F461728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 544 | 223 | 544 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10756495|Ga0105249_107564952 |
| Length | 193 |
| Sequence | MEAIVQNCKIKSFSKPLPQRGFYIPKLCILLFMKEHKFEFQYEIYNDSSELKKEDAELLGKARAVTKYAYAPYSDFRVGAAGILVNGEIISGTNQENASFPVGICAERVLLGAAASMHPGIPIKTIAVSYDSDNVSTDHPISPCGMCRQALIEQETRFHQPIRLILSGQQGKVLIIRSAVSLLPFAFTGDELE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 157 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 158 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 162 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 163 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 164 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 165 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 166 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 167 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 168 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 196 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 197 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 201 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 202 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 222 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 223 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0 |
| Rhizoplane | 1.65 |
| Rhizosphere | 95.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3060620 | 2162886011 | Bacteria | 1019 |
| 2 | MRS1b_contig_4234355 | 2162886011 | Bacteria | 1224 |
| 3 | rootH2_10014715 | 3300003320 | Bacteria | 11737 |
| 4 | Ga0065712_10001567 | 3300005290 | Bacteria | 12724 |
| 5 | Ga0065712_10178720 | 3300005290 | Bacteria | 1174 |
| 6 | Ga0065712_10230060 | 3300005290 | Bacteria | 1014 |
| 7 | Ga0065715_10481615 | 3300005293 | Bacteria | 796 |
| 8 | Ga0065707_10095485 | 3300005295 | Bacteria | 3374 |
| 9 | Ga0065707_10204070 | 3300005295 | Bacteria | 1297 |
| 10 | Ga0070658_10854429 | 3300005327 | Bacteria | 791 |
| 11 | Ga0070676_10028466 | 3300005328 | Bacteria | 3173 |
| 12 | Ga0070676_10057214 | 3300005328 | Bacteria | 2307 |
| 13 | Ga0070676_10157646 | 3300005328 | Bacteria | 1458 |
| 14 | Ga0070676_10248938 | 3300005328 | Bacteria | 1185 |
| 15 | Ga0070683_100007696 | 3300005329 | Bacteria | 9117 |
| 16 | Ga0070690_100027358 | 3300005330 | Unclassified | 3525 |
| 17 | Ga0070690_100032740 | 3300005330 | Bacteria | 3249 |
| 18 | Ga0070690_100658722 | 3300005330 | Bacteria | 800 |
| 19 | Ga0070670_100159752 | 3300005331 | Bacteria | 1953 |
| 20 | Ga0070670_100196739 | 3300005331 | Bacteria | 1751 |
| 21 | Ga0070670_100323070 | 3300005331 | Bacteria | 1352 |
| 22 | Ga0070670_100426597 | 3300005331 | Bacteria | 1173 |
| 23 | Ga0070677_10299603 | 3300005333 | Bacteria | 816 |
| 24 | Ga0068869_100001850 | 3300005334 | Bacteria | 12717 |
| 25 | Ga0068869_100009539 | 3300005334 | Bacteria | 6300 |
| 26 | Ga0068869_100016622 | 3300005334 | Bacteria | 4962 |
| 27 | Ga0068869_100037747 | 3300005334 | Bacteria | 3436 |
| 28 | Ga0068869_100234083 | 3300005334 | Bacteria | 1461 |
| 29 | Ga0068869_100416538 | 3300005334 | Bacteria | 1108 |
| 30 | Ga0068869_101623318 | 3300005334 | Unclassified | 576 |
| 31 | Ga0070666_10000127 | 3300005335 | Bacteria | 53362 |
| 32 | Ga0070666_10014370 | 3300005335 | Bacteria | 5039 |
| 33 | Ga0070666_10041325 | 3300005335 | Bacteria | 3081 |
| 34 | Ga0070666_10268305 | 3300005335 | Bacteria | 1211 |
| 35 | Ga0070666_10310223 | 3300005335 | Bacteria | 1124 |
| 36 | Ga0070666_10400568 | 3300005335 | Bacteria | 987 |
| 37 | Ga0070682_100771364 | 3300005337 | Bacteria | 778 |
| 38 | Ga0068868_100005670 | 3300005338 | Bacteria | 8788 |
| 39 | Ga0068868_100007552 | 3300005338 | Bacteria | 7745 |
| 40 | Ga0068868_100013219 | 3300005338 | Bacteria | 6047 |
| 41 | Ga0068868_100030307 | 3300005338 | Bacteria | 4148 |
| 42 | Ga0068868_100166603 | 3300005338 | Bacteria | 1823 |
| 43 | Ga0068868_100332300 | 3300005338 | Bacteria | 1297 |
| 44 | Ga0070660_100007829 | 3300005339 | Bacteria | 7451 |
| 45 | Ga0070689_100004423 | 3300005340 | Bacteria | 9490 |
| 46 | Ga0070689_100036841 | 3300005340 | Bacteria | 3741 |
| 47 | Ga0070689_100239541 | 3300005340 | Bacteria | 1494 |
| 48 | Ga0070689_100321672 | 3300005340 | Bacteria | 1292 |
| 49 | Ga0070687_100006493 | 3300005343 | Bacteria | 4796 |
| 50 | Ga0070661_100080351 | 3300005344 | Bacteria | 2407 |
| 51 | Ga0070661_100095021 | 3300005344 | Bacteria | 2210 |
| 52 | Ga0070661_100319900 | 3300005344 | Unclassified | 1212 |
| 53 | Ga0070692_10560040 | 3300005345 | Bacteria | 750 |
| 54 | Ga0070668_100058326 | 3300005347 | Bacteria | 2986 |
| 55 | Ga0070669_100035285 | 3300005353 | Bacteria | 3623 |
| 56 | Ga0070669_100218612 | 3300005353 | Unclassified | 1506 |
| 57 | Ga0070675_100022380 | 3300005354 | Bacteria | 5051 |
| 58 | Ga0070675_100076631 | 3300005354 | Bacteria | 2782 |
| 59 | Ga0070675_100163676 | 3300005354 | Bacteria | 1915 |
| 60 | Ga0070675_100196652 | 3300005354 | Bacteria | 1749 |
| 61 | Ga0070675_100211289 | 3300005354 | Bacteria | 1686 |
| 62 | Ga0070675_100764682 | 3300005354 | Bacteria | 882 |
| 63 | Ga0070675_101406229 | 3300005354 | Bacteria | 643 |
| 64 | Ga0070671_100018592 | 3300005355 | Bacteria | 5646 |
| 65 | Ga0070671_100063111 | 3300005355 | Bacteria | 3085 |
| 66 | Ga0070671_100650581 | 3300005355 | Bacteria | 912 |
| 67 | Ga0070674_100108438 | 3300005356 | Unclassified | 2035 |
| 68 | Ga0070674_100443426 | 3300005356 | Bacteria | 1070 |
| 69 | Ga0070674_100695465 | 3300005356 | Bacteria | 869 |
| 70 | Ga0070673_100010606 | 3300005364 | Bacteria | 6244 |
| 71 | Ga0070673_100037208 | 3300005364 | Bacteria | 3707 |
| 72 | Ga0070673_100043345 | 3300005364 | Bacteria | 3476 |
| 73 | Ga0070673_100190631 | 3300005364 | Bacteria | 1761 |
| 74 | Ga0070688_100057889 | 3300005365 | Bacteria | 2438 |
| 75 | Ga0070688_100062103 | 3300005365 | Bacteria | 2364 |
| 76 | Ga0070659_100014717 | 3300005366 | Bacteria | 5850 |
| 77 | Ga0070659_100213813 | 3300005366 | Bacteria | 1589 |
| 78 | Ga0070659_100642257 | 3300005366 | Bacteria | 915 |
| 79 | Ga0070667_100007591 | 3300005367 | Bacteria | 8994 |
| 80 | Ga0070667_100013534 | 3300005367 | Bacteria | 6741 |
| 81 | Ga0070667_100063851 | 3300005367 | Bacteria | 3122 |
| 82 | Ga0070667_100079184 | 3300005367 | Bacteria | 2809 |
| 83 | Ga0070667_100094694 | 3300005367 | Bacteria | 2573 |
| 84 | Ga0070667_100235083 | 3300005367 | Bacteria | 1635 |
| 85 | Ga0070667_100905920 | 3300005367 | Bacteria | 821 |
| 86 | Ga0070667_102121377 | 3300005367 | Bacteria | 529 |
| 87 | Ga0070709_11300772 | 3300005434 | Bacteria | 586 |
| 88 | Ga0070700_100040779 | 3300005441 | Bacteria | 2844 |
| 89 | Ga0070694_100241642 | 3300005444 | Bacteria | 1362 |
| 90 | Ga0070663_100267403 | 3300005455 | Bacteria | 1358 |
| 91 | Ga0070663_100953625 | 3300005455 | Bacteria | 744 |
| 92 | Ga0070678_100188610 | 3300005456 | Bacteria | 1693 |
| 93 | Ga0070678_100431151 | 3300005456 | Bacteria | 1151 |
| 94 | Ga0070678_100832695 | 3300005456 | Bacteria | 840 |
| 95 | Ga0070678_100864455 | 3300005456 | Bacteria | 825 |
| 96 | Ga0070662_100029275 | 3300005457 | Bacteria | 3843 |
| 97 | Ga0070662_100048370 | 3300005457 | Bacteria | 3063 |
| 98 | Ga0070662_100051142 | 3300005457 | Bacteria | 2983 |
| 99 | Ga0070662_100183776 | 3300005457 | Bacteria | 1650 |
| 100 | Ga0070681_10968836 | 3300005458 | Bacteria | 770 |
| 101 | Ga0068867_100013723 | 3300005459 | Bacteria | 5738 |
| 102 | Ga0068867_100028976 | 3300005459 | Bacteria | 3987 |
| 103 | Ga0068867_100055781 | 3300005459 | Bacteria | 2922 |
| 104 | Ga0068867_100116619 | 3300005459 | Bacteria | 2058 |
| 105 | Ga0068867_100152741 | 3300005459 | Bacteria | 1815 |
| 106 | Ga0068867_100190003 | 3300005459 | Bacteria | 1638 |
| 107 | Ga0068867_100436386 | 3300005459 | Bacteria | 1113 |
| 108 | Ga0068867_100573899 | 3300005459 | Bacteria | 980 |
| 109 | Ga0070685_10252918 | 3300005466 | Bacteria | 1168 |
| 110 | Ga0070685_10290596 | 3300005466 | Bacteria | 1098 |
| 111 | Ga0070684_100003930 | 3300005535 | Bacteria | 11259 |
| 112 | Ga0070684_100111498 | 3300005535 | Bacteria | 2453 |
| 113 | Ga0070684_100304324 | 3300005535 | Bacteria | 1463 |
| 114 | Ga0070684_100454591 | 3300005535 | Bacteria | 1184 |
| 115 | Ga0068853_100007598 | 3300005539 | Bacteria | 8682 |
| 116 | Ga0068853_100141363 | 3300005539 | Bacteria | 2161 |
| 117 | Ga0068853_100572461 | 3300005539 | Bacteria | 1071 |
| 118 | Ga0068853_100885542 | 3300005539 | Bacteria | 857 |
| 119 | Ga0068853_101400598 | 3300005539 | Unclassified | 676 |
| 120 | Ga0070672_100013498 | 3300005543 | Bacteria | 5773 |
| 121 | Ga0070672_100084057 | 3300005543 | Bacteria | 2555 |
| 122 | Ga0070672_101652348 | 3300005543 | Unclassified | 575 |
| 123 | Ga0070686_100016237 | 3300005544 | Bacteria | 4327 |
| 124 | Ga0070686_100341985 | 3300005544 | Bacteria | 1121 |
| 125 | Ga0070686_100899827 | 3300005544 | Bacteria | 720 |
| 126 | Ga0070686_100941153 | 3300005544 | Bacteria | 705 |
| 127 | Ga0070665_100153414 | 3300005548 | Bacteria | 2305 |
| 128 | Ga0070665_100993639 | 3300005548 | Bacteria | 851 |
| 129 | Ga0068855_100859577 | 3300005563 | Unclassified | 961 |
| 130 | Ga0070664_100023253 | 3300005564 | Bacteria | 5118 |
| 131 | Ga0070664_100029660 | 3300005564 | Bacteria | 4562 |
| 132 | Ga0070664_100141033 | 3300005564 | Bacteria | 2122 |
| 133 | Ga0070664_100143176 | 3300005564 | Bacteria | 2106 |
