377_10752952 3300014745 Unclassified 713
297 Ga0157379_10019184 3300014968 Bacteria 6038
298 Ga0157379_10067509 3300014968 Bacteria 3196
299 Ga0157379_10118413 3300014968 Bacteria 2382
300 Ga0157379_10164988 3300014968 Bacteria 1999
301 Ga0157379_10534521 3300014968 Unclassified 1089
302 Ga0157376_10005350 3300014969 Bacteria 8966
303 Ga0157376_10040197 3300014969 Bacteria 3821
304 Ga0157376_10175906 3300014969 Unclassified 1952
305 Ga0157376_10633658 3300014969 Bacteria 1068
306 Ga0163161_10015385 3300017792 Bacteria 5333
307 Ga0163161_10031511 3300017792 Bacteria 3778
308 Ga0163161_10552201 3300017792 Bacteria 944
309 Ga0163161_11131023 3300017792 Unclassified 674
310 Ga0207656_10012767 3300025321 Bacteria 3198
311 Ga0207656_10214160 3300025321 Unclassified 935
312 Ga0207656_10350670 3300025321 Unclassified 737
313 Ga0207656_10373891 3300025321 Bacteria 714
314 Ga0207682_10366974 3300025893 Bacteria 679
315 Ga0207710_10005089 3300025900 Bacteria 5686
316 Ga0207710_10269568 3300025900 Bacteria 855
317 Ga0207680_10000408 3300025903 Bacteria 20509
318 Ga0207680_10352936 3300025903 Unclassified 1033
319 Ga0207647_10391571 3300025904 Bacteria 784
320 Ga0207645_10023001 3300025907 Bacteria 4050
321 Ga0207645_10060151 3300025907 Bacteria 2426
322 Ga0207645_10273148 3300025907 Bacteria 1121
323 Ga0207645_10929660 3300025907 Bacteria 590
324 Ga0207643_10019785 3300025908 Bacteria 3689
325 Ga0207705_10692879 3300025909 Bacteria 792
326 Ga0207654_10001077 3300025911 Bacteria 14842
327 Ga0207695_10135298 3300025913 Bacteria 2418
328 Ga0207671_10002175 3300025914 Bacteria 21298
329 Ga0207662_10005885 3300025918 Bacteria 6578
330 Ga0207657_10007407 3300025919 Bacteria 11251
331 Ga0207649_10063136 3300025920 Bacteria 2337
332 Ga0207649_10191759 3300025920 Bacteria 1438
333 Ga0207649_11064074 3300025920 Unclassified 638
334 Ga0207681_10039871 3300025923 Bacteria 3121
335 Ga0207681_10535680 3300025923 Unclassified 962
336 Ga0207694_10163744 3300025924 Bacteria 1798
337 Ga0207650_10077238 3300025925 Bacteria 2517
338 Ga0207650_10081238 3300025925 Bacteria 2459
339 Ga0207650_10298638 3300025925 Bacteria 1315
340 Ga0207659_10017079 3300025926 Bacteria 4735
341 Ga0207659_10029977 3300025926 Bacteria 3712
342 Ga0207659_10463171 3300025926 Bacteria 1069
343 Ga0207644_10078537 3300025931 Bacteria 2433
344 Ga0207644_10119438 3300025931 Bacteria 2005
345 Ga0207644_10159171 3300025931 Bacteria 1754
346 Ga0207644_11352541 3300025931 Bacteria 598
347 Ga0207690_10195032 3300025932 Bacteria 1534
348 Ga0207706_10005971 3300025933 Bacteria 11327
349 Ga0207706_10009126 3300025933 Bacteria 9119
350 Ga0207706_10016466 3300025933 Bacteria 6673
351 Ga0207706_10025117 3300025933 Bacteria 5341
352 Ga0207706_10027500 3300025933 Bacteria 5085
353 Ga0207706_10045334 3300025933 Bacteria 3896
354 Ga0207686_10070740 3300025934 Bacteria 2243
355 Ga0207686_10457723 3300025934 Bacteria 983
356 Ga0207670_10005049 3300025936 Bacteria 7197
357 Ga0207670_10309951 3300025936 Bacteria 1239
358 Ga0207669_10072199 3300025937 Unclassified 2172
359 Ga0207704_10448344 3300025938 Bacteria 1029
360 Ga0207704_10819666 3300025938 Bacteria 778
361 Ga0207691_10027432 3300025940 Bacteria 5339
362 Ga0207691_10036564 3300025940 Bacteria 4550
363 Ga0207691_10172245 3300025940 Bacteria 1895
364 Ga0207691_11328944 3300025940 Bacteria 593
365 Ga0207711_10870663 3300025941 Bacteria 838
366 Ga0207689_10000357 3300025942 Bacteria 42953
367 Ga0207689_10005824 3300025942 Bacteria 10929
368 Ga0207689_10032834 3300025942 Bacteria 4314
369 Ga0207689_10033210 3300025942 Bacteria 4288
370 Ga0207689_10039976 3300025942 Bacteria 3882
371 Ga0207689_10056654 3300025942 Bacteria 3226
372 Ga0207689_10099900 3300025942 Bacteria 2384
373 Ga0207689_10168409 3300025942 Bacteria 1805
374 Ga0207689_10366272 3300025942 Bacteria 1199
375 Ga0207661_10007258 3300025944 Bacteria 7882
376 Ga0207661_10263569 3300025944 Bacteria 1536
377 Ga0207679_10001099 3300025945 Bacteria 17218
378 Ga0207679_10044056 3300025945 Bacteria 3217
379 Ga0207679_10062335 3300025945 Bacteria 2778
380 Ga0207679_10072030 3300025945 Bacteria 2609
381 Ga0207679_10701647 3300025945 Bacteria 918
382 Ga0207679_11499553 3300025945 Bacteria 618
383 Ga0207667_10834209 3300025949 Unclassified 917
384 Ga0207651_10029891 3300025960 Bacteria 3461
385 Ga0207651_10844884 3300025960 Bacteria 813
386 Ga0207651_10920367 3300025960 Unclassified 779
387 Ga0207651_11057830 3300025960 Bacteria 726
388 Ga0207712_10025486 3300025961 Bacteria 3929
389 Ga0207712_10100105 3300025961 Bacteria 2153
390 Ga0207712_10111280 3300025961 Bacteria 2055
391 Ga0207712_10591562 3300025961 Bacteria 959
392 Ga0207712_10629673 3300025961 Bacteria 930
393 Ga0207640_10510058 3300025981 Bacteria 1003
394 Ga0207640_10930226 3300025981 Unclassified 761
395 Ga0207658_10008823 3300025986 Bacteria 6842
396 Ga0207658_10023335 3300025986 Bacteria 4318
397 Ga0207658_10056508 3300025986 Bacteria 2913
398 Ga0207658_10480892 3300025986 Bacteria 1103
399 Ga0207658_10823618 3300025986 Unclassified 843
400 Ga0207658_10909375 3300025986 Bacteria 801
401 Ga0207658_10994695 3300025986 Bacteria 765
402 Ga0207677_10016641 3300026023 Bacteria 4361
403 Ga0207677_10065714 3300026023 Bacteria 2532
404 Ga0207677_10253187 3300026023 Bacteria 1431
405 Ga0207677_10308344 3300026023 Bacteria 1310
406 Ga0207677_10396310 3300026023 Bacteria 1169
407 Ga0207703_10010057 3300026035 Bacteria 7417
408 Ga0207703_10814995 3300026035 Unclassified 892
409 Ga0207639_10009624 3300026041 Bacteria 6675
410 Ga0207678_10036598 3300026067 Bacteria 4273
411 Ga0207708_10133349 3300026075 Bacteria 1944
412 Ga0207702_10081890 3300026078 Bacteria 2804
413 Ga0207641_10000840 3300026088 Bacteria 32683
414 Ga0207641_10228015 3300026088 Unclassified 1730
415 Ga0207641_11426865 3300026088 Bacteria 693