| 134 | Ga0070664_100146336 | 3300005564 | Bacteria | 2084 |
| 135 | Ga0070664_100415753 | 3300005564 | Bacteria | 1231 |
| 136 | Ga0070664_100487530 | 3300005564 | Bacteria | 1135 |
| 137 | Ga0070664_100716877 | 3300005564 | Bacteria | 933 |
| 138 | Ga0068857_100012224 | 3300005577 | Bacteria | 7468 |
| 139 | Ga0068857_100024477 | 3300005577 | Bacteria | 5315 |
| 140 | Ga0068857_100063896 | 3300005577 | Bacteria | 3272 |
| 141 | Ga0068854_100019390 | 3300005578 | Bacteria | 4582 |
| 142 | Ga0068854_100049871 | 3300005578 | Bacteria | 2993 |
| 143 | Ga0068854_100342457 | 3300005578 | Unclassified | 1221 |
| 144 | Ga0068854_100555320 | 3300005578 | Bacteria | 975 |
| 145 | Ga0068852_100033780 | 3300005616 | Unclassified | 4251 |
| 146 | Ga0068852_100044139 | 3300005616 | Bacteria | 3784 |
| 147 | Ga0068852_100045895 | 3300005616 | Bacteria | 3720 |
| 148 | Ga0068852_100049011 | 3300005616 | Bacteria | 3612 |
| 149 | Ga0068852_100356097 | 3300005616 | Bacteria | 1430 |
| 150 | Ga0068852_100468346 | 3300005616 | Bacteria | 1250 |
| 151 | Ga0068859_100000098 | 3300005617 | Bacteria | 80555 |
| 152 | Ga0068859_100017189 | 3300005617 | Bacteria | 7262 |
| 153 | Ga0068859_100029305 | 3300005617 | Bacteria | 5523 |
| 154 | Ga0068859_100107032 | 3300005617 | Bacteria | 2856 |
| 155 | Ga0068864_100034536 | 3300005618 | Bacteria | 4301 |
| 156 | Ga0068864_100068541 | 3300005618 | Bacteria | 3082 |
| 157 | Ga0068864_100098437 | 3300005618 | Bacteria | 2590 |
| 158 | Ga0068861_100022702 | 3300005719 | Bacteria | 4524 |
| 159 | Ga0068861_100477332 | 3300005719 | Bacteria | 1123 |
| 160 | Ga0068861_100597558 | 3300005719 | Bacteria | 1012 |
| 161 | Ga0068861_102378304 | 3300005719 | Unclassified | 532 |
| 162 | Ga0068851_10084974 | 3300005834 | Bacteria | 1658 |
| 163 | Ga0068851_10103289 | 3300005834 | Bacteria | 1514 |
| 164 | Ga0068851_10256551 | 3300005834 | Bacteria | 993 |
| 165 | Ga0068851_10294544 | 3300005834 | Unclassified | 931 |
| 166 | Ga0068851_10326306 | 3300005834 | Bacteria | 888 |
| 167 | Ga0068851_10575016 | 3300005834 | Unclassified | 683 |
| 168 | Ga0068851_10677452 | 3300005834 | Bacteria | 633 |
| 169 | Ga0068870_10032627 | 3300005840 | Bacteria | 2650 |
| 170 | Ga0068870_10692720 | 3300005840 | Unclassified | 702 |
| 171 | Ga0068863_100002114 | 3300005841 | Bacteria | 19700 |
| 172 | Ga0068863_100097781 | 3300005841 | Bacteria | 2788 |
| 173 | Ga0068863_100254405 | 3300005841 | Unclassified | 1697 |
| 174 | Ga0068863_100716373 | 3300005841 | Bacteria | 995 |
| 175 | Ga0068863_100891173 | 3300005841 | Bacteria | 890 |
| 176 | Ga0068863_101227699 | 3300005841 | Unclassified | 756 |
| 177 | Ga0068858_100004286 | 3300005842 | Bacteria | 14032 |
| 178 | Ga0068858_100092637 | 3300005842 | Bacteria | 2813 |
| 179 | Ga0068858_100864207 | 3300005842 | Bacteria | 884 |
| 180 | Ga0068858_100880210 | 3300005842 | Unclassified | 875 |
| 181 | Ga0068860_100002611 | 3300005843 | Bacteria | 18829 |
| 182 | Ga0068860_100008715 | 3300005843 | Bacteria | 10101 |
| 183 | Ga0068860_100026008 | 3300005843 | Bacteria | 5645 |
| 184 | Ga0068860_100045977 | 3300005843 | Bacteria | 4163 |
| 185 | Ga0068860_100134942 | 3300005843 | Bacteria | 2370 |
| 186 | Ga0068860_100454837 | 3300005843 | Bacteria | 1273 |
| 187 | Ga0068860_100615053 | 3300005843 | Bacteria | 1093 |
| 188 | Ga0068862_100021507 | 3300005844 | Bacteria | 5391 |
| 189 | Ga0068862_100303002 | 3300005844 | Unclassified | 1471 |
| 190 | Ga0068862_100460941 | 3300005844 | Bacteria | 1200 |
| 191 | Ga0068862_100764600 | 3300005844 | Unclassified | 941 |
| 192 | Ga0068862_100855000 | 3300005844 | Bacteria | 892 |
| 193 | Ga0068862_101703507 | 3300005844 | Bacteria | 639 |
| 194 | Ga0081539_10051231 | 3300005985 | Bacteria | 2329 |
| 195 | Ga0097621_100016333 | 3300006237 | Bacteria | 5609 |
| 196 | Ga0097621_100051706 | 3300006237 | Bacteria | 3344 |
| 197 | Ga0097621_100223238 | 3300006237 | Bacteria | 1642 |
| 198 | Ga0097621_100430398 | 3300006237 | Bacteria | 1186 |
| 199 | Ga0068871_100008063 | 3300006358 | Bacteria | 7559 |
| 200 | Ga0068871_100020720 | 3300006358 | Bacteria | 5042 |
| 201 | Ga0068871_100140045 | 3300006358 | Bacteria | 2057 |
| 202 | Ga0068871_100295650 | 3300006358 | Bacteria | 1420 |
| 203 | Ga0068871_100401329 | 3300006358 | Bacteria | 1221 |
| 204 | Ga0068871_100878430 | 3300006358 | Bacteria | 830 |
| 205 | Ga0068871_101234288 | 3300006358 | Bacteria | 702 |
| 206 | Ga0075434_100037201 | 3300006871 | Bacteria | 4818 |
| 207 | Ga0075434_100235685 | 3300006871 | Bacteria | 1850 |
| 208 | Ga0068865_100020121 | 3300006881 | Bacteria | 4328 |
| 209 | Ga0068865_100124096 | 3300006881 | Unclassified | 1925 |
| 210 | Ga0068865_100379989 | 3300006881 | Bacteria | 1152 |
| 211 | Ga0068865_100441889 | 3300006881 | Bacteria | 1074 |
| 212 | Ga0097620_100000098 | 3300006931 | Bacteria | 80555 |
| 213 | Ga0097620_100017190 | 3300006931 | Bacteria | 7262 |
| 214 | Ga0097620_100029305 | 3300006931 | Bacteria | 5523 |
| 215 | Ga0097620_100107033 | 3300006931 | Bacteria | 2856 |
| 216 | Ga0105251_10090997 | 3300009011 | Bacteria | 1402 |
| 217 | Ga0105240_10048921 | 3300009093 | Bacteria | 5341 |
| 218 | Ga0105240_10961135 | 3300009093 | Unclassified | 916 |
| 219 | Ga0111539_10005240 | 3300009094 | Bacteria | 16795 |
| 220 | Ga0111539_12463630 | 3300009094 | Bacteria | 603 |
| 221 | Ga0105247_10001541 | 3300009101 | Bacteria | 16441 |
| 222 | Ga0105247_10013490 | 3300009101 | Bacteria | 4900 |
| 223 | Ga0105247_10412456 | 3300009101 | Unclassified | 965 |
| 224 | Ga0114129_11345854 | 3300009147 | Bacteria | 883 |
| 225 | Ga0105243_11268000 | 3300009148 | Bacteria | 753 |
| 226 | Ga0105243_11790766 | 3300009148 | Bacteria | 645 |
| 227 | Ga0105241_10000426 | 3300009174 | Bacteria | 31864 |
| 228 | Ga0105241_11872309 | 3300009174 | Bacteria | 587 |
| 229 | Ga0105242_10166195 | 3300009176 | Bacteria | 1936 |
| 230 | Ga0105242_10280303 | 3300009176 | Bacteria | 1514 |
| 231 | Ga0105242_11197425 | 3300009176 | Bacteria | 779 |
| 232 | Ga0105248_10398613 | 3300009177 | Bacteria | 1549 |
| 233 | Ga0105248_11149122 | 3300009177 | Bacteria | 878 |
| 234 | Ga0105237_10003853 | 3300009545 | Bacteria | 17642 |
| 235 | Ga0105237_11575508 | 3300009545 | Unclassified | 664 |
| 236 | Ga0105238_10684152 | 3300009551 | Bacteria | 1037 |
| 237 | Ga0105238_12395115 | 3300009551 | Bacteria | 563 |
| 238 | Ga0105249_10010747 | 3300009553 | Bacteria | 8043 |
| 239 | Ga0105249_10130739 | 3300009553 | Bacteria | 2396 |
| 240 | Ga0105249_10338112 | 3300009553 | Bacteria | 1521 |
| 241 | Ga0105249_10533259 | 3300009553 | Bacteria | 1223 |
| 242 | Ga0105249_10756495 | 3300009553 | Bacteria | 1034 |
| 243 | Ga0105249_11369420 | 3300009553 | Bacteria | 779 |
| 244 | Ga0105239_10068708 | 3300010375 | Bacteria | 3894 |
| 245 | Ga0105239_10162361 | 3300010375 | Unclassified | 2497 |
| 246 | Ga0105239_10995713 | 3300010375 | Bacteria | 964 |
| 247 | Ga0105246_10114368 | 3300011119 | Bacteria | 1988 |
| 248 | Ga0105246_10159395 | 3300011119 | Bacteria | 1717 |
| 249 | Ga0105246_10189621 | 3300011119 | Bacteria | 1590 |
| 250 | Ga0105246_10212276 | 3300011119 | Bacteria | 1511 |
| 251 | Ga0157373_10198175 | 3300013100 | Bacteria | 1416 |
| 252 | Ga0157371_10219816 | 3300013102 | Bacteria | 1364 |
| 253 | Ga0157371_10252605 | 3300013102 | Bacteria | 1270 |
| 254 | Ga0157370_10033924 | 3300013104 | Bacteria | 4973 |
| 255 | Ga0157370_10122963 | 3300013104 | Bacteria | 2423 |
| 256 | Ga0157369_10163444 | 3300013105 | Bacteria | 2349 |
| 257 | Ga0157374_10001178 | 3300013296 | Bacteria | 22309 |
| 258 | Ga0157374_10003276 | 3300013296 | Bacteria | 13602 |
| 259 | Ga0157374_10016837 | 3300013296 | Bacteria | 6431 |
| 260 | Ga0157374_10161296 | 3300013296 | Bacteria | 2184 |
| 261 | Ga0157374_10330887 | 3300013296 | Bacteria | 1511 |
| 262 | Ga0157374_10463820 | 3300013296 | Bacteria | 1269 |
| 263 | Ga0157374_10513506 | 3300013296 | Bacteria | 1204 |
| 264 | Ga0157378_10013365 | 3300013297 | Bacteria | 7174 |
| 265 | Ga0157378_10039647 | 3300013297 | Bacteria | 4178 |
| 266 | Ga0157378_10103242 | 3300013297 | Bacteria | 2604 |
| 267 | Ga0157378_10140437 | 3300013297 | Bacteria | 2243 |
| 268 | Ga0157378_10149757 | 3300013297 | Bacteria | 2173 |
| 269 | Ga0157378_10175160 | 3300013297 | Unclassified | 2014 |
| 270 | Ga0157378_10181199 | 3300013297 | Bacteria | 1982 |
| 271 | Ga0157378_10982791 | 3300013297 | Bacteria | 878 |
| 272 | Ga0157378_11427737 | 3300013297 | Bacteria | 735 |
| 273 | Ga0163162_10000376 | 3300013306 | Bacteria | 40621 |
| 274 | Ga0163162_10000736 | 3300013306 | Bacteria | 30393 |
| 275 | Ga0163162_10010551 | 3300013306 | Bacteria | 8986 |
| 276 | Ga0163162_10054037 | 3300013306 | Bacteria | 4038 |
| 277 | Ga0163162_10481685 | 3300013306 | Bacteria | 1372 |
| 278 | Ga0157372_10029125 | 3300013307 | Bacteria | 6026 |
| 279 | Ga0157372_10330320 | 3300013307 | Unclassified | 1775 |
| 280 | Ga0157375_10018253 | 3300013308 | Bacteria | 6358 |
| 281 | Ga0157375_10058827 | 3300013308 | Bacteria | 3804 |
| 282 | Ga0157375_10136843 | 3300013308 | Bacteria | 2574 |
| 283 | Ga0157375_10690609 | 3300013308 | Bacteria | 1175 |
| 284 | Ga0157375_10697553 | 3300013308 | Bacteria | 1169 |
| 285 | Ga0157375_10771258 | 3300013308 | Bacteria | 1112 |
| 286 | Ga0163163_10000803 | 3300014325 | Bacteria | 26650 |
| 287 | Ga0163163_10020169 | 3300014325 | Bacteria | 6274 |
| 288 | Ga0163163_10066461 | 3300014325 | Bacteria | 3581 |
| 289 | Ga0163163_10311616 | 3300014325 | Bacteria | 1627 |
| 290 | Ga0163163_10481930 | 3300014325 | Unclassified | 1301 |
| 291 | Ga0157380_10001088 | 3300014326 | Bacteria | 17471 |
| 292 | Ga0157380_10499069 | 3300014326 | Bacteria | 1182 |
| 293 | Ga0157380_11149194 | 3300014326 | Bacteria | 818 |
| 294 | Ga0157377_10003528 | 3300014745 | Bacteria | 7082 |
| 295 | Ga0157377_10009333 | 3300014745 | Bacteria | 4807 |
| 296 | Ga0157377_10752952 | 3300014745 | Unclassified | 713 |
| 297 | Ga0157379_10019184 | 3300014968 | Bacteria | 6038 |
| 298 | Ga0157379_10067509 | 3300014968 | Bacteria | 3196 |
| 299 | Ga0157379_10118413 | 3300014968 | Bacteria | 2382 |
| 300 | Ga0157379_10164988 | 3300014968 | Bacteria | 1999 |
| 301 | Ga0157379_10534521 | 3300014968 | Unclassified | 1089 |
| 302 | Ga0157376_10005350 | 3300014969 | Bacteria | 8966 |
| 303 | Ga0157376_10040197 | 3300014969 | Bacteria | 3821 |
| 304 | Ga0157376_10175906 | 3300014969 | Unclassified | 1952 |
| 305 | Ga0157376_10633658 | 3300014969 | Bacteria | 1068 |
| 306 | Ga0163161_10015385 | 3300017792 | Bacteria | 5333 |
| 307 | Ga0163161_10031511 | 3300017792 | Bacteria | 3778 |
| 308 | Ga0163161_10552201 | 3300017792 | Bacteria | 944 |
| 309 | Ga0163161_11131023 | 3300017792 | Unclassified | 674 |
| 310 | Ga0207656_10012767 | 3300025321 | Bacteria | 3198 |
| 311 | Ga0207656_10214160 | 3300025321 | Unclassified | 935 |
| 312 | Ga0207656_10350670 | 3300025321 | Unclassified | 737 |
| 313 | Ga0207656_10373891 | 3300025321 | Bacteria | 714 |
| 314 | Ga0207682_10366974 | 3300025893 | Bacteria | 679 |
| 315 | Ga0207710_10005089 | 3300025900 | Bacteria | 5686 |
| 316 | Ga0207710_10269568 | 3300025900 | Bacteria | 855 |
| 317 | Ga0207680_10000408 | 3300025903 | Bacteria | 20509 |
| 318 | Ga0207680_10352936 | 3300025903 | Unclassified | 1033 |
| 319 | Ga0207647_10391571 | 3300025904 | Bacteria | 784 |
| 320 | Ga0207645_10023001 | 3300025907 | Bacteria | 4050 |
| 321 | Ga0207645_10060151 | 3300025907 | Bacteria | 2426 |
| 322 | Ga0207645_10273148 | 3300025907 | Bacteria | 1121 |
| 323 | Ga0207645_10929660 | 3300025907 | Bacteria | 590 |
| 324 | Ga0207643_10019785 | 3300025908 | Bacteria | 3689 |
| 325 | Ga0207705_10692879 | 3300025909 | Bacteria | 792 |
| 326 | Ga0207654_10001077 | 3300025911 | Bacteria | 14842 |
| 327 | Ga0207695_10135298 | 3300025913 | Bacteria | 2418 |
| 328 | Ga0207671_10002175 | 3300025914 | Bacteria | 21298 |
| 329 | Ga0207662_10005885 | 3300025918 | Bacteria | 6578 |
| 330 | Ga0207657_10007407 | 3300025919 | Bacteria | 11251 |
| 331 | Ga0207649_10063136 | 3300025920 | Bacteria | 2337 |
| 332 | Ga0207649_10191759 | 3300025920 | Bacteria | 1438 |
| 333 | Ga0207649_11064074 | 3300025920 | Unclassified | 638 |
| 334 | Ga0207681_10039871 | 3300025923 | Bacteria | 3121 |
| 335 | Ga0207681_10535680 | 3300025923 | Unclassified | 962 |
| 336 | Ga0207694_10163744 | 3300025924 | Bacteria | 1798 |
| 337 | Ga0207650_10077238 | 3300025925 | Bacteria | 2517 |
| 338 | Ga0207650_10081238 | 3300025925 | Bacteria | 2459 |
| 339 | Ga0207650_10298638 | 3300025925 | Bacteria | 1315 |
| 340 | Ga0207659_10017079 | 3300025926 | Bacteria | 4735 |
| 341 | Ga0207659_10029977 | 3300025926 | Bacteria | 3712 |
| 342 | Ga0207659_10463171 | 3300025926 | Bacteria | 1069 |
| 343 | Ga0207644_10078537 | 3300025931 | Bacteria | 2433 |
| 344 | Ga0207644_10119438 | 3300025931 | Bacteria | 2005 |
| 345 | Ga0207644_10159171 | 3300025931 | Bacteria | 1754 |
| 346 | Ga0207644_11352541 | 3300025931 | Bacteria | 598 |
| 347 | Ga0207690_10195032 | 3300025932 | Bacteria | 1534 |
| 348 | Ga0207706_10005971 | 3300025933 | Bacteria | 11327 |
| 349 | Ga0207706_10009126 | 3300025933 | Bacteria | 9119 |
| 350 | Ga0207706_10016466 | 3300025933 | Bacteria | 6673 |
| 351 | Ga0207706_10025117 | 3300025933 | Bacteria | 5341 |
| 352 | Ga0207706_10027500 | 3300025933 | Bacteria | 5085 |
| 353 | Ga0207706_10045334 | 3300025933 | Bacteria | 3896 |
| 354 | Ga0207686_10070740 | 3300025934 | Bacteria | 2243 |
| 355 | Ga0207686_10457723 | 3300025934 | Bacteria | 983 |
| 356 | Ga0207670_10005049 | 3300025936 | Bacteria | 7197 |
| 357 | Ga0207670_10309951 | 3300025936 | Bacteria | 1239 |
| 358 | Ga0207669_10072199 | 3300025937 | Unclassified | 2172 |
| 359 | Ga0207704_10448344 | 3300025938 | Bacteria | 1029 |
| 360 | Ga0207704_10819666 | 3300025938 | Bacteria | 778 |
| 361 | Ga0207691_10027432 | 3300025940 | Bacteria | 5339 |
| 362 | Ga0207691_10036564 | 3300025940 | Bacteria | 4550 |
| 363 | Ga0207691_10172245 | 3300025940 | Bacteria | 1895 |
| 364 | Ga0207691_11328944 | 3300025940 | Bacteria | 593 |
| 365 | Ga0207711_10870663 | 3300025941 | Bacteria | 838 |
| 366 | Ga0207689_10000357 | 3300025942 | Bacteria | 42953 |
| 367 | Ga0207689_10005824 | 3300025942 | Bacteria | 10929 |
| 368 | Ga0207689_10032834 | 3300025942 | Bacteria | 4314 |
| 369 | Ga0207689_10033210 | 3300025942 | Bacteria | 4288 |
| 370 | Ga0207689_10039976 | 3300025942 | Bacteria | 3882 |
| 371 | Ga0207689_10056654 | 3300025942 | Bacteria | 3226 |
| 372 | Ga0207689_10099900 | 3300025942 | Bacteria | 2384 |
| 373 | Ga0207689_10168409 | 3300025942 | Bacteria | 1805 |
| 374 | Ga0207689_10366272 | 3300025942 | Bacteria | 1199 |
| 375 | Ga0207661_10007258 | 3300025944 | Bacteria | 7882 |
| 376 | Ga0207661_10263569 | 3300025944 | Bacteria | 1536 |
| 377 | Ga0207679_10001099 | 3300025945 | Bacteria | 17218 |
| 378 | Ga0207679_10044056 | 3300025945 | Bacteria | 3217 |
| 379 | Ga0207679_10062335 | 3300025945 | Bacteria | 2778 |
| 380 | Ga0207679_10072030 | 3300025945 | Bacteria | 2609 |
| 381 | Ga0207679_10701647 | 3300025945 | Bacteria | 918 |
| 382 | Ga0207679_11499553 | 3300025945 | Bacteria | 618 |
| 383 | Ga0207667_10834209 | 3300025949 | Unclassified | 917 |
| 384 | Ga0207651_10029891 | 3300025960 | Bacteria | 3461 |
| 385 | Ga0207651_10844884 | 3300025960 | Bacteria | 813 |
| 386 | Ga0207651_10920367 | 3300025960 | Unclassified | 779 |
| 387 | Ga0207651_11057830 | 3300025960 | Bacteria | 726 |
| 388 | Ga0207712_10025486 | 3300025961 | Bacteria | 3929 |
| 389 | Ga0207712_10100105 | 3300025961 | Bacteria | 2153 |
| 390 | Ga0207712_10111280 | 3300025961 | Bacteria | 2055 |
| 391 | Ga0207712_10591562 | 3300025961 | Bacteria | 959 |
| 392 | Ga0207712_10629673 | 3300025961 | Bacteria | 930 |
| 393 | Ga0207640_10510058 | 3300025981 | Bacteria | 1003 |
| 394 | Ga0207640_10930226 | 3300025981 | Unclassified | 761 |
| 395 | Ga0207658_10008823 | 3300025986 | Bacteria | 6842 |
| 396 | Ga0207658_10023335 | 3300025986 | Bacteria | 4318 |
| 397 | Ga0207658_10056508 | 3300025986 | Bacteria | 2913 |
| 398 | Ga0207658_10480892 | 3300025986 | Bacteria | 1103 |
| 399 | Ga0207658_10823618 | 3300025986 | Unclassified | 843 |
| 400 | Ga0207658_10909375 | 3300025986 | Bacteria | 801 |
| 401 | Ga0207658_10994695 | 3300025986 | Bacteria | 765 |
| 402 | Ga0207677_10016641 | 3300026023 | Bacteria | 4361 |
| 403 | Ga0207677_10065714 | 3300026023 | Bacteria | 2532 |
| 404 | Ga0207677_10253187 | 3300026023 | Bacteria | 1431 |
| 405 | Ga0207677_10308344 | 3300026023 | Bacteria | 1310 |
| 406 | Ga0207677_10396310 | 3300026023 | Bacteria | 1169 |
| 407 | Ga0207703_10010057 | 3300026035 | Bacteria | 7417 |
| 408 | Ga0207703_10814995 | 3300026035 | Unclassified | 892 |
| 409 | Ga0207639_10009624 | 3300026041 | Bacteria | 6675 |
| 410 | Ga0207678_10036598 | 3300026067 | Bacteria | 4273 |
| 411 | Ga0207708_10133349 | 3300026075 | Bacteria | 1944 |
| 412 | Ga0207702_10081890 | 3300026078 | Bacteria | 2804 |
| 413 | Ga0207641_10000840 | 3300026088 | Bacteria | 32683 |
| 414 | Ga0207641_10228015 | 3300026088 | Unclassified | 1730 |
| 415 | Ga0207641_11426865 | 3300026088 | Bacteria | 693 |
| 416 | Ga0207648_10000260 | 3300026089 | Bacteria | 57280 |
| 417 | Ga0207648_10028135 | 3300026089 | Bacteria | 4985 |
| 418 | Ga0207648_10047679 | 3300026089 | Bacteria | 3754 |
| 419 | Ga0207648_10134595 | 3300026089 | Bacteria | 2177 |
| 420 | Ga0207648_11294324 | 3300026089 | Bacteria | 685 |
| 421 | Ga0207676_10006164 | 3300026095 | Bacteria | 8467 |
| 422 | Ga0207676_10010000 | 3300026095 | Bacteria | 6750 |
| 423 | Ga0207676_10148514 | 3300026095 | Bacteria | 2016 |
| 424 | Ga0207676_10188657 | 3300026095 | Bacteria | 1812 |
| 425 | Ga0207676_10500712 | 3300026095 | Bacteria | 1153 |
| 426 | Ga0207674_10010177 | 3300026116 | Bacteria | 10684 |
| 427 | Ga0207674_10028171 | 3300026116 | Bacteria | 5933 |
| 428 | Ga0207674_10031851 | 3300026116 | Bacteria | 5535 |
| 429 | Ga0207674_10120100 | 3300026116 | Bacteria | 2596 |
| 430 | Ga0207675_100272606 | 3300026118 | Unclassified | 1642 |
| 431 | Ga0207675_100565406 | 3300026118 | Bacteria | 1137 |
| 432 | Ga0207675_101092581 | 3300026118 | Bacteria | 817 |
| 433 | Ga0207675_102238857 | 3300026118 | Unclassified | 561 |
| 434 | Ga0207683_10206554 | 3300026121 | Bacteria | 1786 |
| 435 | Ga0207683_10223201 | 3300026121 | Bacteria | 1717 |
| 436 | Ga0207683_10800128 | 3300026121 | Unclassified | 875 |
| 437 | Ga0207698_10039278 | 3300026142 | Bacteria | 3505 |
| 438 | Ga0207698_10126944 | 3300026142 | Bacteria | 2171 |
| 439 | Ga0207698_10131433 | 3300026142 | Bacteria | 2140 |
| 440 | Ga0207698_10140495 | 3300026142 | Bacteria | 2080 |
| 441 | Ga0207698_10152213 | 3300026142 | Bacteria | 2009 |
| 442 | Ga0207698_11226344 | 3300026142 | Bacteria | 764 |
| 443 | Ga0268266_10851392 | 3300028379 | Unclassified | 881 |