416 Ga0207648_10000260 3300026089 Bacteria 57280
417 Ga0207648_10028135 3300026089 Bacteria 4985
418 Ga0207648_10047679 3300026089 Bacteria 3754
419 Ga0207648_10134595 3300026089 Bacteria 2177
420 Ga0207648_11294324 3300026089 Bacteria 685
421 Ga0207676_10006164 3300026095 Bacteria 8467
422 Ga0207676_10010000 3300026095 Bacteria 6750
423 Ga0207676_10148514 3300026095 Bacteria 2016
424 Ga0207676_10188657 3300026095 Bacteria 1812
425 Ga0207676_10500712 3300026095 Bacteria 1153
426 Ga0207674_10010177 3300026116 Bacteria 10684
427 Ga0207674_10028171 3300026116 Bacteria 5933
428 Ga0207674_10031851 3300026116 Bacteria 5535
429 Ga0207674_10120100 3300026116 Bacteria 2596
430 Ga0207675_100272606 3300026118 Unclassified 1642
431 Ga0207675_100565406 3300026118 Bacteria 1137
432 Ga0207675_101092581 3300026118 Bacteria 817
433 Ga0207675_102238857 3300026118 Unclassified 561
434 Ga0207683_10206554 3300026121 Bacteria 1786
435 Ga0207683_10223201 3300026121 Bacteria 1717
436 Ga0207683_10800128 3300026121 Unclassified 875
437 Ga0207698_10039278 3300026142 Bacteria 3505
438 Ga0207698_10126944 3300026142 Bacteria 2171
439 Ga0207698_10131433 3300026142 Bacteria 2140
440 Ga0207698_10140495 3300026142 Bacteria 2080
441 Ga0207698_10152213 3300026142 Bacteria 2009
442 Ga0207698_11226344 3300026142 Bacteria 764
443 Ga0268266_10851392 3300028379 Unclassified 881
444 Ga0268265_10157833 3300028380 Bacteria 1922
445 Ga0268265_10330079 3300028380 Bacteria 1385
446 Ga0268265_10555233 3300028380 Bacteria 1091
447 Ga0268265_11774680 3300028380 Bacteria 623
448 Ga0268264_10001002 3300028381 Bacteria 28669
449 Ga0268264_10009470 3300028381 Bacteria 8066
450 Ga0268264_10012477 3300028381 Bacteria 6996
451 Ga0268264_10038853 3300028381 Bacteria 3930
452 Ga0268264_10197594 3300028381 Bacteria 1837
453 Ga0268264_10570317 3300028381 Bacteria 1112
454 Ga0268264_11102970 3300028381 Bacteria 802
455 Ga0307515_10000261 3300028794 Bacteria 130891
456 Ga0307515_10000341 3300028794 Bacteria 115360
457 Ga0307511_10043258 3300030521 Bacteria 3767
458 Ga0307410_10176308 3300031852 Bacteria 1615
459 Ga0307410_10638160 3300031852 Bacteria 892
460 Ga0307412_10076112 3300031911 Bacteria 2305
461 Ga0307414_10028618 3300032004 Bacteria 3617
462 Ga0373929_0077533 3300035085 Bacteria 805
463 Ga0373943_0635816 3300035170 Bacteria 630
464 Ga0373961_0185911 3300035241 Bacteria 726
465 Ga0373924_0005029 3300035410 Bacteria 4654
466 Ga0373935_0291043 3300035692 Bacteria 1152
467 Ga0373937_0006347 3300036401 Bacteria 10197
468 Ga0395901_0657873 3300038443 Bacteria 1050
469 Ga0439439_0096742 3300041406 Unclassified 810
470 Ga0439461_0073576 3300041410 Bacteria 796
471 Ga0451797_1480866 3300041453 Bacteria 726
472 Ga0451795_0884481 3300041456 Bacteria 894
473 Ga0451807_1052453 3300041486 Bacteria 880
474 Ga0451843_0124940 3300041509 Bacteria 1245
475 Ga0451853_1526035 3300041512 Bacteria 1071
476 Ga0451853_2401845 3300041512 Bacteria 614
477 Ga0439431_0121515 3300041997 Bacteria 729
478 Ga0439442_064576 3300042002 Bacteria 777
479 Ga0439445_0001791 3300042004 Bacteria 4736
480 Ga0439457_005680 3300042014 Bacteria 3108
481 Ga0439462_0006414 3300042015 Bacteria 2923
482 Ga0439458_0081941 3300042157 Unclassified 824
483 Ga0451577_0006025 3300042876 Bacteria 12208
484 Ga0453684_0071138 3300044712 Bacteria 4400
485 Ga0453684_0125470 3300044712 Bacteria 3091
486 Ga0451576_0285613 3300045051 Bacteria 1725
487 Ga0466967_0390970 3300045976 Bacteria 1352
488 Ga0495592_0101286 3300046454 Bacteria 2052
489 Ga0495638_0447680 3300046460 Bacteria 660
490 Ga0495653_0075413 3300046463 Bacteria 2510
491 Ga0495608_0035877 3300046511 Bacteria 3341
492 Ga0495618_0030947 3300046514 Bacteria 3345
493 Ga0495628_0342413 3300046516 Unclassified 1100
494 Ga0495630_0062747 3300046517 Bacteria 2791
495 Ga0495640_0213239 3300046533 Unclassified 1220
496 Ga0495587_0095593 3300046536 Bacteria 1715
497 Ga0495598_0226103 3300046537 Bacteria 685
498 Ga0495621_0169060 3300046539 Bacteria 868
499 Ga0495668_0001819 3300046616 Bacteria 19357
500 Ga0495634_0173686 3300046642 Unclassified 1353
501 Ga0495635_0253714 3300046663 Unclassified 1185
502 Ga0495657_0241154 3300046675 Bacteria 1091
503 Ga0495599_0090021 3300046678 Bacteria 1915
504 Ga0495604_0149068 3300047317 Bacteria 1664
505 Ga0495672_0012400 3300047320 Bacteria 5951
506 Ga0495680_0110301 3300047322 Bacteria 2040
507 Ga0495684_0194478 3300047471 Bacteria 1498
508 Ga0495686_0005149 3300047472 Bacteria 10420
509 Ga0495686_0359791 3300047472 Unclassified 789
510 Ga0496101_0240518 3300048904 Bacteria 1409
511 Ga0496106_0250916 3300048909 Bacteria 1415
512 Ga0496110_0174449 3300048913 Bacteria 1951
513 Ga0496111_0164505 3300048914 Unclassified 1648
514 Ga0496113_1139452 3300048916 Unclassified 611
515 Ga0496114_0334913 3300048917 Bacteria 1338
516 Ga0501290_017505 3300049513 Bacteria 960
517 Ga0501300_025582 3300049523 Bacteria 866
518 Ga0501032_0030141 3300049569 Bacteria 3721
519 Ga0501034_0002546 3300049571 Bacteria 21767
520 Ga0501034_0522874 3300049571 Bacteria 1098
521 Ga0501036_0005747 3300049572 Bacteria 10058
522 Ga0501037_0134694 3300049573 Bacteria 1770
523 Ga0501038_0040428 3300049574 Bacteria 4073
524 Ga0501043_0004799 3300049579 Bacteria 10951
525 Ga0501043_0374069 3300049579 Bacteria 1080
526 Ga0501046_0016027 3300049580 Bacteria 6287
527 Ga0501047_0141683 3300049581 Bacteria 2282
528 Ga0501048_0033984 3300049582 Bacteria 3682
529 Ga0501069_0402858 3300049585 Bacteria 810
530 Ga0501070_0012235 3300049586 Bacteria 7241
531 Ga0501073_0002208 3300049589 Bacteria 14545
532 Ga0501074_0040824 3300049590 Bacteria 3359
533 Ga0501080_0147041 3300049742 Bacteria 2178
534 Ga0501083_0035233 3300049744 Bacteria 3419
535 Ga0501045_0201000 3300049824 Bacteria 1485
536 nmdc:mga0k408_10793_c1 3300050493 Bacteria 4952
537 nmdc:mga0k408_151620_c1 3300050493 Bacteria 668
538 nmdc:mga0k408_341989_c1 3300050493 Bacteria 892
539 nmdc:mga0k408_590487_c1 3300050493 Bacteria 655
540 nmdc:mga08y16_21771_c1 3300050511 Bacteria 6764
541 nmdc:mga0n895_261412_c1 3300050512 Bacteria 1756
542 Ga0500568_0003661 3300053139 Bacteria 8451
543 Ga0500611_000050 3300053727 Bacteria 54600
544 Ga0501084_0146976 3300054114 Bacteria 1986

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_12463630 Ga0111539_124636301 159
2 3300041456 Ga0451795_0884481 Ga0451795_0884481_237_722 159
3 3300049571 Ga0501034_0522874 Ga0501034_0522874_359_841 159
4 3300049579 Ga0501043_0374069 Ga0501043_0374069_231_713 159
5 3300005328 Ga0070676_10057214 Ga0070676_100572144 160
6 3300005334 Ga0068869_100016622 Ga0068869_1000166222 160
7 3300005344 Ga0070661_100080351 Ga0070661_1000803512 160
8 3300005354 Ga0070675_100163676 Ga0070675_1001636762 160
9 3300005356 Ga0070674_100108438 Ga0070674_1001084382 160
10 3300005459 Ga0068867_100055781 Ga0068867_1000557813 160
11 3300005459 Ga0068867_100116619 Ga0068867_1001166192 160
12 3300005539 Ga0068853_101400598 Ga0068853_1014005981 160
13 3300005719 Ga0068861_100477332 Ga0068861_1004773322 160
14 3300005841 Ga0068863_100254405 Ga0068863_1002544053 160
15 3300005843 Ga0068860_100134942 Ga0068860_1001349423 160
16 3300006237 Ga0097621_100051706 Ga0097621_1000517062 160
17 3300006881 Ga0068865_100020121 Ga0068865_1000201216 160
18 3300009551 Ga0105238_10684152 Ga0105238_106841522 160
19 3300009551 Ga0105238_12395115 Ga0105238_123951151 160
20 3300010375 Ga0105239_10162361 Ga0105239_101623613 160
21 3300013104 Ga0157370_10033924 Ga0157370_100339244 160
22 3300013297 Ga0157378_10175160 Ga0157378_101751602 160
23 3300013308 Ga0157375_10697553 Ga0157375_106975532 160
24 3300025907 Ga0207645_10060151 Ga0207645_100601512 160
25 3300025924 Ga0207694_10163744 Ga0207694_101637442 160
26 3300025937 Ga0207669_10072199 Ga0207669_100721992 160
27 3300025938 Ga0207704_10819666 Ga0207704_108196662 160
28 3300025942 Ga0207689_10099900 Ga0207689_100999004 160
29 3300025949 Ga0207667_10834209 Ga0207667_108342092 160
30 3300026078 Ga0207702_10081890 Ga0207702_100818903 160
31 3300026088 Ga0207641_10228015 Ga0207641_102280151 160
32 3300026089 Ga0207648_10000260 Ga0207648_1000026015 160
33 3300026118 Ga0207675_100272606 Ga0207675_1002726061 160
34 3300026118 Ga0207675_100565406 Ga0207675_1005654062 160
35 3300028381 Ga0268264_10197594 Ga0268264_101975942 160
36 3300031852 Ga0307410_10638160 Ga0307410_106381601 160
37 3300031911 Ga0307412_10076112 Ga0307412_100761122 160
38 3300046616 Ga0495668_0001819 Ga0495668_0001819_12347_12835 160
39 3300053139 Ga0500568_0003661 Ga0500568_0003661_5834_6316 160
40 2162886011 MRS1b_contig_4234355 MRS1b_0249.00000080 161
41 3300003320 rootH2_10014715 rootH2_100147152 161
42 3300005290 Ga0065712_10001567 Ga0065712_1000156712 161
43 3300005290 Ga0065712_10230060 Ga0065712_102300602 161
44 3300005293 Ga0065715_10481615 Ga0065715_104816151 161
45 3300005295 Ga0065707_10095485 Ga0065707_100954852 161
46 3300005295 Ga0065707_10204070 Ga0065707_102040702 161
47 3300005327 Ga0070658_10854429 Ga0070658_108544292 161
48 3300005328 Ga0070676_10028466 Ga0070676_100284663 161
49 3300005328 Ga0070676_10157646 Ga0070676_101576462 161
50 3300005328 Ga0070676_10248938 Ga0070676_102489381 161
51 3300005329 Ga0070683_100007696 Ga0070683_1000076963 161
52 3300005330 Ga0070690_100027358 Ga0070690_1000273581 161
53 3300005330 Ga0070690_100032740 Ga0070690_1000327402 161
54 3300005330 Ga0070690_100658722 Ga0070690_1006587221 161
55 3300005331 Ga0070670_100159752 Ga0070670_1001597522 161
56 3300005331 Ga0070670_100196739 Ga0070670_1001967391 161
57 3300005331 Ga0070670_100323070 Ga0070670_1003230702 161
58 3300005331 Ga0070670_100426597 Ga0070670_1004265972 161
59 3300005333 Ga0070677_10299603 Ga0070677_102996031 161
60 3300005334 Ga0068869_100001850 Ga0068869_1000018508 161
61 3300005334 Ga0068869_100009539 Ga0068869_1000095395 161
62 3300005334 Ga0068869_100037747 Ga0068869_1000377472 161
63 3300005334 Ga0068869_100234083 Ga0068869_1002340832 161
64 3300005334 Ga0068869_100416538 Ga0068869_1004165382 161
65 3300005334 Ga0068869_101623318 Ga0068869_1016233181 161
66 3300005335 Ga0070666_10000127 Ga0070666_1000012712 161
67 3300005335 Ga0070666_10014370 Ga0070666_100143705 161
68 3300005335 Ga0070666_10041325 Ga0070666_100413253 161
69 3300005335 Ga0070666_10268305 Ga0070666_102683052 161
70 3300005335 Ga0070666_10310223 Ga0070666_103102231 161
71 3300005335 Ga0070666_10400568 Ga0070666_104005682 161
72 3300005337 Ga0070682_100771364 Ga0070682_1007713642 161
73 3300005338 Ga0068868_100005670 Ga0068868_1000056703 161
74 3300005338 Ga0068868_100007552 Ga0068868_1000075522 161
75 3300005338 Ga0068868_100013219 Ga0068868_1000132195 161
76 3300005338 Ga0068868_100030307 Ga0068868_1000303073 161
77 3300005338 Ga0068868_100166603 Ga0068868_1001666033 161
78 3300005338 Ga0068868_100332300 Ga0068868_1003323002 161
79 3300005339 Ga0070660_100007829 Ga0070660_1000078292 161
80 3300005340 Ga0070689_100004423 Ga0070689_1000044235 161
81 3300005340 Ga0070689_100036841 Ga0070689_1000368411 161
82 3300005340 Ga0070689_100239541 Ga0070689_1002395412 161
83 3300005340 Ga0070689_100321672 Ga0070689_1003216722 161
84 3300005343 Ga0070687_100006493 Ga0070687_1000064931 161
85 3300005344 Ga0070661_100095021 Ga0070661_1000950212 161
86 3300005344 Ga0070661_100319900 Ga0070661_1003199002 161
87 3300005345 Ga0070692_10560040 Ga0070692_105600402 161
88 3300005347 Ga0070668_100058326 Ga0070668_1000583262 161
89 3300005353 Ga0070669_100035285 Ga0070669_1000352852 161
90 3300005353 Ga0070669_100218612 Ga0070669_1002186123 161
91 3300005354 Ga0070675_100022380 Ga0070675_1000223801 161
92 3300005354 Ga0070675_100076631 Ga0070675_1000766314 161