| 444 | Ga0268265_10157833 | 3300028380 | Bacteria | 1922 |
| 445 | Ga0268265_10330079 | 3300028380 | Bacteria | 1385 |
| 446 | Ga0268265_10555233 | 3300028380 | Bacteria | 1091 |
| 447 | Ga0268265_11774680 | 3300028380 | Bacteria | 623 |
| 448 | Ga0268264_10001002 | 3300028381 | Bacteria | 28669 |
| 449 | Ga0268264_10009470 | 3300028381 | Bacteria | 8066 |
| 450 | Ga0268264_10012477 | 3300028381 | Bacteria | 6996 |
| 451 | Ga0268264_10038853 | 3300028381 | Bacteria | 3930 |
| 452 | Ga0268264_10197594 | 3300028381 | Bacteria | 1837 |
| 453 | Ga0268264_10570317 | 3300028381 | Bacteria | 1112 |
| 454 | Ga0268264_11102970 | 3300028381 | Bacteria | 802 |
| 455 | Ga0307515_10000261 | 3300028794 | Bacteria | 130891 |
| 456 | Ga0307515_10000341 | 3300028794 | Bacteria | 115360 |
| 457 | Ga0307511_10043258 | 3300030521 | Bacteria | 3767 |
| 458 | Ga0307410_10176308 | 3300031852 | Bacteria | 1615 |
| 459 | Ga0307410_10638160 | 3300031852 | Bacteria | 892 |
| 460 | Ga0307412_10076112 | 3300031911 | Bacteria | 2305 |
| 461 | Ga0307414_10028618 | 3300032004 | Bacteria | 3617 |
| 462 | Ga0373929_0077533 | 3300035085 | Bacteria | 805 |
| 463 | Ga0373943_0635816 | 3300035170 | Bacteria | 630 |
| 464 | Ga0373961_0185911 | 3300035241 | Bacteria | 726 |
| 465 | Ga0373924_0005029 | 3300035410 | Bacteria | 4654 |
| 466 | Ga0373935_0291043 | 3300035692 | Bacteria | 1152 |
| 467 | Ga0373937_0006347 | 3300036401 | Bacteria | 10197 |
| 468 | Ga0395901_0657873 | 3300038443 | Bacteria | 1050 |
| 469 | Ga0439439_0096742 | 3300041406 | Unclassified | 810 |
| 470 | Ga0439461_0073576 | 3300041410 | Bacteria | 796 |
| 471 | Ga0451797_1480866 | 3300041453 | Bacteria | 726 |
| 472 | Ga0451795_0884481 | 3300041456 | Bacteria | 894 |
| 473 | Ga0451807_1052453 | 3300041486 | Bacteria | 880 |
| 474 | Ga0451843_0124940 | 3300041509 | Bacteria | 1245 |
| 475 | Ga0451853_1526035 | 3300041512 | Bacteria | 1071 |
| 476 | Ga0451853_2401845 | 3300041512 | Bacteria | 614 |
| 477 | Ga0439431_0121515 | 3300041997 | Bacteria | 729 |
| 478 | Ga0439442_064576 | 3300042002 | Bacteria | 777 |
| 479 | Ga0439445_0001791 | 3300042004 | Bacteria | 4736 |
| 480 | Ga0439457_005680 | 3300042014 | Bacteria | 3108 |
| 481 | Ga0439462_0006414 | 3300042015 | Bacteria | 2923 |
| 482 | Ga0439458_0081941 | 3300042157 | Unclassified | 824 |
| 483 | Ga0451577_0006025 | 3300042876 | Bacteria | 12208 |
| 484 | Ga0453684_0071138 | 3300044712 | Bacteria | 4400 |
| 485 | Ga0453684_0125470 | 3300044712 | Bacteria | 3091 |
| 486 | Ga0451576_0285613 | 3300045051 | Bacteria | 1725 |
| 487 | Ga0466967_0390970 | 3300045976 | Bacteria | 1352 |
| 488 | Ga0495592_0101286 | 3300046454 | Bacteria | 2052 |
| 489 | Ga0495638_0447680 | 3300046460 | Bacteria | 660 |
| 490 | Ga0495653_0075413 | 3300046463 | Bacteria | 2510 |
| 491 | Ga0495608_0035877 | 3300046511 | Bacteria | 3341 |
| 492 | Ga0495618_0030947 | 3300046514 | Bacteria | 3345 |
| 493 | Ga0495628_0342413 | 3300046516 | Unclassified | 1100 |
| 494 | Ga0495630_0062747 | 3300046517 | Bacteria | 2791 |
| 495 | Ga0495640_0213239 | 3300046533 | Unclassified | 1220 |
| 496 | Ga0495587_0095593 | 3300046536 | Bacteria | 1715 |
| 497 | Ga0495598_0226103 | 3300046537 | Bacteria | 685 |
| 498 | Ga0495621_0169060 | 3300046539 | Bacteria | 868 |
| 499 | Ga0495668_0001819 | 3300046616 | Bacteria | 19357 |
| 500 | Ga0495634_0173686 | 3300046642 | Unclassified | 1353 |
| 501 | Ga0495635_0253714 | 3300046663 | Unclassified | 1185 |
| 502 | Ga0495657_0241154 | 3300046675 | Bacteria | 1091 |
| 503 | Ga0495599_0090021 | 3300046678 | Bacteria | 1915 |
| 504 | Ga0495604_0149068 | 3300047317 | Bacteria | 1664 |
| 505 | Ga0495672_0012400 | 3300047320 | Bacteria | 5951 |
| 506 | Ga0495680_0110301 | 3300047322 | Bacteria | 2040 |
| 507 | Ga0495684_0194478 | 3300047471 | Bacteria | 1498 |
| 508 | Ga0495686_0005149 | 3300047472 | Bacteria | 10420 |
| 509 | Ga0495686_0359791 | 3300047472 | Unclassified | 789 |
| 510 | Ga0496101_0240518 | 3300048904 | Bacteria | 1409 |
| 511 | Ga0496106_0250916 | 3300048909 | Bacteria | 1415 |
| 512 | Ga0496110_0174449 | 3300048913 | Bacteria | 1951 |
| 513 | Ga0496111_0164505 | 3300048914 | Unclassified | 1648 |
| 514 | Ga0496113_1139452 | 3300048916 | Unclassified | 611 |
| 515 | Ga0496114_0334913 | 3300048917 | Bacteria | 1338 |
| 516 | Ga0501290_017505 | 3300049513 | Bacteria | 960 |
| 517 | Ga0501300_025582 | 3300049523 | Bacteria | 866 |
| 518 | Ga0501032_0030141 | 3300049569 | Bacteria | 3721 |
| 519 | Ga0501034_0002546 | 3300049571 | Bacteria | 21767 |
| 520 | Ga0501034_0522874 | 3300049571 | Bacteria | 1098 |
| 521 | Ga0501036_0005747 | 3300049572 | Bacteria | 10058 |
| 522 | Ga0501037_0134694 | 3300049573 | Bacteria | 1770 |
| 523 | Ga0501038_0040428 | 3300049574 | Bacteria | 4073 |
| 524 | Ga0501043_0004799 | 3300049579 | Bacteria | 10951 |
| 525 | Ga0501043_0374069 | 3300049579 | Bacteria | 1080 |
| 526 | Ga0501046_0016027 | 3300049580 | Bacteria | 6287 |
| 527 | Ga0501047_0141683 | 3300049581 | Bacteria | 2282 |
| 528 | Ga0501048_0033984 | 3300049582 | Bacteria | 3682 |
| 529 | Ga0501069_0402858 | 3300049585 | Bacteria | 810 |
| 530 | Ga0501070_0012235 | 3300049586 | Bacteria | 7241 |
| 531 | Ga0501073_0002208 | 3300049589 | Bacteria | 14545 |
| 532 | Ga0501074_0040824 | 3300049590 | Bacteria | 3359 |
| 533 | Ga0501080_0147041 | 3300049742 | Bacteria | 2178 |
| 534 | Ga0501083_0035233 | 3300049744 | Bacteria | 3419 |
| 535 | Ga0501045_0201000 | 3300049824 | Bacteria | 1485 |
| 536 | nmdc:mga0k408_10793_c1 | 3300050493 | Bacteria | 4952 |
| 537 | nmdc:mga0k408_151620_c1 | 3300050493 | Bacteria | 668 |
| 538 | nmdc:mga0k408_341989_c1 | 3300050493 | Bacteria | 892 |
| 539 | nmdc:mga0k408_590487_c1 | 3300050493 | Bacteria | 655 |
| 540 | nmdc:mga08y16_21771_c1 | 3300050511 | Bacteria | 6764 |
| 541 | nmdc:mga0n895_261412_c1 | 3300050512 | Bacteria | 1756 |
| 542 | Ga0500568_0003661 | 3300053139 | Bacteria | 8451 |
| 543 | Ga0500611_000050 | 3300053727 | Bacteria | 54600 |
| 544 | Ga0501084_0146976 | 3300054114 | Bacteria | 1986 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_12463630 | Ga0111539_124636301 | 159 |
| 2 | 3300041456 | Ga0451795_0884481 | Ga0451795_0884481_237_722 | 159 |
| 3 | 3300049571 | Ga0501034_0522874 | Ga0501034_0522874_359_841 | 159 |
| 4 | 3300049579 | Ga0501043_0374069 | Ga0501043_0374069_231_713 | 159 |
| 5 | 3300005328 | Ga0070676_10057214 | Ga0070676_100572144 | 160 |
| 6 | 3300005334 | Ga0068869_100016622 | Ga0068869_1000166222 | 160 |
| 7 | 3300005344 | Ga0070661_100080351 | Ga0070661_1000803512 | 160 |
| 8 | 3300005354 | Ga0070675_100163676 | Ga0070675_1001636762 | 160 |
| 9 | 3300005356 | Ga0070674_100108438 | Ga0070674_1001084382 | 160 |
| 10 | 3300005459 | Ga0068867_100055781 | Ga0068867_1000557813 | 160 |
| 11 | 3300005459 | Ga0068867_100116619 | Ga0068867_1001166192 | 160 |
| 12 | 3300005539 | Ga0068853_101400598 | Ga0068853_1014005981 | 160 |
| 13 | 3300005719 | Ga0068861_100477332 | Ga0068861_1004773322 | 160 |
| 14 | 3300005841 | Ga0068863_100254405 | Ga0068863_1002544053 | 160 |
| 15 | 3300005843 | Ga0068860_100134942 | Ga0068860_1001349423 | 160 |
| 16 | 3300006237 | Ga0097621_100051706 | Ga0097621_1000517062 | 160 |
| 17 | 3300006881 | Ga0068865_100020121 | Ga0068865_1000201216 | 160 |
| 18 | 3300009551 | Ga0105238_10684152 | Ga0105238_106841522 | 160 |
| 19 | 3300009551 | Ga0105238_12395115 | Ga0105238_123951151 | 160 |
| 20 | 3300010375 | Ga0105239_10162361 | Ga0105239_101623613 | 160 |
| 21 | 3300013104 | Ga0157370_10033924 | Ga0157370_100339244 | 160 |
| 22 | 3300013297 | Ga0157378_10175160 | Ga0157378_101751602 | 160 |
| 23 | 3300013308 | Ga0157375_10697553 | Ga0157375_106975532 | 160 |
| 24 | 3300025907 | Ga0207645_10060151 | Ga0207645_100601512 | 160 |
| 25 | 3300025924 | Ga0207694_10163744 | Ga0207694_101637442 | 160 |
| 26 | 3300025937 | Ga0207669_10072199 | Ga0207669_100721992 | 160 |
| 27 | 3300025938 | Ga0207704_10819666 | Ga0207704_108196662 | 160 |
| 28 | 3300025942 | Ga0207689_10099900 | Ga0207689_100999004 | 160 |
| 29 | 3300025949 | Ga0207667_10834209 | Ga0207667_108342092 | 160 |
| 30 | 3300026078 | Ga0207702_10081890 | Ga0207702_100818903 | 160 |
| 31 | 3300026088 | Ga0207641_10228015 | Ga0207641_102280151 | 160 |
| 32 | 3300026089 | Ga0207648_10000260 | Ga0207648_1000026015 | 160 |
| 33 | 3300026118 | Ga0207675_100272606 | Ga0207675_1002726061 | 160 |
| 34 | 3300026118 | Ga0207675_100565406 | Ga0207675_1005654062 | 160 |
| 35 | 3300028381 | Ga0268264_10197594 | Ga0268264_101975942 | 160 |
| 36 | 3300031852 | Ga0307410_10638160 | Ga0307410_106381601 | 160 |
| 37 | 3300031911 | Ga0307412_10076112 | Ga0307412_100761122 | 160 |
| 38 | 3300046616 | Ga0495668_0001819 | Ga0495668_0001819_12347_12835 | 160 |
| 39 | 3300053139 | Ga0500568_0003661 | Ga0500568_0003661_5834_6316 | 160 |
| 40 | 2162886011 | MRS1b_contig_4234355 | MRS1b_0249.00000080 | 161 |
| 41 | 3300003320 | rootH2_10014715 | rootH2_100147152 | 161 |
| 42 | 3300005290 | Ga0065712_10001567 | Ga0065712_1000156712 | 161 |
| 43 | 3300005290 | Ga0065712_10230060 | Ga0065712_102300602 | 161 |
| 44 | 3300005293 | Ga0065715_10481615 | Ga0065715_104816151 | 161 |
| 45 | 3300005295 | Ga0065707_10095485 | Ga0065707_100954852 | 161 |
| 46 | 3300005295 | Ga0065707_10204070 | Ga0065707_102040702 | 161 |
| 47 | 3300005327 | Ga0070658_10854429 | Ga0070658_108544292 | 161 |
| 48 | 3300005328 | Ga0070676_10028466 | Ga0070676_100284663 | 161 |