93 3300005354 Ga0070675_100196652 Ga0070675_1001966524 161
94 3300005354 Ga0070675_100211289 Ga0070675_1002112892 161
95 3300005354 Ga0070675_100764682 Ga0070675_1007646821 161
96 3300005354 Ga0070675_101406229 Ga0070675_1014062291 161
97 3300005355 Ga0070671_100018592 Ga0070671_1000185922 161
98 3300005355 Ga0070671_100063111 Ga0070671_1000631111 161
99 3300005355 Ga0070671_100650581 Ga0070671_1006505811 161
100 3300005356 Ga0070674_100443426 Ga0070674_1004434261 161
101 3300005356 Ga0070674_100695465 Ga0070674_1006954651 161
102 3300005364 Ga0070673_100010606 Ga0070673_1000106063 161
103 3300005364 Ga0070673_100037208 Ga0070673_1000372083 161
104 3300005364 Ga0070673_100043345 Ga0070673_1000433453 161
105 3300005364 Ga0070673_100190631 Ga0070673_1001906312 161
106 3300005365 Ga0070688_100057889 Ga0070688_1000578892 161
107 3300005365 Ga0070688_100062103 Ga0070688_1000621032 161
108 3300005366 Ga0070659_100014717 Ga0070659_1000147172 161
109 3300005366 Ga0070659_100642257 Ga0070659_1006422572 161
110 3300005367 Ga0070667_100007591 Ga0070667_1000075914 161
111 3300005367 Ga0070667_100013534 Ga0070667_1000135343 161
112 3300005367 Ga0070667_100063851 Ga0070667_1000638513 161
113 3300005367 Ga0070667_100079184 Ga0070667_1000791842 161
114 3300005367 Ga0070667_100094694 Ga0070667_1000946942 161
115 3300005367 Ga0070667_100235083 Ga0070667_1002350832 161
116 3300005367 Ga0070667_100905920 Ga0070667_1009059201 161
117 3300005367 Ga0070667_102121377 Ga0070667_1021213771 161
118 3300005434 Ga0070709_11300772 Ga0070709_113007721 161
119 3300005441 Ga0070700_100040779 Ga0070700_1000407792 161
120 3300005444 Ga0070694_100241642 Ga0070694_1002416421 161
121 3300005455 Ga0070663_100267403 Ga0070663_1002674032 161
122 3300005455 Ga0070663_100953625 Ga0070663_1009536251 161
123 3300005456 Ga0070678_100188610 Ga0070678_1001886102 161
124 3300005456 Ga0070678_100431151 Ga0070678_1004311511 161
125 3300005456 Ga0070678_100832695 Ga0070678_1008326952 161
126 3300005457 Ga0070662_100029275 Ga0070662_1000292752 161
127 3300005457 Ga0070662_100048370 Ga0070662_1000483701 161
128 3300005457 Ga0070662_100051142 Ga0070662_1000511423 161
129 3300005457 Ga0070662_100183776 Ga0070662_1001837762 161
130 3300005458 Ga0070681_10968836 Ga0070681_109688361 161
131 3300005459 Ga0068867_100013723 Ga0068867_1000137233 161
132 3300005459 Ga0068867_100028976 Ga0068867_1000289762 161
133 3300005459 Ga0068867_100152741 Ga0068867_1001527412 161
134 3300005459 Ga0068867_100190003 Ga0068867_1001900032 161
135 3300005459 Ga0068867_100436386 Ga0068867_1004363861 161
136 3300005459 Ga0068867_100573899 Ga0068867_1005738992 161
137 3300005466 Ga0070685_10252918 Ga0070685_102529182 161
138 3300005466 Ga0070685_10290596 Ga0070685_102905962 161
139 3300005535 Ga0070684_100003930 Ga0070684_1000039302 161
140 3300005535 Ga0070684_100111498 Ga0070684_1001114982 161
141 3300005535 Ga0070684_100304324 Ga0070684_1003043242 161
142 3300005535 Ga0070684_100454591 Ga0070684_1004545912 161
143 3300005539 Ga0068853_100007598 Ga0068853_1000075987 161
144 3300005539 Ga0068853_100141363 Ga0068853_1001413632 161
145 3300005539 Ga0068853_100572461 Ga0068853_1005724612 161
146 3300005539 Ga0068853_100885542 Ga0068853_1008855422 161
147 3300005543 Ga0070672_100013498 Ga0070672_1000134982 161
148 3300005543 Ga0070672_100084057 Ga0070672_1000840572 161
149 3300005543 Ga0070672_101652348 Ga0070672_1016523481 161
150 3300005544 Ga0070686_100016237 Ga0070686_1000162375 161
151 3300005544 Ga0070686_100341985 Ga0070686_1003419851 161
152 3300005544 Ga0070686_100899827 Ga0070686_1008998271 161
153 3300005544 Ga0070686_100941153 Ga0070686_1009411531 161
154 3300005548 Ga0070665_100153414 Ga0070665_1001534142 161
155 3300005548 Ga0070665_100993639 Ga0070665_1009936391 161
156 3300005563 Ga0068855_100859577 Ga0068855_1008595772 161
157 3300005564 Ga0070664_100023253 Ga0070664_1000232532 161
158 3300005564 Ga0070664_100029660 Ga0070664_1000296604 161
159 3300005564 Ga0070664_100141033 Ga0070664_1001410332 161
160 3300005564 Ga0070664_100143176 Ga0070664_1001431762 161
161 3300005564 Ga0070664_100146336 Ga0070664_1001463362 161
162 3300005564 Ga0070664_100415753 Ga0070664_1004157533 161
163 3300005564 Ga0070664_100487530 Ga0070664_1004875302 161
164 3300005564 Ga0070664_100716877 Ga0070664_1007168771 161
165 3300005577 Ga0068857_100012224 Ga0068857_1000122245 161
166 3300005577 Ga0068857_100024477 Ga0068857_1000244772 161
167 3300005577 Ga0068857_100063896 Ga0068857_1000638963 161
168 3300005578 Ga0068854_100019390 Ga0068854_1000193904 161
169 3300005578 Ga0068854_100049871 Ga0068854_1000498712 161
170 3300005578 Ga0068854_100342457 Ga0068854_1003424571 161
171 3300005578 Ga0068854_100555320 Ga0068854_1005553202 161
172 3300005616 Ga0068852_100033780 Ga0068852_1000337803 161
173 3300005616 Ga0068852_100044139 Ga0068852_1000441395 161
174 3300005616 Ga0068852_100045895 Ga0068852_1000458952 161
175 3300005616 Ga0068852_100049011 Ga0068852_1000490115 161
176 3300005616 Ga0068852_100356097 Ga0068852_1003560972 161
177 3300005616 Ga0068852_100468346 Ga0068852_1004683462 161
178 3300005617 Ga0068859_100000098 Ga0068859_10000009825 161
179 3300005617 Ga0068859_100017189 Ga0068859_1000171892 161
180 3300005617 Ga0068859_100029305 Ga0068859_1000293055 161
181 3300005617 Ga0068859_100107032 Ga0068859_1001070322 161
182 3300005618 Ga0068864_100034536 Ga0068864_1000345364 161
183 3300005618 Ga0068864_100068541 Ga0068864_1000685413 161
184 3300005618 Ga0068864_100098437 Ga0068864_1000984372 161
185 3300005719 Ga0068861_100022702 Ga0068861_1000227021 161
186 3300005719 Ga0068861_100597558 Ga0068861_1005975582 161
187 3300005719 Ga0068861_102378304 Ga0068861_1023783041 161
188 3300005834 Ga0068851_10084974 Ga0068851_100849742 161
189 3300005834 Ga0068851_10103289 Ga0068851_101032892 161
190 3300005834 Ga0068851_10256551 Ga0068851_102565512 161
191 3300005834 Ga0068851_10294544 Ga0068851_102945441 161
192 3300005834 Ga0068851_10326306 Ga0068851_103263062 161
193 3300005834 Ga0068851_10575016 Ga0068851_105750161 161
194 3300005840 Ga0068870_10032627 Ga0068870_100326271 161
195 3300005840 Ga0068870_10692720 Ga0068870_106927202 161
196 3300005841 Ga0068863_100002114 Ga0068863_1000021146 161
197 3300005841 Ga0068863_100097781 Ga0068863_1000977813 161
198 3300005841 Ga0068863_100716373 Ga0068863_1007163732 161
199 3300005841 Ga0068863_100891173 Ga0068863_1008911731 161
200 3300005841 Ga0068863_101227699 Ga0068863_1012276992 161
201 3300005842 Ga0068858_100004286 Ga0068858_1000042863 161
202 3300005842 Ga0068858_100092637 Ga0068858_1000926374 161
203 3300005842 Ga0068858_100864207 Ga0068858_1008642072 161
204 3300005842 Ga0068858_100880210 Ga0068858_1008802102 161
205 3300005843 Ga0068860_100002611 Ga0068860_10000261121 161
206 3300005843 Ga0068860_100008715 Ga0068860_1000087155 161
207 3300005843 Ga0068860_100026008 Ga0068860_1000260086 161
208 3300005843 Ga0068860_100045977 Ga0068860_1000459774 161
209 3300005843 Ga0068860_100454837 Ga0068860_1004548372 161
210 3300005843 Ga0068860_100615053 Ga0068860_1006150532 161
211 3300005844 Ga0068862_100021507 Ga0068862_1000215077 161
212 3300005844 Ga0068862_100460941 Ga0068862_1004609412 161
213 3300005844 Ga0068862_100764600 Ga0068862_1007646002 161
214 3300005844 Ga0068862_100855000 Ga0068862_1008550002 161
215 3300005844 Ga0068862_101703507 Ga0068862_1017035071 161
216 3300005985 Ga0081539_10051231 Ga0081539_100512313 161
217 3300006237 Ga0097621_100016333 Ga0097621_1000163335 161
218 3300006237 Ga0097621_100223238 Ga0097621_1002232382 161
219 3300006237 Ga0097621_100430398 Ga0097621_1004303982 161
220 3300006358 Ga0068871_100008063 Ga0068871_1000080636 161
221 3300006358 Ga0068871_100020720 Ga0068871_1000207204 161
222 3300006358 Ga0068871_100140045 Ga0068871_1001400453 161
223 3300006358 Ga0068871_100295650 Ga0068871_1002956502 161
224 3300006358 Ga0068871_100401329 Ga0068871_1004013292 161
225 3300006358 Ga0068871_100878430 Ga0068871_1008784302 161
226 3300006358 Ga0068871_101234288 Ga0068871_1012342882 161
227 3300006871 Ga0075434_100037201 Ga0075434_1000372014 161
228 3300006871 Ga0075434_100235685 Ga0075434_1002356852 161
229 3300006881 Ga0068865_100124096 Ga0068865_1001240964 161
230 3300006881 Ga0068865_100379989 Ga0068865_1003799893 161
231 3300006881 Ga0068865_100441889 Ga0068865_1004418892 161
232 3300006931 Ga0097620_100000098 Ga0097620_10000009825 161
233 3300006931 Ga0097620_100017190 Ga0097620_1000171902 161
234 3300006931 Ga0097620_100029305 Ga0097620_1000293055 161
235 3300006931 Ga0097620_100107033 Ga0097620_1001070332 161
236 3300009011 Ga0105251_10090997 Ga0105251_100909971 161
237 3300009093 Ga0105240_10048921 Ga0105240_100489212 161
238 3300009093 Ga0105240_10961135 Ga0105240_109611352 161
239 3300009094 Ga0111539_10005240 Ga0111539_1000524015 161
240 3300009101 Ga0105247_10001541 Ga0105247_100015413 161
241 3300009101 Ga0105247_10013490 Ga0105247_100134902 161
242 3300009101 Ga0105247_10412456 Ga0105247_104124562 161
243 3300009147 Ga0114129_11345854 Ga0114129_113458542 161
244 3300009148 Ga0105243_11268000 Ga0105243_112680001 161
245 3300009148 Ga0105243_11790766 Ga0105243_117907661 161
246 3300009174 Ga0105241_10000426 Ga0105241_1000042619 161
247 3300009174 Ga0105241_11872309 Ga0105241_118723091 161
248 3300009176 Ga0105242_10166195 Ga0105242_101661952 161
249 3300009176 Ga0105242_10280303 Ga0105242_102803032 161
250 3300009176 Ga0105242_11197425 Ga0105242_111974252 161
251 3300009177 Ga0105248_10398613 Ga0105248_103986132 161
252 3300009177 Ga0105248_11149122 Ga0105248_111491222 161
253 3300009545 Ga0105237_10003853 Ga0105237_1000385311 161
254 3300009545 Ga0105237_11575508 Ga0105237_115755082 161
255 3300009553 Ga0105249_10010747 Ga0105249_100107476 161
256 3300009553 Ga0105249_10130739 Ga0105249_101307392 161
257 3300009553 Ga0105249_10338112 Ga0105249_103381121 161
258 3300009553 Ga0105249_10533259 Ga0105249_105332592 161
259 3300009553 Ga0105249_10756495 Ga0105249_107564952 161
260 3300009553 Ga0105249_11369420 Ga0105249_113694202 161
261 3300010375 Ga0105239_10068708 Ga0105239_100687084 161
262 3300010375 Ga0105239_10995713 Ga0105239_109957132 161
263 3300011119 Ga0105246_10114368 Ga0105246_101143683 161
264 3300011119 Ga0105246_10159395 Ga0105246_101593952 161
265 3300011119 Ga0105246_10189621 Ga0105246_101896212 161
266 3300011119 Ga0105246_10212276 Ga0105246_102122763 161
267 3300013100 Ga0157373_10198175 Ga0157373_101981752 161
268 3300013102 Ga0157371_10219816 Ga0157371_102198162 161
269 3300013102 Ga0157371_10252605 Ga0157371_102526052 161
270 3300013104 Ga0157370_10122963 Ga0157370_101229631 161
271 3300013105 Ga0157369_10163444 Ga0157369_101634442 161
272 3300013296 Ga0157374_10001178 Ga0157374_1000117816 161
273 3300013296 Ga0157374_10003276 Ga0157374_100032767 161
274 3300013296 Ga0157374_10016837 Ga0157374_100168372 161
275 3300013296 Ga0157374_10161296 Ga0157374_101612962 161
276 3300013296 Ga0157374_10330887 Ga0157374_103308872 161
277 3300013296 Ga0157374_10463820 Ga0157374_104638202 161
278 3300013296 Ga0157374_10513506 Ga0157374_105135062 161
279 3300013297 Ga0157378_10013365 Ga0157378_100133656 161
280 3300013297 Ga0157378_10039647 Ga0157378_100396473 161
281 3300013297 Ga0157378_10103242 Ga0157378_101032422 161
282 3300013297 Ga0157378_10140437 Ga0157378_101404374 161
283 3300013297 Ga0157378_10149757 Ga0157378_101497572 161
284 3300013297 Ga0157378_10181199 Ga0157378_101811992 161
285 3300013297 Ga0157378_10982791 Ga0157378_109827912 161
286 3300013297 Ga0157378_11427737 Ga0157378_114277371 161
287 3300013306 Ga0163162_10000376 Ga0163162_1000037619 161