| 49 | 3300005328 | Ga0070676_10157646 | Ga0070676_101576462 | 161 |
| 50 | 3300005328 | Ga0070676_10248938 | Ga0070676_102489381 | 161 |
| 51 | 3300005329 | Ga0070683_100007696 | Ga0070683_1000076963 | 161 |
| 52 | 3300005330 | Ga0070690_100027358 | Ga0070690_1000273581 | 161 |
| 53 | 3300005330 | Ga0070690_100032740 | Ga0070690_1000327402 | 161 |
| 54 | 3300005330 | Ga0070690_100658722 | Ga0070690_1006587221 | 161 |
| 55 | 3300005331 | Ga0070670_100159752 | Ga0070670_1001597522 | 161 |
| 56 | 3300005331 | Ga0070670_100196739 | Ga0070670_1001967391 | 161 |
| 57 | 3300005331 | Ga0070670_100323070 | Ga0070670_1003230702 | 161 |
| 58 | 3300005331 | Ga0070670_100426597 | Ga0070670_1004265972 | 161 |
| 59 | 3300005333 | Ga0070677_10299603 | Ga0070677_102996031 | 161 |
| 60 | 3300005334 | Ga0068869_100001850 | Ga0068869_1000018508 | 161 |
| 61 | 3300005334 | Ga0068869_100009539 | Ga0068869_1000095395 | 161 |
| 62 | 3300005334 | Ga0068869_100037747 | Ga0068869_1000377472 | 161 |
| 63 | 3300005334 | Ga0068869_100234083 | Ga0068869_1002340832 | 161 |
| 64 | 3300005334 | Ga0068869_100416538 | Ga0068869_1004165382 | 161 |
| 65 | 3300005334 | Ga0068869_101623318 | Ga0068869_1016233181 | 161 |
| 66 | 3300005335 | Ga0070666_10000127 | Ga0070666_1000012712 | 161 |
| 67 | 3300005335 | Ga0070666_10014370 | Ga0070666_100143705 | 161 |
| 68 | 3300005335 | Ga0070666_10041325 | Ga0070666_100413253 | 161 |
| 69 | 3300005335 | Ga0070666_10268305 | Ga0070666_102683052 | 161 |
| 70 | 3300005335 | Ga0070666_10310223 | Ga0070666_103102231 | 161 |
| 71 | 3300005335 | Ga0070666_10400568 | Ga0070666_104005682 | 161 |
| 72 | 3300005337 | Ga0070682_100771364 | Ga0070682_1007713642 | 161 |
| 73 | 3300005338 | Ga0068868_100005670 | Ga0068868_1000056703 | 161 |
| 74 | 3300005338 | Ga0068868_100007552 | Ga0068868_1000075522 | 161 |
| 75 | 3300005338 | Ga0068868_100013219 | Ga0068868_1000132195 | 161 |
| 76 | 3300005338 | Ga0068868_100030307 | Ga0068868_1000303073 | 161 |
| 77 | 3300005338 | Ga0068868_100166603 | Ga0068868_1001666033 | 161 |
| 78 | 3300005338 | Ga0068868_100332300 | Ga0068868_1003323002 | 161 |
| 79 | 3300005339 | Ga0070660_100007829 | Ga0070660_1000078292 | 161 |
| 80 | 3300005340 | Ga0070689_100004423 | Ga0070689_1000044235 | 161 |
| 81 | 3300005340 | Ga0070689_100036841 | Ga0070689_1000368411 | 161 |
| 82 | 3300005340 | Ga0070689_100239541 | Ga0070689_1002395412 | 161 |
| 83 | 3300005340 | Ga0070689_100321672 | Ga0070689_1003216722 | 161 |
| 84 | 3300005343 | Ga0070687_100006493 | Ga0070687_1000064931 | 161 |
| 85 | 3300005344 | Ga0070661_100095021 | Ga0070661_1000950212 | 161 |
| 86 | 3300005344 | Ga0070661_100319900 | Ga0070661_1003199002 | 161 |
| 87 | 3300005345 | Ga0070692_10560040 | Ga0070692_105600402 | 161 |
| 88 | 3300005347 | Ga0070668_100058326 | Ga0070668_1000583262 | 161 |
| 89 | 3300005353 | Ga0070669_100035285 | Ga0070669_1000352852 | 161 |
| 90 | 3300005353 | Ga0070669_100218612 | Ga0070669_1002186123 | 161 |
| 91 | 3300005354 | Ga0070675_100022380 | Ga0070675_1000223801 | 161 |
| 92 | 3300005354 | Ga0070675_100076631 | Ga0070675_1000766314 | 161 |
| 93 | 3300005354 | Ga0070675_100196652 | Ga0070675_1001966524 | 161 |
| 94 | 3300005354 | Ga0070675_100211289 | Ga0070675_1002112892 | 161 |
| 95 | 3300005354 | Ga0070675_100764682 | Ga0070675_1007646821 | 161 |
| 96 | 3300005354 | Ga0070675_101406229 | Ga0070675_1014062291 | 161 |
| 97 | 3300005355 | Ga0070671_100018592 | Ga0070671_1000185922 | 161 |
| 98 | 3300005355 | Ga0070671_100063111 | Ga0070671_1000631111 | 161 |
| 99 | 3300005355 | Ga0070671_100650581 | Ga0070671_1006505811 | 161 |
| 100 | 3300005356 | Ga0070674_100443426 | Ga0070674_1004434261 | 161 |
| 101 | 3300005356 | Ga0070674_100695465 | Ga0070674_1006954651 | 161 |
| 102 | 3300005364 | Ga0070673_100010606 | Ga0070673_1000106063 | 161 |
| 103 | 3300005364 | Ga0070673_100037208 | Ga0070673_1000372083 | 161 |
| 104 | 3300005364 | Ga0070673_100043345 | Ga0070673_1000433453 | 161 |
| 105 | 3300005364 | Ga0070673_100190631 | Ga0070673_1001906312 | 161 |
| 106 | 3300005365 | Ga0070688_100057889 | Ga0070688_1000578892 | 161 |
| 107 | 3300005365 | Ga0070688_100062103 | Ga0070688_1000621032 | 161 |
| 108 | 3300005366 | Ga0070659_100014717 | Ga0070659_1000147172 | 161 |
| 109 | 3300005366 | Ga0070659_100642257 | Ga0070659_1006422572 | 161 |
| 110 | 3300005367 | Ga0070667_100007591 | Ga0070667_1000075914 | 161 |
| 111 | 3300005367 | Ga0070667_100013534 | Ga0070667_1000135343 | 161 |
| 112 | 3300005367 | Ga0070667_100063851 | Ga0070667_1000638513 | 161 |
| 113 | 3300005367 | Ga0070667_100079184 | Ga0070667_1000791842 | 161 |
| 114 | 3300005367 | Ga0070667_100094694 | Ga0070667_1000946942 | 161 |
| 115 | 3300005367 | Ga0070667_100235083 | Ga0070667_1002350832 | 161 |
| 116 | 3300005367 | Ga0070667_100905920 | Ga0070667_1009059201 | 161 |
| 117 | 3300005367 | Ga0070667_102121377 | Ga0070667_1021213771 | 161 |
| 118 | 3300005434 | Ga0070709_11300772 | Ga0070709_113007721 | 161 |
| 119 | 3300005441 | Ga0070700_100040779 | Ga0070700_1000407792 | 161 |
| 120 | 3300005444 | Ga0070694_100241642 | Ga0070694_1002416421 | 161 |
| 121 | 3300005455 | Ga0070663_100267403 | Ga0070663_1002674032 | 161 |
| 122 | 3300005455 | Ga0070663_100953625 | Ga0070663_1009536251 | 161 |
| 123 | 3300005456 | Ga0070678_100188610 | Ga0070678_1001886102 | 161 |
| 124 | 3300005456 | Ga0070678_100431151 | Ga0070678_1004311511 | 161 |
| 125 | 3300005456 | Ga0070678_100832695 | Ga0070678_1008326952 | 161 |
| 126 | 3300005457 | Ga0070662_100029275 | Ga0070662_1000292752 | 161 |
| 127 | 3300005457 | Ga0070662_100048370 | Ga0070662_1000483701 | 161 |
| 128 | 3300005457 | Ga0070662_100051142 | Ga0070662_1000511423 | 161 |
| 129 | 3300005457 | Ga0070662_100183776 | Ga0070662_1001837762 | 161 |
| 130 | 3300005458 | Ga0070681_10968836 | Ga0070681_109688361 | 161 |
| 131 | 3300005459 | Ga0068867_100013723 | Ga0068867_1000137233 | 161 |
| 132 | 3300005459 | Ga0068867_100028976 | Ga0068867_1000289762 | 161 |
| 133 | 3300005459 | Ga0068867_100152741 | Ga0068867_1001527412 | 161 |
| 134 | 3300005459 | Ga0068867_100190003 | Ga0068867_1001900032 | 161 |
| 135 | 3300005459 | Ga0068867_100436386 | Ga0068867_1004363861 | 161 |
| 136 | 3300005459 | Ga0068867_100573899 | Ga0068867_1005738992 | 161 |
| 137 | 3300005466 | Ga0070685_10252918 | Ga0070685_102529182 | 161 |
| 138 | 3300005466 | Ga0070685_10290596 | Ga0070685_102905962 | 161 |
| 139 | 3300005535 | Ga0070684_100003930 | Ga0070684_1000039302 | 161 |
| 140 | 3300005535 | Ga0070684_100111498 | Ga0070684_1001114982 | 161 |
| 141 | 3300005535 | Ga0070684_100304324 | Ga0070684_1003043242 | 161 |
| 142 | 3300005535 | Ga0070684_100454591 | Ga0070684_1004545912 | 161 |
| 143 | 3300005539 | Ga0068853_100007598 | Ga0068853_1000075987 | 161 |
| 144 | 3300005539 | Ga0068853_100141363 | Ga0068853_1001413632 | 161 |
| 145 | 3300005539 | Ga0068853_100572461 | Ga0068853_1005724612 | 161 |
| 146 | 3300005539 | Ga0068853_100885542 | Ga0068853_1008855422 | 161 |
| 147 | 3300005543 | Ga0070672_100013498 | Ga0070672_1000134982 | 161 |
| 148 | 3300005543 | Ga0070672_100084057 | Ga0070672_1000840572 | 161 |
| 149 | 3300005543 | Ga0070672_101652348 | Ga0070672_1016523481 | 161 |
| 150 | 3300005544 | Ga0070686_100016237 | Ga0070686_1000162375 | 161 |
| 151 | 3300005544 | Ga0070686_100341985 | Ga0070686_1003419851 | 161 |
| 152 | 3300005544 | Ga0070686_100899827 | Ga0070686_1008998271 | 161 |
| 153 | 3300005544 | Ga0070686_100941153 | Ga0070686_1009411531 | 161 |
| 154 | 3300005548 | Ga0070665_100153414 | Ga0070665_1001534142 | 161 |
| 155 | 3300005548 | Ga0070665_100993639 | Ga0070665_1009936391 | 161 |
| 156 | 3300005563 | Ga0068855_100859577 | Ga0068855_1008595772 | 161 |
| 157 | 3300005564 | Ga0070664_100023253 | Ga0070664_1000232532 | 161 |
| 158 | 3300005564 | Ga0070664_100029660 | Ga0070664_1000296604 | 161 |
| 159 | 3300005564 | Ga0070664_100141033 | Ga0070664_1001410332 | 161 |
| 160 | 3300005564 | Ga0070664_100143176 | Ga0070664_1001431762 | 161 |
| 161 | 3300005564 | Ga0070664_100146336 | Ga0070664_1001463362 | 161 |
| 162 | 3300005564 | Ga0070664_100415753 | Ga0070664_1004157533 | 161 |
| 163 | 3300005564 | Ga0070664_100487530 | Ga0070664_1004875302 | 161 |
| 164 | 3300005564 | Ga0070664_100716877 | Ga0070664_1007168771 | 161 |
| 165 | 3300005577 | Ga0068857_100012224 | Ga0068857_1000122245 | 161 |
| 166 | 3300005577 | Ga0068857_100024477 | Ga0068857_1000244772 | 161 |
| 167 | 3300005577 | Ga0068857_100063896 | Ga0068857_1000638963 | 161 |
| 168 | 3300005578 | Ga0068854_100019390 | Ga0068854_1000193904 | 161 |
| 169 | 3300005578 | Ga0068854_100049871 | Ga0068854_1000498712 | 161 |
| 170 | 3300005578 | Ga0068854_100342457 | Ga0068854_1003424571 | 161 |
| 171 | 3300005578 | Ga0068854_100555320 | Ga0068854_1005553202 | 161 |
| 172 | 3300005616 | Ga0068852_100033780 | Ga0068852_1000337803 | 161 |
| 173 | 3300005616 | Ga0068852_100044139 | Ga0068852_1000441395 | 161 |
| 174 | 3300005616 | Ga0068852_100045895 | Ga0068852_1000458952 | 161 |
| 175 | 3300005616 | Ga0068852_100049011 | Ga0068852_1000490115 | 161 |
| 176 | 3300005616 | Ga0068852_100356097 | Ga0068852_1003560972 | 161 |
| 177 | 3300005616 | Ga0068852_100468346 | Ga0068852_1004683462 | 161 |
| 178 | 3300005617 | Ga0068859_100000098 | Ga0068859_10000009825 | 161 |
| 179 | 3300005617 | Ga0068859_100017189 | Ga0068859_1000171892 | 161 |
| 180 | 3300005617 | Ga0068859_100029305 | Ga0068859_1000293055 | 161 |