288 3300013306 Ga0163162_10000736 Ga0163162_1000073617 161
289 3300013306 Ga0163162_10010551 Ga0163162_100105517 161
290 3300013306 Ga0163162_10054037 Ga0163162_100540373 161
291 3300013306 Ga0163162_10481685 Ga0163162_104816852 161
292 3300013307 Ga0157372_10029125 Ga0157372_100291254 161
293 3300013307 Ga0157372_10330320 Ga0157372_103303202 161
294 3300013308 Ga0157375_10018253 Ga0157375_100182537 161
295 3300013308 Ga0157375_10058827 Ga0157375_100588274 161
296 3300013308 Ga0157375_10136843 Ga0157375_101368432 161
297 3300013308 Ga0157375_10771258 Ga0157375_107712582 161
298 3300014325 Ga0163163_10000803 Ga0163163_100008039 161
299 3300014325 Ga0163163_10020169 Ga0163163_100201695 161
300 3300014325 Ga0163163_10066461 Ga0163163_100664615 161
301 3300014325 Ga0163163_10311616 Ga0163163_103116162 161
302 3300014325 Ga0163163_10481930 Ga0163163_104819301 161
303 3300014326 Ga0157380_10001088 Ga0157380_100010886 161
304 3300014326 Ga0157380_10499069 Ga0157380_104990691 161
305 3300014326 Ga0157380_11149194 Ga0157380_111491941 161
306 3300014745 Ga0157377_10003528 Ga0157377_100035285 161
307 3300014745 Ga0157377_10009333 Ga0157377_100093332 161
308 3300014745 Ga0157377_10752952 Ga0157377_107529522 161
309 3300014968 Ga0157379_10019184 Ga0157379_100191847 161
310 3300014968 Ga0157379_10067509 Ga0157379_100675093 161
311 3300014968 Ga0157379_10118413 Ga0157379_101184133 161
312 3300014968 Ga0157379_10164988 Ga0157379_101649882 161
313 3300014968 Ga0157379_10534521 Ga0157379_105345211 161
314 3300014969 Ga0157376_10005350 Ga0157376_100053509 161
315 3300014969 Ga0157376_10040197 Ga0157376_100401973 161
316 3300014969 Ga0157376_10175906 Ga0157376_101759062 161
317 3300014969 Ga0157376_10633658 Ga0157376_106336582 161
318 3300017792 Ga0163161_10015385 Ga0163161_100153855 161
319 3300017792 Ga0163161_10031511 Ga0163161_100315112 161
320 3300017792 Ga0163161_10552201 Ga0163161_105522012 161
321 3300017792 Ga0163161_11131023 Ga0163161_111310231 161
322 3300025321 Ga0207656_10012767 Ga0207656_100127673 161
323 3300025321 Ga0207656_10214160 Ga0207656_102141601 161
324 3300025321 Ga0207656_10350670 Ga0207656_103506701 161
325 3300025893 Ga0207682_10366974 Ga0207682_103669741 161
326 3300025900 Ga0207710_10005089 Ga0207710_100050895 161
327 3300025900 Ga0207710_10269568 Ga0207710_102695681 161
328 3300025903 Ga0207680_10000408 Ga0207680_1000040811 161
329 3300025903 Ga0207680_10352936 Ga0207680_103529362 161
330 3300025904 Ga0207647_10391571 Ga0207647_103915712 161
331 3300025907 Ga0207645_10023001 Ga0207645_100230015 161
332 3300025907 Ga0207645_10273148 Ga0207645_102731482 161
333 3300025907 Ga0207645_10929660 Ga0207645_109296601 161
334 3300025908 Ga0207643_10019785 Ga0207643_100197852 161
335 3300025909 Ga0207705_10692879 Ga0207705_106928792 161
336 3300025911 Ga0207654_10001077 Ga0207654_100010776 161
337 3300025913 Ga0207695_10135298 Ga0207695_101352983 161
338 3300025914 Ga0207671_10002175 Ga0207671_1000217514 161
339 3300025918 Ga0207662_10005885 Ga0207662_100058855 161
340 3300025919 Ga0207657_10007407 Ga0207657_100074078 161
341 3300025920 Ga0207649_10063136 Ga0207649_100631362 161
342 3300025920 Ga0207649_10191759 Ga0207649_101917591 161
343 3300025920 Ga0207649_11064074 Ga0207649_110640741 161
344 3300025923 Ga0207681_10039871 Ga0207681_100398715 161
345 3300025923 Ga0207681_10535680 Ga0207681_105356802 161
346 3300025925 Ga0207650_10077238 Ga0207650_100772382 161
347 3300025925 Ga0207650_10081238 Ga0207650_100812382 161
348 3300025925 Ga0207650_10298638 Ga0207650_102986381 161
349 3300025926 Ga0207659_10017079 Ga0207659_100170795 161
350 3300025926 Ga0207659_10029977 Ga0207659_100299772 161
351 3300025926 Ga0207659_10463171 Ga0207659_104631712 161
352 3300025931 Ga0207644_10078537 Ga0207644_100785372 161
353 3300025931 Ga0207644_10119438 Ga0207644_101194381 161
354 3300025931 Ga0207644_10159171 Ga0207644_101591712 161
355 3300025931 Ga0207644_11352541 Ga0207644_113525412 161
356 3300025932 Ga0207690_10195032 Ga0207690_101950322 161
357 3300025933 Ga0207706_10005971 Ga0207706_100059714 161
358 3300025933 Ga0207706_10009126 Ga0207706_1000912610 161
359 3300025933 Ga0207706_10016466 Ga0207706_100164665 161
360 3300025933 Ga0207706_10025117 Ga0207706_100251172 161
361 3300025933 Ga0207706_10027500 Ga0207706_100275002 161
362 3300025933 Ga0207706_10045334 Ga0207706_100453342 161
363 3300025934 Ga0207686_10070740 Ga0207686_100707402 161
364 3300025934 Ga0207686_10457723 Ga0207686_104577231 161
365 3300025936 Ga0207670_10005049 Ga0207670_100050494 161
366 3300025936 Ga0207670_10309951 Ga0207670_103099512 161
367 3300025938 Ga0207704_10448344 Ga0207704_104483442 161
368 3300025940 Ga0207691_10027432 Ga0207691_100274326 161
369 3300025940 Ga0207691_10036564 Ga0207691_100365644 161
370 3300025940 Ga0207691_10172245 Ga0207691_101722452 161
371 3300025940 Ga0207691_11328944 Ga0207691_113289442 161
372 3300025941 Ga0207711_10870663 Ga0207711_108706631 161
373 3300025942 Ga0207689_10000357 Ga0207689_1000035727 161
374 3300025942 Ga0207689_10005824 Ga0207689_100058247 161
375 3300025942 Ga0207689_10032834 Ga0207689_100328343 161
376 3300025942 Ga0207689_10033210 Ga0207689_100332105 161
377 3300025942 Ga0207689_10039976 Ga0207689_100399762 161
378 3300025942 Ga0207689_10056654 Ga0207689_100566543 161
379 3300025942 Ga0207689_10168409 Ga0207689_101684091 161
380 3300025942 Ga0207689_10366272 Ga0207689_103662722 161
381 3300025944 Ga0207661_10007258 Ga0207661_100072586 161
382 3300025944 Ga0207661_10263569 Ga0207661_102635693 161
383 3300025945 Ga0207679_10001099 Ga0207679_100010998 161
384 3300025945 Ga0207679_10044056 Ga0207679_100440562 161
385 3300025945 Ga0207679_10062335 Ga0207679_100623352 161
386 3300025945 Ga0207679_10072030 Ga0207679_100720302 161
387 3300025945 Ga0207679_10701647 Ga0207679_107016471 161
388 3300025945 Ga0207679_11499553 Ga0207679_114995531 161
389 3300025960 Ga0207651_10029891 Ga0207651_100298912 161
390 3300025960 Ga0207651_10844884 Ga0207651_108448841 161
391 3300025960 Ga0207651_10920367 Ga0207651_109203671 161
392 3300025960 Ga0207651_11057830 Ga0207651_110578301 161
393 3300025961 Ga0207712_10025486 Ga0207712_100254861 161
394 3300025961 Ga0207712_10100105 Ga0207712_101001052 161
395 3300025961 Ga0207712_10111280 Ga0207712_101112802 161
396 3300025961 Ga0207712_10591562 Ga0207712_105915622 161
397 3300025961 Ga0207712_10629673 Ga0207712_106296732 161
398 3300025981 Ga0207640_10510058 Ga0207640_105100582 161
399 3300025981 Ga0207640_10930226 Ga0207640_109302261 161
400 3300025986 Ga0207658_10008823 Ga0207658_100088235 161
401 3300025986 Ga0207658_10023335 Ga0207658_100233352 161
402 3300025986 Ga0207658_10056508 Ga0207658_100565083 161
403 3300025986 Ga0207658_10480892 Ga0207658_104808921 161
404 3300025986 Ga0207658_10823618 Ga0207658_108236182 161
405 3300025986 Ga0207658_10909375 Ga0207658_109093751 161
406 3300025986 Ga0207658_10994695 Ga0207658_109946952 161
407 3300026023 Ga0207677_10016641 Ga0207677_100166413 161
408 3300026023 Ga0207677_10065714 Ga0207677_100657143 161
409 3300026023 Ga0207677_10253187 Ga0207677_102531872 161
410 3300026023 Ga0207677_10308344 Ga0207677_103083442 161
411 3300026023 Ga0207677_10396310 Ga0207677_103963102 161
412 3300026035 Ga0207703_10010057 Ga0207703_100100578 161
413 3300026035 Ga0207703_10814995 Ga0207703_108149952 161
414 3300026041 Ga0207639_10009624 Ga0207639_100096242 161
415 3300026067 Ga0207678_10036598 Ga0207678_100365984 161
416 3300026075 Ga0207708_10133349 Ga0207708_101333492 161
417 3300026088 Ga0207641_10000840 Ga0207641_1000084020 161
418 3300026088 Ga0207641_11426865 Ga0207641_114268651 161
419 3300026089 Ga0207648_10028135 Ga0207648_100281353 161
420 3300026089 Ga0207648_10047679 Ga0207648_100476792 161
421 3300026089 Ga0207648_10134595 Ga0207648_101345952 161
422 3300026095 Ga0207676_10006164 Ga0207676_100061644 161
423 3300026095 Ga0207676_10010000 Ga0207676_100100002 161
424 3300026095 Ga0207676_10148514 Ga0207676_101485143 161
425 3300026095 Ga0207676_10188657 Ga0207676_101886571 161
426 3300026095 Ga0207676_10500712 Ga0207676_105007122 161
427 3300026116 Ga0207674_10010177 Ga0207674_100101774 161
428 3300026116 Ga0207674_10028171 Ga0207674_100281712 161
429 3300026116 Ga0207674_10031851 Ga0207674_100318514 161
430 3300026116 Ga0207674_10120100 Ga0207674_101201002 161
431 3300026118 Ga0207675_101092581 Ga0207675_1010925811 161
432 3300026118 Ga0207675_102238857 Ga0207675_1022388571 161
433 3300026121 Ga0207683_10206554 Ga0207683_102065542 161
434 3300026121 Ga0207683_10223201 Ga0207683_102232014 161
435 3300026121 Ga0207683_10800128 Ga0207683_108001281 161
436 3300026142 Ga0207698_10039278 Ga0207698_100392784 161
437 3300026142 Ga0207698_10126944 Ga0207698_101269441 161
438 3300026142 Ga0207698_10131433 Ga0207698_101314332 161
439 3300026142 Ga0207698_10140495 Ga0207698_101404952 161
440 3300026142 Ga0207698_10152213 Ga0207698_101522132 161
441 3300026142 Ga0207698_11226344 Ga0207698_112263442 161
442 3300028379 Ga0268266_10851392 Ga0268266_108513923 161
443 3300028380 Ga0268265_10157833 Ga0268265_101578332 161
444 3300028380 Ga0268265_10330079 Ga0268265_103300792 161
445 3300028380 Ga0268265_10555233 Ga0268265_105552332 161
446 3300028380 Ga0268265_11774680 Ga0268265_117746801 161
447 3300028381 Ga0268264_10001002 Ga0268264_1000100215 161
448 3300028381 Ga0268264_10009470 Ga0268264_100094702 161
449 3300028381 Ga0268264_10012477 Ga0268264_100124774 161
450 3300028381 Ga0268264_10038853 Ga0268264_100388531 161
451 3300028381 Ga0268264_10570317 Ga0268264_105703171 161
452 3300028381 Ga0268264_11102970 Ga0268264_111029701 161
453 3300028794 Ga0307515_10000261 Ga0307515_1000026151 161
454 3300028794 Ga0307515_10000341 Ga0307515_1000034110 161
455 3300030521 Ga0307511_10043258 Ga0307511_100432582 161
456 3300031852 Ga0307410_10176308 Ga0307410_101763083 161
457 3300032004 Ga0307414_10028618 Ga0307414_100286182 161
458 3300035085 Ga0373929_0077533 Ga0373929_0077533_133_618 161
459 3300035170 Ga0373943_0635816 Ga0373943_0635816_55_540 161
460 3300035241 Ga0373961_0185911 Ga0373961_0185911_50_535 161
461 3300035410 Ga0373924_0005029 Ga0373924_0005029_3743_4228 161
462 3300035692 Ga0373935_0291043 Ga0373935_0291043_473_958 161
463 3300036401 Ga0373937_0006347 Ga0373937_0006347_527_1012 161
464 3300038443 Ga0395901_0657873 Ga0395901_0657873_39_524 161
465 3300041406 Ga0439439_0096742 Ga0439439_0096742_165_650 161
466 3300041410 Ga0439461_0073576 Ga0439461_0073576_127_612 161
467 3300041453 Ga0451797_1480866 Ga0451797_1480866_44_529 161
468 3300041486 Ga0451807_1052453 Ga0451807_1052453_143_637 161
469 3300041509 Ga0451843_0124940 Ga0451843_0124940_127_612 161
470 3300041512 Ga0451853_1526035 Ga0451853_1526035_149_634 161
471 3300041512 Ga0451853_2401845 Ga0451853_2401845_99_584 161
472 3300041997 Ga0439431_0121515 Ga0439431_0121515_203_688 161
473 3300042002 Ga0439442_064576 Ga0439442_064576_200_685 161
474 3300042004 Ga0439445_0001791 Ga0439445_0001791_3718_4203 161
475 3300042014 Ga0439457_005680 Ga0439457_005680_2218_2703 161
476 3300042015 Ga0439462_0006414 Ga0439462_0006414_528_1013 161
477 3300042157 Ga0439458_0081941 Ga0439458_0081941_150_635 161
478 3300044712 Ga0453684_0071138 Ga0453684_0071138_3037_3522 161
479 3300045051 Ga0451576_0285613 Ga0451576_0285613_1002_1487 161
480 3300045976 Ga0466967_0390970 Ga0466967_0390970_762_1247 161
481 3300046454 Ga0495592_0101286 Ga0495592_0101286_870_1355 161
482 3300046460 Ga0495638_0447680 Ga0495638_0447680_98_631 161
483 3300046463 Ga0495653_0075413 Ga0495653_0075413_1829_2314 161