| 181 | 3300005617 | Ga0068859_100107032 | Ga0068859_1001070322 | 161 |
| 182 | 3300005618 | Ga0068864_100034536 | Ga0068864_1000345364 | 161 |
| 183 | 3300005618 | Ga0068864_100068541 | Ga0068864_1000685413 | 161 |
| 184 | 3300005618 | Ga0068864_100098437 | Ga0068864_1000984372 | 161 |
| 185 | 3300005719 | Ga0068861_100022702 | Ga0068861_1000227021 | 161 |
| 186 | 3300005719 | Ga0068861_100597558 | Ga0068861_1005975582 | 161 |
| 187 | 3300005719 | Ga0068861_102378304 | Ga0068861_1023783041 | 161 |
| 188 | 3300005834 | Ga0068851_10084974 | Ga0068851_100849742 | 161 |
| 189 | 3300005834 | Ga0068851_10103289 | Ga0068851_101032892 | 161 |
| 190 | 3300005834 | Ga0068851_10256551 | Ga0068851_102565512 | 161 |
| 191 | 3300005834 | Ga0068851_10294544 | Ga0068851_102945441 | 161 |
| 192 | 3300005834 | Ga0068851_10326306 | Ga0068851_103263062 | 161 |
| 193 | 3300005834 | Ga0068851_10575016 | Ga0068851_105750161 | 161 |
| 194 | 3300005840 | Ga0068870_10032627 | Ga0068870_100326271 | 161 |
| 195 | 3300005840 | Ga0068870_10692720 | Ga0068870_106927202 | 161 |
| 196 | 3300005841 | Ga0068863_100002114 | Ga0068863_1000021146 | 161 |
| 197 | 3300005841 | Ga0068863_100097781 | Ga0068863_1000977813 | 161 |
| 198 | 3300005841 | Ga0068863_100716373 | Ga0068863_1007163732 | 161 |
| 199 | 3300005841 | Ga0068863_100891173 | Ga0068863_1008911731 | 161 |
| 200 | 3300005841 | Ga0068863_101227699 | Ga0068863_1012276992 | 161 |
| 201 | 3300005842 | Ga0068858_100004286 | Ga0068858_1000042863 | 161 |
| 202 | 3300005842 | Ga0068858_100092637 | Ga0068858_1000926374 | 161 |
| 203 | 3300005842 | Ga0068858_100864207 | Ga0068858_1008642072 | 161 |
| 204 | 3300005842 | Ga0068858_100880210 | Ga0068858_1008802102 | 161 |
| 205 | 3300005843 | Ga0068860_100002611 | Ga0068860_10000261121 | 161 |
| 206 | 3300005843 | Ga0068860_100008715 | Ga0068860_1000087155 | 161 |
| 207 | 3300005843 | Ga0068860_100026008 | Ga0068860_1000260086 | 161 |
| 208 | 3300005843 | Ga0068860_100045977 | Ga0068860_1000459774 | 161 |
| 209 | 3300005843 | Ga0068860_100454837 | Ga0068860_1004548372 | 161 |
| 210 | 3300005843 | Ga0068860_100615053 | Ga0068860_1006150532 | 161 |
| 211 | 3300005844 | Ga0068862_100021507 | Ga0068862_1000215077 | 161 |
| 212 | 3300005844 | Ga0068862_100460941 | Ga0068862_1004609412 | 161 |
| 213 | 3300005844 | Ga0068862_100764600 | Ga0068862_1007646002 | 161 |
| 214 | 3300005844 | Ga0068862_100855000 | Ga0068862_1008550002 | 161 |
| 215 | 3300005844 | Ga0068862_101703507 | Ga0068862_1017035071 | 161 |
| 216 | 3300005985 | Ga0081539_10051231 | Ga0081539_100512313 | 161 |
| 217 | 3300006237 | Ga0097621_100016333 | Ga0097621_1000163335 | 161 |
| 218 | 3300006237 | Ga0097621_100223238 | Ga0097621_1002232382 | 161 |
| 219 | 3300006237 | Ga0097621_100430398 | Ga0097621_1004303982 | 161 |
| 220 | 3300006358 | Ga0068871_100008063 | Ga0068871_1000080636 | 161 |
| 221 | 3300006358 | Ga0068871_100020720 | Ga0068871_1000207204 | 161 |
| 222 | 3300006358 | Ga0068871_100140045 | Ga0068871_1001400453 | 161 |
| 223 | 3300006358 | Ga0068871_100295650 | Ga0068871_1002956502 | 161 |
| 224 | 3300006358 | Ga0068871_100401329 | Ga0068871_1004013292 | 161 |
| 225 | 3300006358 | Ga0068871_100878430 | Ga0068871_1008784302 | 161 |
| 226 | 3300006358 | Ga0068871_101234288 | Ga0068871_1012342882 | 161 |
| 227 | 3300006871 | Ga0075434_100037201 | Ga0075434_1000372014 | 161 |
| 228 | 3300006871 | Ga0075434_100235685 | Ga0075434_1002356852 | 161 |
| 229 | 3300006881 | Ga0068865_100124096 | Ga0068865_1001240964 | 161 |
| 230 | 3300006881 | Ga0068865_100379989 | Ga0068865_1003799893 | 161 |
| 231 | 3300006881 | Ga0068865_100441889 | Ga0068865_1004418892 | 161 |
| 232 | 3300006931 | Ga0097620_100000098 | Ga0097620_10000009825 | 161 |
| 233 | 3300006931 | Ga0097620_100017190 | Ga0097620_1000171902 | 161 |
| 234 | 3300006931 | Ga0097620_100029305 | Ga0097620_1000293055 | 161 |
| 235 | 3300006931 | Ga0097620_100107033 | Ga0097620_1001070332 | 161 |
| 236 | 3300009011 | Ga0105251_10090997 | Ga0105251_100909971 | 161 |
| 237 | 3300009093 | Ga0105240_10048921 | Ga0105240_100489212 | 161 |
| 238 | 3300009093 | Ga0105240_10961135 | Ga0105240_109611352 | 161 |
| 239 | 3300009094 | Ga0111539_10005240 | Ga0111539_1000524015 | 161 |
| 240 | 3300009101 | Ga0105247_10001541 | Ga0105247_100015413 | 161 |
| 241 | 3300009101 | Ga0105247_10013490 | Ga0105247_100134902 | 161 |
| 242 | 3300009101 | Ga0105247_10412456 | Ga0105247_104124562 | 161 |
| 243 | 3300009147 | Ga0114129_11345854 | Ga0114129_113458542 | 161 |
| 244 | 3300009148 | Ga0105243_11268000 | Ga0105243_112680001 | 161 |
| 245 | 3300009148 | Ga0105243_11790766 | Ga0105243_117907661 | 161 |
| 246 | 3300009174 | Ga0105241_10000426 | Ga0105241_1000042619 | 161 |
| 247 | 3300009174 | Ga0105241_11872309 | Ga0105241_118723091 | 161 |
| 248 | 3300009176 | Ga0105242_10166195 | Ga0105242_101661952 | 161 |
| 249 | 3300009176 | Ga0105242_10280303 | Ga0105242_102803032 | 161 |
| 250 | 3300009176 | Ga0105242_11197425 | Ga0105242_111974252 | 161 |
| 251 | 3300009177 | Ga0105248_10398613 | Ga0105248_103986132 | 161 |
| 252 | 3300009177 | Ga0105248_11149122 | Ga0105248_111491222 | 161 |
| 253 | 3300009545 | Ga0105237_10003853 | Ga0105237_1000385311 | 161 |
| 254 | 3300009545 | Ga0105237_11575508 | Ga0105237_115755082 | 161 |
| 255 | 3300009553 | Ga0105249_10010747 | Ga0105249_100107476 | 161 |
| 256 | 3300009553 | Ga0105249_10130739 | Ga0105249_101307392 | 161 |
| 257 | 3300009553 | Ga0105249_10338112 | Ga0105249_103381121 | 161 |
| 258 | 3300009553 | Ga0105249_10533259 | Ga0105249_105332592 | 161 |
| 259 | 3300009553 | Ga0105249_10756495 | Ga0105249_107564952 | 161 |
| 260 | 3300009553 | Ga0105249_11369420 | Ga0105249_113694202 | 161 |
| 261 | 3300010375 | Ga0105239_10068708 | Ga0105239_100687084 | 161 |
| 262 | 3300010375 | Ga0105239_10995713 | Ga0105239_109957132 | 161 |
| 263 | 3300011119 | Ga0105246_10114368 | Ga0105246_101143683 | 161 |
| 264 | 3300011119 | Ga0105246_10159395 | Ga0105246_101593952 | 161 |
| 265 | 3300011119 | Ga0105246_10189621 | Ga0105246_101896212 | 161 |
| 266 | 3300011119 | Ga0105246_10212276 | Ga0105246_102122763 | 161 |
| 267 | 3300013100 | Ga0157373_10198175 | Ga0157373_101981752 | 161 |
| 268 | 3300013102 | Ga0157371_10219816 | Ga0157371_102198162 | 161 |
| 269 | 3300013102 | Ga0157371_10252605 | Ga0157371_102526052 | 161 |
| 270 | 3300013104 | Ga0157370_10122963 | Ga0157370_101229631 | 161 |
| 271 | 3300013105 | Ga0157369_10163444 | Ga0157369_101634442 | 161 |
| 272 | 3300013296 | Ga0157374_10001178 | Ga0157374_1000117816 | 161 |
| 273 | 3300013296 | Ga0157374_10003276 | Ga0157374_100032767 | 161 |
| 274 | 3300013296 | Ga0157374_10016837 | Ga0157374_100168372 | 161 |
| 275 | 3300013296 | Ga0157374_10161296 | Ga0157374_101612962 | 161 |
| 276 | 3300013296 | Ga0157374_10330887 | Ga0157374_103308872 | 161 |
| 277 | 3300013296 | Ga0157374_10463820 | Ga0157374_104638202 | 161 |
| 278 | 3300013296 | Ga0157374_10513506 | Ga0157374_105135062 | 161 |
| 279 | 3300013297 | Ga0157378_10013365 | Ga0157378_100133656 | 161 |
| 280 | 3300013297 | Ga0157378_10039647 | Ga0157378_100396473 | 161 |
| 281 | 3300013297 | Ga0157378_10103242 | Ga0157378_101032422 | 161 |
| 282 | 3300013297 | Ga0157378_10140437 | Ga0157378_101404374 | 161 |
| 283 | 3300013297 | Ga0157378_10149757 | Ga0157378_101497572 | 161 |
| 284 | 3300013297 | Ga0157378_10181199 | Ga0157378_101811992 | 161 |
| 285 | 3300013297 | Ga0157378_10982791 | Ga0157378_109827912 | 161 |
| 286 | 3300013297 | Ga0157378_11427737 | Ga0157378_114277371 | 161 |
| 287 | 3300013306 | Ga0163162_10000376 | Ga0163162_1000037619 | 161 |
| 288 | 3300013306 | Ga0163162_10000736 | Ga0163162_1000073617 | 161 |
| 289 | 3300013306 | Ga0163162_10010551 | Ga0163162_100105517 | 161 |
| 290 | 3300013306 | Ga0163162_10054037 | Ga0163162_100540373 | 161 |
| 291 | 3300013306 | Ga0163162_10481685 | Ga0163162_104816852 | 161 |
| 292 | 3300013307 | Ga0157372_10029125 | Ga0157372_100291254 | 161 |
| 293 | 3300013307 | Ga0157372_10330320 | Ga0157372_103303202 | 161 |
| 294 | 3300013308 | Ga0157375_10018253 | Ga0157375_100182537 | 161 |
| 295 | 3300013308 | Ga0157375_10058827 | Ga0157375_100588274 | 161 |
| 296 | 3300013308 | Ga0157375_10136843 | Ga0157375_101368432 | 161 |
| 297 | 3300013308 | Ga0157375_10771258 | Ga0157375_107712582 | 161 |
| 298 | 3300014325 | Ga0163163_10000803 | Ga0163163_100008039 | 161 |
| 299 | 3300014325 | Ga0163163_10020169 | Ga0163163_100201695 | 161 |
| 300 | 3300014325 | Ga0163163_10066461 | Ga0163163_100664615 | 161 |
| 301 | 3300014325 | Ga0163163_10311616 | Ga0163163_103116162 | 161 |
| 302 | 3300014325 | Ga0163163_10481930 | Ga0163163_104819301 | 161 |
| 303 | 3300014326 | Ga0157380_10001088 | Ga0157380_100010886 | 161 |
| 304 | 3300014326 | Ga0157380_10499069 | Ga0157380_104990691 | 161 |
| 305 | 3300014326 | Ga0157380_11149194 | Ga0157380_111491941 | 161 |
| 306 | 3300014745 | Ga0157377_10003528 | Ga0157377_100035285 | 161 |
| 307 | 3300014745 | Ga0157377_10009333 | Ga0157377_100093332 | 161 |
| 308 | 3300014745 | Ga0157377_10752952 | Ga0157377_107529522 | 161 |
| 309 | 3300014968 | Ga0157379_10019184 | Ga0157379_100191847 | 161 |
| 310 | 3300014968 | Ga0157379_10067509 | Ga0157379_100675093 | 161 |
| 311 | 3300014968 | Ga0157379_10118413 | Ga0157379_101184133 | 161 |
| 312 | 3300014968 | Ga0157379_10164988 | Ga0157379_101649882 | 161 |