484 3300046511 Ga0495608_0035877 Ga0495608_0035877_1841_2326 161
485 3300046514 Ga0495618_0030947 Ga0495618_0030947_1363_1848 161
486 3300046516 Ga0495628_0342413 Ga0495628_0342413_89_574 161
487 3300046517 Ga0495630_0062747 Ga0495630_0062747_456_941 161
488 3300046533 Ga0495640_0213239 Ga0495640_0213239_665_1150 161
489 3300046536 Ga0495587_0095593 Ga0495587_0095593_515_1000 161
490 3300046642 Ga0495634_0173686 Ga0495634_0173686_653_1138 161
491 3300046663 Ga0495635_0253714 Ga0495635_0253714_532_1017 161
492 3300046675 Ga0495657_0241154 Ga0495657_0241154_463_948 161
493 3300046678 Ga0495599_0090021 Ga0495599_0090021_207_692 161
494 3300047317 Ga0495604_0149068 Ga0495604_0149068_124_609 161
495 3300047320 Ga0495672_0012400 Ga0495672_0012400_4156_4641 161
496 3300047322 Ga0495680_0110301 Ga0495680_0110301_792_1277 161
497 3300047471 Ga0495684_0194478 Ga0495684_0194478_499_984 161
498 3300047472 Ga0495686_0005149 Ga0495686_0005149_7209_7694 161
499 3300047472 Ga0495686_0359791 Ga0495686_0359791_122_607 161
500 3300048904 Ga0496101_0240518 Ga0496101_0240518_595_1116 161
501 3300048909 Ga0496106_0250916 Ga0496106_0250916_492_977 161
502 3300048913 Ga0496110_0174449 Ga0496110_0174449_313_801 161
503 3300048914 Ga0496111_0164505 Ga0496111_0164505_28_513 161
504 3300048916 Ga0496113_1139452 Ga0496113_1139452_67_555 161
505 3300048917 Ga0496114_0334913 Ga0496114_0334913_364_933 161
506 3300049513 Ga0501290_017505 Ga0501290_017505_163_648 161
507 3300049523 Ga0501300_025582 Ga0501300_025582_165_650 161
508 3300049569 Ga0501032_0030141 Ga0501032_0030141_2526_3011 161
509 3300049571 Ga0501034_0002546 Ga0501034_0002546_17700_18185 161
510 3300049572 Ga0501036_0005747 Ga0501036_0005747_2279_2764 161
511 3300049573 Ga0501037_0134694 Ga0501037_0134694_504_989 161
512 3300049574 Ga0501038_0040428 Ga0501038_0040428_3495_3980 161
513 3300049579 Ga0501043_0004799 Ga0501043_0004799_5443_5928 161
514 3300049580 Ga0501046_0016027 Ga0501046_0016027_831_1316 161
515 3300049581 Ga0501047_0141683 Ga0501047_0141683_17_502 161
516 3300049582 Ga0501048_0033984 Ga0501048_0033984_1148_1633 161
517 3300049585 Ga0501069_0402858 Ga0501069_0402858_281_766 161
518 3300049586 Ga0501070_0012235 Ga0501070_0012235_2693_3178 161
519 3300049589 Ga0501073_0002208 Ga0501073_0002208_7474_7959 161
520 3300049590 Ga0501074_0040824 Ga0501074_0040824_67_552 161
521 3300049742 Ga0501080_0147041 Ga0501080_0147041_957_1442 161
522 3300049744 Ga0501083_0035233 Ga0501083_0035233_267_752 161
523 3300049824 Ga0501045_0201000 Ga0501045_0201000_943_1428 161
524 3300050493 nmdc:mga0k408_10793_c1 nmdc:mga0k408_10793_c1_1733_2218 161
525 3300050493 nmdc:mga0k408_151620_c1 nmdc:mga0k408_151620_c1_90_626 161
526 3300050493 nmdc:mga0k408_341989_c1 nmdc:mga0k408_341989_c1_156_641 161
527 3300050493 nmdc:mga0k408_590487_c1 nmdc:mga0k408_590487_c1_43_576 161
528 3300050511 nmdc:mga08y16_21771_c1 nmdc:mga08y16_21771_c1_3651_4136 161
529 3300050512 nmdc:mga0n895_261412_c1 nmdc:mga0n895_261412_c1_877_1362 161
530 3300053727 Ga0500611_000050 Ga0500611_000050_6826_7359 161
531 3300054114 Ga0501084_0146976 Ga0501084_0146976_1263_1748 161
532 3300044712 Ga0453684_0125470 Ga0453684_0125470_1917_2405 162
533 2162886011 MRS1b_contig_3060620 MRS1b_0951.00001060 163
534 3300005290 Ga0065712_10178720 Ga0065712_101787202 163
535 3300005366 Ga0070659_100213813 Ga0070659_1002138132 163
536 3300005456 Ga0070678_100864455 Ga0070678_1008644551 163
537 3300005834 Ga0068851_10677452 Ga0068851_106774521 163
538 3300005844 Ga0068862_100303002 Ga0068862_1003030022 163
539 3300013308 Ga0157375_10690609 Ga0157375_106906092 163
540 3300025321 Ga0207656_10373891 Ga0207656_103738911 163
541 3300026089 Ga0207648_11294324 Ga0207648_112943241 163
542 3300042876 Ga0451577_0006025 Ga0451577_0006025_1203_1703 163
543 3300046537 Ga0495598_0226103 Ga0495598_0226103_80_595 163
544 3300046539 Ga0495621_0169060 Ga0495621_0169060_121_636 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

52

159

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d30-assembly1.cif.gz_A crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution 0.9018 25 154
1ux0-assembly1.cif.gz_B-2 bacillus subtilis cytidine deaminase with an arg56 - gln substitution 0.8924 23 159
1ux1-assembly1.cif.gz_D bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution 0.8898 23 160
1jtk-assembly1.cif.gz_A crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine 0.8885 23 160
3dmo-assembly1.cif.gz_C 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei 0.8875 25 155
ID Description Score Start End Superfamily
af_A0A1D8PMQ1_5_145_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8659 17 162 3.40.140.10
af_Q4DCG1_17_164_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8658 19 159 3.40.140.10
af_Q2FY04_3_129_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8636 28 156 3.40.140.10
af_A0A0P0WYM0_4_131_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8418 25 160 3.40.140.10
af_F1QSJ0_1_133_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8387 25 163 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2D7K8G1-F1-model_v4 Cytidine deaminase 0.9694 2 155 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A3Q2XTG9-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9641 19 146 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802
AF-A0A2D7K8G1-F1-model_v4 Cytidine deaminase 0.9632 2 155 GO:0004126
GO:0005829
GO:0008270
GO:0009972
AF-A0A4Q0AX19-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) 0.963 2 159 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0016020
GO:0042802
AF-A0A1M6MDI4-F1-model_v4 Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) 0.9622 1 158 GO:0004126
GO:0005829
GO:0008270
GO:0009972
GO:0042802

Feature Viewer

pLDDT pTM Quality
94.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map