| 313 | 3300014968 | Ga0157379_10534521 | Ga0157379_105345211 | 161 |
| 314 | 3300014969 | Ga0157376_10005350 | Ga0157376_100053509 | 161 |
| 315 | 3300014969 | Ga0157376_10040197 | Ga0157376_100401973 | 161 |
| 316 | 3300014969 | Ga0157376_10175906 | Ga0157376_101759062 | 161 |
| 317 | 3300014969 | Ga0157376_10633658 | Ga0157376_106336582 | 161 |
| 318 | 3300017792 | Ga0163161_10015385 | Ga0163161_100153855 | 161 |
| 319 | 3300017792 | Ga0163161_10031511 | Ga0163161_100315112 | 161 |
| 320 | 3300017792 | Ga0163161_10552201 | Ga0163161_105522012 | 161 |
| 321 | 3300017792 | Ga0163161_11131023 | Ga0163161_111310231 | 161 |
| 322 | 3300025321 | Ga0207656_10012767 | Ga0207656_100127673 | 161 |
| 323 | 3300025321 | Ga0207656_10214160 | Ga0207656_102141601 | 161 |
| 324 | 3300025321 | Ga0207656_10350670 | Ga0207656_103506701 | 161 |
| 325 | 3300025893 | Ga0207682_10366974 | Ga0207682_103669741 | 161 |
| 326 | 3300025900 | Ga0207710_10005089 | Ga0207710_100050895 | 161 |
| 327 | 3300025900 | Ga0207710_10269568 | Ga0207710_102695681 | 161 |
| 328 | 3300025903 | Ga0207680_10000408 | Ga0207680_1000040811 | 161 |
| 329 | 3300025903 | Ga0207680_10352936 | Ga0207680_103529362 | 161 |
| 330 | 3300025904 | Ga0207647_10391571 | Ga0207647_103915712 | 161 |
| 331 | 3300025907 | Ga0207645_10023001 | Ga0207645_100230015 | 161 |
| 332 | 3300025907 | Ga0207645_10273148 | Ga0207645_102731482 | 161 |
| 333 | 3300025907 | Ga0207645_10929660 | Ga0207645_109296601 | 161 |
| 334 | 3300025908 | Ga0207643_10019785 | Ga0207643_100197852 | 161 |
| 335 | 3300025909 | Ga0207705_10692879 | Ga0207705_106928792 | 161 |
| 336 | 3300025911 | Ga0207654_10001077 | Ga0207654_100010776 | 161 |
| 337 | 3300025913 | Ga0207695_10135298 | Ga0207695_101352983 | 161 |
| 338 | 3300025914 | Ga0207671_10002175 | Ga0207671_1000217514 | 161 |
| 339 | 3300025918 | Ga0207662_10005885 | Ga0207662_100058855 | 161 |
| 340 | 3300025919 | Ga0207657_10007407 | Ga0207657_100074078 | 161 |
| 341 | 3300025920 | Ga0207649_10063136 | Ga0207649_100631362 | 161 |
| 342 | 3300025920 | Ga0207649_10191759 | Ga0207649_101917591 | 161 |
| 343 | 3300025920 | Ga0207649_11064074 | Ga0207649_110640741 | 161 |
| 344 | 3300025923 | Ga0207681_10039871 | Ga0207681_100398715 | 161 |
| 345 | 3300025923 | Ga0207681_10535680 | Ga0207681_105356802 | 161 |
| 346 | 3300025925 | Ga0207650_10077238 | Ga0207650_100772382 | 161 |
| 347 | 3300025925 | Ga0207650_10081238 | Ga0207650_100812382 | 161 |
| 348 | 3300025925 | Ga0207650_10298638 | Ga0207650_102986381 | 161 |
| 349 | 3300025926 | Ga0207659_10017079 | Ga0207659_100170795 | 161 |
| 350 | 3300025926 | Ga0207659_10029977 | Ga0207659_100299772 | 161 |
| 351 | 3300025926 | Ga0207659_10463171 | Ga0207659_104631712 | 161 |
| 352 | 3300025931 | Ga0207644_10078537 | Ga0207644_100785372 | 161 |
| 353 | 3300025931 | Ga0207644_10119438 | Ga0207644_101194381 | 161 |
| 354 | 3300025931 | Ga0207644_10159171 | Ga0207644_101591712 | 161 |
| 355 | 3300025931 | Ga0207644_11352541 | Ga0207644_113525412 | 161 |
| 356 | 3300025932 | Ga0207690_10195032 | Ga0207690_101950322 | 161 |
| 357 | 3300025933 | Ga0207706_10005971 | Ga0207706_100059714 | 161 |
| 358 | 3300025933 | Ga0207706_10009126 | Ga0207706_1000912610 | 161 |
| 359 | 3300025933 | Ga0207706_10016466 | Ga0207706_100164665 | 161 |
| 360 | 3300025933 | Ga0207706_10025117 | Ga0207706_100251172 | 161 |
| 361 | 3300025933 | Ga0207706_10027500 | Ga0207706_100275002 | 161 |
| 362 | 3300025933 | Ga0207706_10045334 | Ga0207706_100453342 | 161 |
| 363 | 3300025934 | Ga0207686_10070740 | Ga0207686_100707402 | 161 |
| 364 | 3300025934 | Ga0207686_10457723 | Ga0207686_104577231 | 161 |
| 365 | 3300025936 | Ga0207670_10005049 | Ga0207670_100050494 | 161 |
| 366 | 3300025936 | Ga0207670_10309951 | Ga0207670_103099512 | 161 |
| 367 | 3300025938 | Ga0207704_10448344 | Ga0207704_104483442 | 161 |
| 368 | 3300025940 | Ga0207691_10027432 | Ga0207691_100274326 | 161 |
| 369 | 3300025940 | Ga0207691_10036564 | Ga0207691_100365644 | 161 |
| 370 | 3300025940 | Ga0207691_10172245 | Ga0207691_101722452 | 161 |
| 371 | 3300025940 | Ga0207691_11328944 | Ga0207691_113289442 | 161 |
| 372 | 3300025941 | Ga0207711_10870663 | Ga0207711_108706631 | 161 |
| 373 | 3300025942 | Ga0207689_10000357 | Ga0207689_1000035727 | 161 |
| 374 | 3300025942 | Ga0207689_10005824 | Ga0207689_100058247 | 161 |
| 375 | 3300025942 | Ga0207689_10032834 | Ga0207689_100328343 | 161 |
| 376 | 3300025942 | Ga0207689_10033210 | Ga0207689_100332105 | 161 |
| 377 | 3300025942 | Ga0207689_10039976 | Ga0207689_100399762 | 161 |
| 378 | 3300025942 | Ga0207689_10056654 | Ga0207689_100566543 | 161 |
| 379 | 3300025942 | Ga0207689_10168409 | Ga0207689_101684091 | 161 |
| 380 | 3300025942 | Ga0207689_10366272 | Ga0207689_103662722 | 161 |
| 381 | 3300025944 | Ga0207661_10007258 | Ga0207661_100072586 | 161 |
| 382 | 3300025944 | Ga0207661_10263569 | Ga0207661_102635693 | 161 |
| 383 | 3300025945 | Ga0207679_10001099 | Ga0207679_100010998 | 161 |
| 384 | 3300025945 | Ga0207679_10044056 | Ga0207679_100440562 | 161 |
| 385 | 3300025945 | Ga0207679_10062335 | Ga0207679_100623352 | 161 |
| 386 | 3300025945 | Ga0207679_10072030 | Ga0207679_100720302 | 161 |
| 387 | 3300025945 | Ga0207679_10701647 | Ga0207679_107016471 | 161 |
| 388 | 3300025945 | Ga0207679_11499553 | Ga0207679_114995531 | 161 |
| 389 | 3300025960 | Ga0207651_10029891 | Ga0207651_100298912 | 161 |
| 390 | 3300025960 | Ga0207651_10844884 | Ga0207651_108448841 | 161 |
| 391 | 3300025960 | Ga0207651_10920367 | Ga0207651_109203671 | 161 |
| 392 | 3300025960 | Ga0207651_11057830 | Ga0207651_110578301 | 161 |
| 393 | 3300025961 | Ga0207712_10025486 | Ga0207712_100254861 | 161 |
| 394 | 3300025961 | Ga0207712_10100105 | Ga0207712_101001052 | 161 |
| 395 | 3300025961 | Ga0207712_10111280 | Ga0207712_101112802 | 161 |
| 396 | 3300025961 | Ga0207712_10591562 | Ga0207712_105915622 | 161 |
| 397 | 3300025961 | Ga0207712_10629673 | Ga0207712_106296732 | 161 |
| 398 | 3300025981 | Ga0207640_10510058 | Ga0207640_105100582 | 161 |
| 399 | 3300025981 | Ga0207640_10930226 | Ga0207640_109302261 | 161 |
| 400 | 3300025986 | Ga0207658_10008823 | Ga0207658_100088235 | 161 |
| 401 | 3300025986 | Ga0207658_10023335 | Ga0207658_100233352 | 161 |
| 402 | 3300025986 | Ga0207658_10056508 | Ga0207658_100565083 | 161 |
| 403 | 3300025986 | Ga0207658_10480892 | Ga0207658_104808921 | 161 |
| 404 | 3300025986 | Ga0207658_10823618 | Ga0207658_108236182 | 161 |
| 405 | 3300025986 | Ga0207658_10909375 | Ga0207658_109093751 | 161 |
| 406 | 3300025986 | Ga0207658_10994695 | Ga0207658_109946952 | 161 |
| 407 | 3300026023 | Ga0207677_10016641 | Ga0207677_100166413 | 161 |
| 408 | 3300026023 | Ga0207677_10065714 | Ga0207677_100657143 | 161 |
| 409 | 3300026023 | Ga0207677_10253187 | Ga0207677_102531872 | 161 |
| 410 | 3300026023 | Ga0207677_10308344 | Ga0207677_103083442 | 161 |
| 411 | 3300026023 | Ga0207677_10396310 | Ga0207677_103963102 | 161 |
| 412 | 3300026035 | Ga0207703_10010057 | Ga0207703_100100578 | 161 |
| 413 | 3300026035 | Ga0207703_10814995 | Ga0207703_108149952 | 161 |
| 414 | 3300026041 | Ga0207639_10009624 | Ga0207639_100096242 | 161 |
| 415 | 3300026067 | Ga0207678_10036598 | Ga0207678_100365984 | 161 |
| 416 | 3300026075 | Ga0207708_10133349 | Ga0207708_101333492 | 161 |
| 417 | 3300026088 | Ga0207641_10000840 | Ga0207641_1000084020 | 161 |
| 418 | 3300026088 | Ga0207641_11426865 | Ga0207641_114268651 | 161 |
| 419 | 3300026089 | Ga0207648_10028135 | Ga0207648_100281353 | 161 |
| 420 | 3300026089 | Ga0207648_10047679 | Ga0207648_100476792 | 161 |
| 421 | 3300026089 | Ga0207648_10134595 | Ga0207648_101345952 | 161 |
| 422 | 3300026095 | Ga0207676_10006164 | Ga0207676_100061644 | 161 |
| 423 | 3300026095 | Ga0207676_10010000 | Ga0207676_100100002 | 161 |
| 424 | 3300026095 | Ga0207676_10148514 | Ga0207676_101485143 | 161 |
| 425 | 3300026095 | Ga0207676_10188657 | Ga0207676_101886571 | 161 |
| 426 | 3300026095 | Ga0207676_10500712 | Ga0207676_105007122 | 161 |
| 427 | 3300026116 | Ga0207674_10010177 | Ga0207674_100101774 | 161 |
| 428 | 3300026116 | Ga0207674_10028171 | Ga0207674_100281712 | 161 |
| 429 | 3300026116 | Ga0207674_10031851 | Ga0207674_100318514 | 161 |
| 430 | 3300026116 | Ga0207674_10120100 | Ga0207674_101201002 | 161 |
| 431 | 3300026118 | Ga0207675_101092581 | Ga0207675_1010925811 | 161 |
| 432 | 3300026118 | Ga0207675_102238857 | Ga0207675_1022388571 | 161 |
| 433 | 3300026121 | Ga0207683_10206554 | Ga0207683_102065542 | 161 |
| 434 | 3300026121 | Ga0207683_10223201 | Ga0207683_102232014 | 161 |
| 435 | 3300026121 | Ga0207683_10800128 | Ga0207683_108001281 | 161 |
| 436 | 3300026142 | Ga0207698_10039278 | Ga0207698_100392784 | 161 |
| 437 | 3300026142 | Ga0207698_10126944 | Ga0207698_101269441 | 161 |
| 438 | 3300026142 | Ga0207698_10131433 | Ga0207698_101314332 | 161 |
| 439 | 3300026142 | Ga0207698_10140495 | Ga0207698_101404952 | 161 |
| 440 | 3300026142 | Ga0207698_10152213 | Ga0207698_101522132 | 161 |
| 441 | 3300026142 | Ga0207698_11226344 | Ga0207698_112263442 | 161 |
| 442 | 3300028379 | Ga0268266_10851392 | Ga0268266_108513923 | 161 |
| 443 | 3300028380 | Ga0268265_10157833 | Ga0268265_101578332 | 161 |
| 444 | 3300028380 | Ga0268265_10330079 | Ga0268265_103300792 | 161 |
| 445 | 3300028380 | Ga0268265_10555233 | Ga0268265_105552332 | 161 |
| 446 | 3300028380 | Ga0268265_11774680 | Ga0268265_117746801 | 161 |
| 447 | 3300028381 | Ga0268264_10001002 | Ga0268264_1000100215 | 161 |
| 448 | 3300028381 | Ga0268264_10009470 | Ga0268264_100094702 | 161 |
| 449 | 3300028381 | Ga0268264_10012477 | Ga0268264_100124774 | 161 |
| 450 | 3300028381 | Ga0268264_10038853 | Ga0268264_100388531 | 161 |
| 451 | 3300028381 | Ga0268264_10570317 | Ga0268264_105703171 | 161 |
| 452 | 3300028381 | Ga0268264_11102970 | Ga0268264_111029701 | 161 |
| 453 | 3300028794 | Ga0307515_10000261 | Ga0307515_1000026151 | 161 |
| 454 | 3300028794 | Ga0307515_10000341 | Ga0307515_1000034110 | 161 |
| 455 | 3300030521 | Ga0307511_10043258 | Ga0307511_100432582 | 161 |
| 456 | 3300031852 | Ga0307410_10176308 | Ga0307410_101763083 | 161 |
| 457 | 3300032004 | Ga0307414_10028618 | Ga0307414_100286182 | 161 |
| 458 | 3300035085 | Ga0373929_0077533 | Ga0373929_0077533_133_618 | 161 |
| 459 | 3300035170 | Ga0373943_0635816 | Ga0373943_0635816_55_540 | 161 |
| 460 | 3300035241 | Ga0373961_0185911 | Ga0373961_0185911_50_535 | 161 |
| 461 | 3300035410 | Ga0373924_0005029 | Ga0373924_0005029_3743_4228 | 161 |
| 462 | 3300035692 | Ga0373935_0291043 | Ga0373935_0291043_473_958 | 161 |
| 463 | 3300036401 | Ga0373937_0006347 | Ga0373937_0006347_527_1012 | 161 |
| 464 | 3300038443 | Ga0395901_0657873 | Ga0395901_0657873_39_524 | 161 |
| 465 | 3300041406 | Ga0439439_0096742 | Ga0439439_0096742_165_650 | 161 |
| 466 | 3300041410 | Ga0439461_0073576 | Ga0439461_0073576_127_612 | 161 |
| 467 | 3300041453 | Ga0451797_1480866 | Ga0451797_1480866_44_529 | 161 |
| 468 | 3300041486 | Ga0451807_1052453 | Ga0451807_1052453_143_637 | 161 |
| 469 | 3300041509 | Ga0451843_0124940 | Ga0451843_0124940_127_612 | 161 |
| 470 | 3300041512 | Ga0451853_1526035 | Ga0451853_1526035_149_634 | 161 |
| 471 | 3300041512 | Ga0451853_2401845 | Ga0451853_2401845_99_584 | 161 |
| 472 | 3300041997 | Ga0439431_0121515 | Ga0439431_0121515_203_688 | 161 |
| 473 | 3300042002 | Ga0439442_064576 | Ga0439442_064576_200_685 | 161 |
| 474 | 3300042004 | Ga0439445_0001791 | Ga0439445_0001791_3718_4203 | 161 |
| 475 | 3300042014 | Ga0439457_005680 | Ga0439457_005680_2218_2703 | 161 |
| 476 | 3300042015 | Ga0439462_0006414 | Ga0439462_0006414_528_1013 | 161 |
| 477 | 3300042157 | Ga0439458_0081941 | Ga0439458_0081941_150_635 | 161 |
| 478 | 3300044712 | Ga0453684_0071138 | Ga0453684_0071138_3037_3522 | 161 |
| 479 | 3300045051 | Ga0451576_0285613 | Ga0451576_0285613_1002_1487 | 161 |
| 480 | 3300045976 | Ga0466967_0390970 | Ga0466967_0390970_762_1247 | 161 |
| 481 | 3300046454 | Ga0495592_0101286 | Ga0495592_0101286_870_1355 | 161 |
| 482 | 3300046460 | Ga0495638_0447680 | Ga0495638_0447680_98_631 | 161 |
| 483 | 3300046463 | Ga0495653_0075413 | Ga0495653_0075413_1829_2314 | 161 |
| 484 | 3300046511 | Ga0495608_0035877 | Ga0495608_0035877_1841_2326 | 161 |
| 485 | 3300046514 | Ga0495618_0030947 | Ga0495618_0030947_1363_1848 | 161 |
| 486 | 3300046516 | Ga0495628_0342413 | Ga0495628_0342413_89_574 | 161 |
| 487 | 3300046517 | Ga0495630_0062747 | Ga0495630_0062747_456_941 | 161 |
| 488 | 3300046533 | Ga0495640_0213239 | Ga0495640_0213239_665_1150 | 161 |
| 489 | 3300046536 | Ga0495587_0095593 | Ga0495587_0095593_515_1000 | 161 |
| 490 | 3300046642 | Ga0495634_0173686 | Ga0495634_0173686_653_1138 | 161 |
| 491 | 3300046663 | Ga0495635_0253714 | Ga0495635_0253714_532_1017 | 161 |
| 492 | 3300046675 | Ga0495657_0241154 | Ga0495657_0241154_463_948 | 161 |
| 493 | 3300046678 | Ga0495599_0090021 | Ga0495599_0090021_207_692 | 161 |
| 494 | 3300047317 | Ga0495604_0149068 | Ga0495604_0149068_124_609 | 161 |
| 495 | 3300047320 | Ga0495672_0012400 | Ga0495672_0012400_4156_4641 | 161 |
| 496 | 3300047322 | Ga0495680_0110301 | Ga0495680_0110301_792_1277 | 161 |
| 497 | 3300047471 | Ga0495684_0194478 | Ga0495684_0194478_499_984 | 161 |
| 498 | 3300047472 | Ga0495686_0005149 | Ga0495686_0005149_7209_7694 | 161 |
| 499 | 3300047472 | Ga0495686_0359791 | Ga0495686_0359791_122_607 | 161 |
| 500 | 3300048904 | Ga0496101_0240518 | Ga0496101_0240518_595_1116 | 161 |
| 501 | 3300048909 | Ga0496106_0250916 | Ga0496106_0250916_492_977 | 161 |
| 502 | 3300048913 | Ga0496110_0174449 | Ga0496110_0174449_313_801 | 161 |
| 503 | 3300048914 | Ga0496111_0164505 | Ga0496111_0164505_28_513 | 161 |
| 504 | 3300048916 | Ga0496113_1139452 | Ga0496113_1139452_67_555 | 161 |
| 505 | 3300048917 | Ga0496114_0334913 | Ga0496114_0334913_364_933 | 161 |
| 506 | 3300049513 | Ga0501290_017505 | Ga0501290_017505_163_648 | 161 |
| 507 | 3300049523 | Ga0501300_025582 | Ga0501300_025582_165_650 | 161 |
| 508 | 3300049569 | Ga0501032_0030141 | Ga0501032_0030141_2526_3011 | 161 |
| 509 | 3300049571 | Ga0501034_0002546 | Ga0501034_0002546_17700_18185 | 161 |
| 510 | 3300049572 | Ga0501036_0005747 | Ga0501036_0005747_2279_2764 | 161 |
| 511 | 3300049573 | Ga0501037_0134694 | Ga0501037_0134694_504_989 | 161 |
| 512 | 3300049574 | Ga0501038_0040428 | Ga0501038_0040428_3495_3980 | 161 |
| 513 | 3300049579 | Ga0501043_0004799 | Ga0501043_0004799_5443_5928 | 161 |
| 514 | 3300049580 | Ga0501046_0016027 | Ga0501046_0016027_831_1316 | 161 |
| 515 | 3300049581 | Ga0501047_0141683 | Ga0501047_0141683_17_502 | 161 |
| 516 | 3300049582 | Ga0501048_0033984 | Ga0501048_0033984_1148_1633 | 161 |
| 517 | 3300049585 | Ga0501069_0402858 | Ga0501069_0402858_281_766 | 161 |
| 518 | 3300049586 | Ga0501070_0012235 | Ga0501070_0012235_2693_3178 | 161 |
| 519 | 3300049589 | Ga0501073_0002208 | Ga0501073_0002208_7474_7959 | 161 |
| 520 | 3300049590 | Ga0501074_0040824 | Ga0501074_0040824_67_552 | 161 |
| 521 | 3300049742 | Ga0501080_0147041 | Ga0501080_0147041_957_1442 | 161 |
| 522 | 3300049744 | Ga0501083_0035233 | Ga0501083_0035233_267_752 | 161 |
| 523 | 3300049824 | Ga0501045_0201000 | Ga0501045_0201000_943_1428 | 161 |
| 524 | 3300050493 | nmdc:mga0k408_10793_c1 | nmdc:mga0k408_10793_c1_1733_2218 | 161 |
| 525 | 3300050493 | nmdc:mga0k408_151620_c1 | nmdc:mga0k408_151620_c1_90_626 | 161 |
| 526 | 3300050493 | nmdc:mga0k408_341989_c1 | nmdc:mga0k408_341989_c1_156_641 | 161 |
| 527 | 3300050493 | nmdc:mga0k408_590487_c1 | nmdc:mga0k408_590487_c1_43_576 | 161 |
| 528 | 3300050511 | nmdc:mga08y16_21771_c1 | nmdc:mga08y16_21771_c1_3651_4136 | 161 |
| 529 | 3300050512 | nmdc:mga0n895_261412_c1 | nmdc:mga0n895_261412_c1_877_1362 | 161 |
| 530 | 3300053727 | Ga0500611_000050 | Ga0500611_000050_6826_7359 | 161 |
| 531 | 3300054114 | Ga0501084_0146976 | Ga0501084_0146976_1263_1748 | 161 |
| 532 | 3300044712 | Ga0453684_0125470 | Ga0453684_0125470_1917_2405 | 162 |
| 533 | 2162886011 | MRS1b_contig_3060620 | MRS1b_0951.00001060 | 163 |
| 534 | 3300005290 | Ga0065712_10178720 | Ga0065712_101787202 | 163 |
| 535 | 3300005366 | Ga0070659_100213813 | Ga0070659_1002138132 | 163 |
| 536 | 3300005456 | Ga0070678_100864455 | Ga0070678_1008644551 | 163 |
| 537 | 3300005834 | Ga0068851_10677452 | Ga0068851_106774521 | 163 |
| 538 | 3300005844 | Ga0068862_100303002 | Ga0068862_1003030022 | 163 |
| 539 | 3300013308 | Ga0157375_10690609 | Ga0157375_106906092 | 163 |
| 540 | 3300025321 | Ga0207656_10373891 | Ga0207656_103738911 | 163 |
| 541 | 3300026089 | Ga0207648_11294324 | Ga0207648_112943241 | 163 |
| 542 | 3300042876 | Ga0451577_0006025 | Ga0451577_0006025_1203_1703 | 163 |
| 543 | 3300046537 | Ga0495598_0226103 | Ga0495598_0226103_80_595 | 163 |
| 544 | 3300046539 | Ga0495621_0169060 | Ga0495621_0169060_121_636 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d30-assembly1.cif.gz_A | crystal structure of cytidine deaminase cdd-2 (ba4525) from bacillus anthracis at 2.40a resolution | 0.9018 | 25 | 154 |
| 1ux0-assembly1.cif.gz_B-2 | bacillus subtilis cytidine deaminase with an arg56 - gln substitution | 0.8924 | 23 | 159 |
| 1ux1-assembly1.cif.gz_D | bacillus subtilis cytidine deaminase with a cys53his and an arg56gln substitution | 0.8898 | 23 | 160 |
| 1jtk-assembly1.cif.gz_A | crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine | 0.8885 | 23 | 160 |
| 3dmo-assembly1.cif.gz_C | 1.6 a crystal structure of cytidine deaminase from burkholderia pseudomallei | 0.8875 | 25 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PMQ1_5_145_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8659 | 17 | 162 | 3.40.140.10 |
| af_Q4DCG1_17_164_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8658 | 19 | 159 | 3.40.140.10 |
| af_Q2FY04_3_129_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8636 | 28 | 156 | 3.40.140.10 |
| af_A0A0P0WYM0_4_131_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8418 | 25 | 160 | 3.40.140.10 |
| af_F1QSJ0_1_133_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8387 | 25 | 163 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7K8G1-F1-model_v4 | Cytidine deaminase | 0.9694 | 2 | 155 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |
| AF-A0A3Q2XTG9-F1-model_v4 | CMP/dCMP-type deaminase domain-containing protein | 0.9641 | 19 | 146 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
| AF-A0A2D7K8G1-F1-model_v4 | Cytidine deaminase | 0.9632 | 2 | 155 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 |
| AF-A0A4Q0AX19-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) | 0.963 | 2 | 159 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0016020 GO:0042802 |
| AF-A0A1M6MDI4-F1-model_v4 | Cytidine deaminase (EC 3.5.4.5) (Cytidine aminohydrolase) | 0.9622 | 1 | 158 |
GO:0004126
GO:0005829 GO:0008270 GO:0009972 GO:0042802 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar