F461706

General Info

Members Datasets Scaffolds Average Seq Length
544 397 400 350

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10075204|Ga0070681_100752043
Length 406
Sequence MAAVDTRTVTPTEAGLWHHATTRGDQVGIPCVFMRGGTSRGAVLHAADLPDDLELRKRLILGIYGSPDIRQINGLGGADPLTSKVAIVAPSDRPDADVEFTFGQVRLAEADVDFTGNCGNISASIGPFAIDEGLVPAVEPTTLVRIYLTNTGGVITSRVPVRDGLALVDGDAEVPGVPGRGAPITLDFGEGSSVLGRGLLPTGVPREQVETPFGTVDVSIVDAGNPTVFVHPSVFGLQGTELPAALTADLLARMEMVRGAGAERLGLAPSAAEAAHVTPAVPKLYMVSEPADYIDSNGRQVSADEIXVTGRGLSMQVPHKAYAGTVAMCTGVAALVPGTVVADVVRPAAGNHRRLRIGHPSGVMGVEAEVVDRPEGPMVTVAAIERTARRIMDGTVYVSRDRLFGE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
5 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
6 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
7 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
8 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
9 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
10 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
11 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
12 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
13 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
14 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
15 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
16 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
17 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
18 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
19 2643221580 Devosia sp. Root635 Isolate Unclassified
20 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
21 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
22 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
23 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
24 2773857925 Microvirga vignae BR3299 Isolate Unclassified
25 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
26 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
27 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
28 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
29 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
30 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
31 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
32 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
33 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
34 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
35 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
36 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
37 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
38 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
39 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
40 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
41 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
42 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
43 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
44 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
45 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
46 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
47 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
48 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
49 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
50 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
51 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
52 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
53 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
54 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
55 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
56 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
57 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
58 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
59 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
60 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
61 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
62 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
63 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
64 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
65 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
66 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
67 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
68 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
69 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
70 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
71 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
72 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
73 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
74 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
75 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
76 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
77 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
78 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
79 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
80 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
81 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
82 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
83 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
84 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
85 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
86 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
87 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
88 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
89 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
90 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
91 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
92 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
93 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
94 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
95 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
96 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
97 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
98 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
99 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
100 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
101 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
102 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
103 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
104 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
105 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
106 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
107 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
108 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
109 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
110 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
111 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
112 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
113 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
114 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
115 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
116 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
117 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
118 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
119 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
120 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
121 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
122 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
123 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
124 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
125 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
126 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
127 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
128 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
129 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
130 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
131 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
132 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
133 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
134 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
135 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
136 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
137 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
138 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
139 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
140 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
141 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
142 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
143 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
144 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
145 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
146 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
147 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
148 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
149 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
150 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
151 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
152 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
153 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
154 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
157 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
158 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
159 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
160 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
161 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
164 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
169 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
170 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
171 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
172 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
173 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
174 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
175 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
176 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
177 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
178 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
179 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
180 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
181 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
182 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
183 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
184 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
185 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
186 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
187 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
188 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
189 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
190 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
191 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
192 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
193 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
196 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
197 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
200 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
201 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
204 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
205 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
206 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
207 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
208 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
209 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
210 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
211 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
213 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
217 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
218 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
219 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
220 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
221 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
222 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
223 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
224 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
225 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
228 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
229 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
231 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
232 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
266 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
271 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
274 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
275 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
276 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
280 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
281 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
282 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
283 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
287 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
288 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
289 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
304 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
333 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
334 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
335 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
351 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
352 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
353 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
354 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
355 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
356 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
362 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
363 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
364 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
365 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
383 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
386 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
389 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
390 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
391 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
392 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
395 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
396 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
397 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.35
Metatranscriptomes 0.18
Isolates 26.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.99
Nodule 22.61
Rhizoplane 2.02
Rhizosphere 61.76
Stem 0
Stem Tuber 0
Unclassified 6.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_738855 2162886007 Bacteria 2705
2 JGI24736J21556_1002547 3300001904 Bacteria 3216
3 JGI24741J21665_1001432 3300001915 Bacteria 6840
4 JGI24752J21851_1000111 3300001976 Bacteria 11024
5 JGI24740J21852_10003286 3300001979 Bacteria 7129
6 JGI24739J22299_10034812 3300001989 Bacteria 1712
7 JGI24737J22298_10000747 3300001990 Bacteria 11486
8 JGI24735J21928_10004263 3300002067 Bacteria 4823
9 JGI24750J21931_1000118 3300002070 Bacteria 12582
10 JGI24748J21848_1000084 3300002074 Bacteria 28101
11 JGI24749J21850_1000336 3300002076 Bacteria 7089
12 JGI24749J21850_1002962 3300002076 Bacteria 2378
13 JGI24034J26672_10000018 3300002239 Bacteria 130180
14 JGI24034J26672_10000076 3300002239 Bacteria 22026
15 JGI24751J29686_10000254 3300002459 Bacteria 20892
16 JGI25153J46596_10038379 3300003215 Bacteria 1510
17 Ga0055534_1008924 3300003784 Bacteria 2224
18 Ga0055531_10006079 3300003794 Bacteria 6914
19 Ga0065704_10002540 3300005289 Bacteria 5186
20 Ga0065704_10013118 3300005289 Bacteria 2612
21 Ga0065704_10070333 3300005289 Bacteria 31916
22 Ga0065707_10087643 3300005295 Bacteria 4933
23 Ga0070658_10000970 3300005327 Bacteria 24593
24 Ga0070658_10005683 3300005327 Bacteria 10110
25 Ga0070658_10011645 3300005327 Bacteria 7054
26 Ga0070658_10130669 3300005327 Bacteria 2093
27 Ga0070676_10000192 3300005328 Bacteria 25516
28 Ga0070683_100035921 3300005329 Bacteria 4532
29 Ga0070690_100000212 3300005330 Bacteria 30301
30 Ga0070670_100012709 3300005331 Bacteria 7204
31 Ga0070666_10000433 3300005335 Bacteria 25624
32 Ga0070680_100214869 3300005336 Bacteria 1623
33 Ga0070682_100000582 3300005337 Bacteria 22418
34 Ga0070682_100115892 3300005337 Bacteria 1792
35 Ga0070660_100000302 3300005339 Bacteria 32774
36 Ga0070661_100001875 3300005344 Bacteria 14551
37 Ga0070661_100031882 3300005344 Bacteria 3813
38 Ga0070669_100032639 3300005353 Bacteria 3761
39 Ga0070669_100262963 3300005353 Bacteria 1377
40 Ga0070688_100002657 3300005365 Bacteria 9073
41 Ga0070659_100002958 3300005366 Bacteria 12113
42 Ga0070659_100086402 3300005366 Bacteria 2510
43 Ga0070667_100045921 3300005367 Bacteria 3674
44 Ga0070708_100035343 3300005445 Unclassified 4353
45 Ga0070663_100001266 3300005455 Bacteria 13895
46 Ga0070663_100156634 3300005455 Bacteria 1751
47 Ga0070663_100214214 3300005455 Bacteria 1510
48 Ga0070662_100003900 3300005457 Bacteria 9350
49 Ga0070662_100085238 3300005457 Bacteria 2361
50 Ga0070662_100198446 3300005457 Bacteria 1591
51 Ga0070662_100206180 3300005457 Bacteria 1562
52 Ga0070681_10075204 3300005458 Bacteria 3337
53 Ga0070685_10003150 3300005466 Bacteria 8381
54 Ga0070699_100050631 3300005518 Bacteria 3597
55 Ga0070679_100000815 3300005530 Bacteria 27015
56 Ga0070679_100036268 3300005530 Bacteria 4894
57 Ga0070684_100058959 3300005535 Bacteria 3355
58 Ga0070684_100072938 3300005535 Bacteria 3024
59 Ga0070697_100024108 3300005536 Bacteria 4843
60 Ga0068853_100148660 3300005539 Bacteria 2107
61 Ga0070686_100000331 3300005544 Bacteria 30636
62 Ga0070665_100000056 3300005548 Bacteria 242622
63 Ga0070665_100129455 3300005548 Bacteria 2526
64 Ga0068855_100022740 3300005563 Bacteria 7512
65 Ga0068855_100082128 3300005563 Bacteria 3735
66 Ga0070664_100005265 3300005564 Bacteria 10382
67 Ga0068857_100104229 3300005577 Bacteria 2546
68 Ga0068857_100170877 3300005577 Bacteria 1976
69 Ga0068854_100003929 3300005578 Bacteria 9313
70 Ga0068854_100111928 3300005578 Bacteria 2060
71 Ga0068856_100004268 3300005614 Bacteria 14272
72 Ga0068856_100007469 3300005614 Bacteria 10670
73 Ga0068852_100091439 3300005616 Bacteria 2723
74 Ga0068852_100142904 3300005616 Bacteria 2217
75 Ga0068859_100011676 3300005617 Bacteria 8827
76 Ga0068864_100011839 3300005618 Bacteria 7204
77 Ga0068861_100078818 3300005719 Bacteria 2574
78 Ga0068861_100223022 3300005719 Bacteria 1594
79 Ga0068863_100000925 3300005841 Bacteria 29446
80 Ga0068858_100006854 3300005842 Bacteria 11073
81 Ga0068860_100001798 3300005843 Bacteria 22829
82 Ga0068860_100203986 3300005843 Bacteria 1917
83 Ga0068862_100000746 3300005844 Bacteria 32594
84 Ga0068862_100003339 3300005844 Bacteria 13854
85 Ga0075365_10018672 3300006038 Bacteria 4269
86 Ga0075368_10000367 3300006042 Bacteria 13288
87 Ga0075363_100029967 3300006048 Bacteria 2813
88 Ga0075367_10001292 3300006178 Bacteria 10596
89 Ga0075370_10169265 3300006353 Bacteria 1284
90 Ga0075433_10000823 3300006852 Bacteria 21653
91 Ga0075433_10023180 3300006852 Bacteria 5221
92 Ga0075434_100003423 3300006871 Bacteria 14191
93 Ga0075436_100002010 3300006914 Bacteria 14054
94 Ga0097620_100011676 3300006931 Bacteria 8827
95 Ga0079104_1010268 3300006946 Bacteria 3097
96 Ga0075435_100024286 3300007076 Bacteria 4702
97 Ga0105250_10019249 3300009092 Bacteria 2760
98 Ga0111539_10145086 3300009094 Bacteria 2779
99 Ga0111539_10389098 3300009094 Bacteria 1624
100 Ga0105243_10000250 3300009148 Bacteria 61801
101 Ga0105243_10132115 3300009148 Bacteria 2119
102 Ga0105241_10025155 3300009174 Bacteria 4424
103 Ga0105248_10004976 3300009177 Bacteria 14689
104 Ga0105248_10008726 3300009177 Bacteria 11135
105 Ga0105248_10051586 3300009177 Bacteria 4616
106 Ga0105248_10063910 3300009177 Bacteria 4132
107 Ga0105237_10000699 3300009545 Bacteria 46489
108 Ga0105237_10036584 3300009545 Bacteria 4968
109 Ga0105249_10000443 3300009553 Bacteria 38901
110 Ga0105148_100175 3300009978 Bacteria 9497
111 Ga0105246_10016020 3300011119 Bacteria 4742
112 Ga0157373_10002669 3300013100 Bacteria 13529
113 Ga0157373_10031761 3300013100 Bacteria 3801
114 Ga0157373_10034603 3300013100 Bacteria 3628
115 Ga0157373_10041251 3300013100 Bacteria 3301
116 Ga0157371_10002890 3300013102 Bacteria 16065
117 Ga0157370_10001318 3300013104 Bacteria 30920
118 Ga0157369_10004018 3300013105 Bacteria 17437
119 Ga0163162_10026469 3300013306 Bacteria 5731
120 Ga0157372_10000795 3300013307 Bacteria 34249
121 Ga0157372_10275268 3300013307 Bacteria 1957
122 Ga0157375_10241341 3300013308 Bacteria 1967
123 Ga0163163_10140478 3300014325 Bacteria 2457
124 Ga0157380_10056381 3300014326 Bacteria 3124
125 Ga0157380_10302443 3300014326 Bacteria 1474
126 Ga0163161_10000760 3300017792 Bacteria 25345
127 Ga0163161_10023012 3300017792 Bacteria 4391
128 Ga0163161_10026928 3300017792 Bacteria 4076
129 Ga0209147_100302 3300025229 Bacteria 40451
130 Ga0209675_1000248 3300025291 Bacteria 53556
131 Ga0209758_1002135 3300025297 Bacteria 20851
132 Ga0209050_1000299 3300025298 Bacteria 104017
133 Ga0209051_1000544 3300025303 Bacteria 46205
134 Ga0209257_1003871 3300025304 Bacteria 12217
135 Ga0207680_10000009 3300025903 Bacteria 464571
136 Ga0207647_10024442 3300025904 Bacteria 3983
137 Ga0207647_10031473 3300025904 Bacteria 3414
138 Ga0207705_10000778 3300025909 Bacteria 26196
139 Ga0207705_10000816 3300025909 Bacteria 25494
140 Ga0207705_10016736 3300025909 Bacteria 5251
141 Ga0207705_10120573 3300025909 Bacteria 1946
142 Ga0207707_10071606 3300025912 Bacteria 3021
143 Ga0207671_10015875 3300025914 Bacteria 5874
144 Ga0207657_10000204 3300025919 Bacteria 61073
145 Ga0207657_10003773 3300025919 Bacteria 16105
146 Ga0207657_10028075 3300025919 Bacteria 5142
147 Ga0207649_10002992 3300025920 Bacteria 9305
148 Ga0207652_10009267 3300025921 Bacteria 7916
149 Ga0207652_10095825 3300025921 Bacteria 2614
150 Ga0207652_10200459 3300025921 Bacteria 1796
151 Ga0207646_10100009 3300025922 Unclassified 2599
152 Ga0207681_10000258 3300025923 Bacteria 40457
153 Ga0207681_10000789 3300025923 Bacteria 20864
154 Ga0207694_10155820 3300025924 Bacteria 1842
155 Ga0207650_10000008 3300025925 Bacteria 498534
156 Ga0207650_10150658 3300025925 Bacteria 1835
157 Ga0207690_10000429 3300025932 Bacteria 27386
158 Ga0207690_10043271 3300025932 Bacteria 2963
159 Ga0207706_10008807 3300025933 Bacteria 9289
160 Ga0207706_10009592 3300025933 Bacteria 8884
161 Ga0207706_10077630 3300025933 Bacteria 2921
162 Ga0207706_10270626 3300025933 Bacteria 1482
163 Ga0207686_10024098 3300025934 Bacteria 3521
164 Ga0207711_10009661 3300025941 Bacteria 8037
165 Ga0207711_10010035 3300025941 Bacteria 7872
166 Ga0207711_10023321 3300025941 Bacteria 5179
167 Ga0207661_10202985 3300025944 Bacteria 1744
168 Ga0207661_10329389 3300025944 Bacteria 1374
169 Ga0207667_10000862 3300025949 Bacteria 39077
170 Ga0207667_10005990 3300025949 Bacteria 14792
171 Ga0207667_10018145 3300025949 Bacteria 7900
172 Ga0207667_10059691 3300025949 Bacteria 3993
173 Ga0207712_10000046 3300025961 Bacteria 162468
174 Ga0207668_10168285 3300025972 Bacteria 1716
175 Ga0207640_10003223 3300025981 Bacteria 8789
176 Ga0207658_10007736 3300025986 Bacteria 7323
177 Ga0207658_10012083 3300025986 Bacteria 5889
178 Ga0207639_10000549 3300026041 Bacteria 25767
179 Ga0207639_10005034 3300026041 Bacteria 8899
180 Ga0207639_10311177 3300026041 Bacteria 1395
181 Ga0207678_10009859 3300026067 Bacteria 8391
182 Ga0207678_10026565 3300026067 Bacteria 5050
183 Ga0207678_10177348 3300026067 Bacteria 1820
184 Ga0207708_10331663 3300026075 Bacteria 1244
185 Ga0207702_10004107 3300026078 Bacteria 13062
186 Ga0207702_10042759 3300026078 Bacteria 3802
187 Ga0207641_10000063 3300026088 Bacteria 159283
188 Ga0207676_10001060 3300026095 Bacteria 20944
189 Ga0207676_10096655 3300026095 Bacteria 2438
190 Ga0207674_10110916 3300026116 Bacteria 2718
191 Ga0207698_10117007 3300026142 Bacteria 2247
192 Ga0209281_1000647 3300027111 Bacteria 37601
193 Ga0209813_10000040 3300027866 Bacteria 53861
194 Ga0209813_10006995 3300027866 Bacteria 2800
195 Ga0268266_10000066 3300028379 Bacteria 242637
196 Ga0268265_10001237 3300028380 Bacteria 22096
197 Ga0268265_10001366 3300028380 Bacteria 20776
198 Ga0268264_10000130 3300028381 Bacteria 181732
199 Ga0268264_10196747 3300028381 Bacteria 1841
200 Ga0307408_100018448 3300031548 Bacteria 4684
201 Ga0316579_10017064 3300031691 Bacteria 3180
202 Ga0265314_10144104 3300031711 Bacteria 1469
203 Ga0307406_10036683 3300031901 Bacteria 3022
204 Ga0307406_10060361 3300031901 Bacteria 2445
205 Ga0307406_10091267 3300031901 Bacteria 2052
206 Ga0307412_10068320 3300031911 Bacteria 2416
207 Ga0307416_100129016 3300032002 Bacteria 2271
208 Ga0307414_10038196 3300032004 Bacteria 3222
209 Ga0307415_100152327 3300032126 Bacteria 1781
210 Ga0373932_0026502 3300035112 Bacteria 1577
211 Ga0316582_0009912 3300036647 Bacteria 5193
212 Ga0316584_0023791 3300036712 Bacteria 4476
213 Ga0316584_0060957 3300036712 Bacteria 2826
214 Ga0395900_0023139 3300037418 Bacteria 6358
215 Ga0395900_0055333 3300037418 Bacteria 4086
216 Ga0395898_0024439 3300037466 Bacteria 6095
217 Ga0395898_0367799 3300037466 Bacteria 1371
218 Ga0395905_0000335 3300037471 Bacteria 67466
219 Ga0395905_0003607 3300037471 Bacteria 16456
220 Ga0395905_0213063 3300037471 Bacteria 1809
221 Ga0395901_0005124 3300038443 Bacteria 13230
222 Ga0395901_0082984 3300038443 Bacteria 3349
223 Ga0395901_0272687 3300038443 Bacteria 1759
224 Ga0395901_0343287 3300038443 Bacteria 1542
225 Ga0400483_050926 3300039062 Bacteria 28961
226 Ga0400483_129390 3300039062 Bacteria 11830
227 Ga0400483_174473 3300039062 Bacteria 6329
228 Ga0439449_0003930 3300042007 Bacteria 5762
229 Ga0439449_0020191 3300042007 Bacteria 2496
230 Ga0439450_001670 3300042008 Bacteria 3306
231 Ga0439455_0035550 3300042012 Bacteria 1258
232 Ga0439458_0023075 3300042157 Bacteria 1449
233 Ga0451577_0196174 3300042876 Bacteria 1822
234 Ga0453683_0000207 3300044673 Bacteria 79577
235 Ga0453683_0047047 3300044673 Bacteria 2704
236 Ga0466968_0006718 3300044735 Bacteria 4347
237 Ga0466960_0055856 3300044901 Bacteria 1921
238 Ga0451576_0030393 3300045051 Bacteria 5773
239 Ga0451576_0034815 3300045051 Bacteria 5347
240 Ga0451576_0080330 3300045051 Bacteria 3393
241 Ga0466967_0079926 3300045976 Bacteria 2949
242 Ga0495627_000127 3300046453 Bacteria 92757
243 Ga0495627_000162 3300046453 Bacteria 76049
244 Ga0495650_0001253 3300046471 Bacteria 26207
245 Ga0495650_0001847 3300046471 Bacteria 18960
246 Ga0495580_0022029 3300046472 Bacteria 4695
247 Ga0495584_0024270 3300046491 Bacteria 3075
248 Ga0495585_0001465 3300046492 Bacteria 18468
249 Ga0495596_0001157 3300046500 Bacteria 15510
250 Ga0495610_0000041 3300046512 Bacteria 160898
251 Ga0495610_0000059 3300046512 Bacteria 134692
252 Ga0495610_0006974 3300046512 Bacteria 7647
253 Ga0495610_0045134 3300046512 Bacteria 2182
254 Ga0495610_0059745 3300046512 Bacteria 1818
255 Ga0495632_0000332 3300046519 Bacteria 44934
256 Ga0495637_0003726 3300046520 Bacteria 8048
257 Ga0495637_0041157 3300046520 Bacteria 1984
258 Ga0495643_0000004 3300046522 Bacteria 519944
259 Ga0495643_0000088 3300046522 Bacteria 155458
260 Ga0495643_0040049 3300046522 Bacteria 2560
261 Ga0495643_0095592 3300046522 Bacteria 1528
262 Ga0495648_0007834 3300046524 Bacteria 8498
263 Ga0495648_0024461 3300046524 Bacteria 4112
264 Ga0495648_0072641 3300046524 Bacteria 1990
265 Ga0495654_0014283 3300046530 Bacteria 4230
266 Ga0495597_0004966 3300046542 Bacteria 7143
267 Ga0495633_0000670 3300046558 Bacteria 31596
268 Ga0495633_0052411 3300046558 Bacteria 1922
269 Ga0495625_0017725 3300046660 Bacteria 5570
270 Ga0495669_0003062 3300046684 Bacteria 6877
271 Ga0495671_0000048 3300046692 Bacteria 155712
272 Ga0495681_0000022 3300047470 Bacteria 165281
273 Ga0495681_0000045 3300047470 Bacteria 111769
274 Ga0495681_0007055 3300047470 Bacteria 7253
275 Ga0495686_0001997 3300047472 Bacteria 20237
276 Ga0495686_0006128 3300047472 Bacteria 9310
277 Ga0495686_0096261 3300047472 Bacteria 1792
278 Ga0496101_0110261 3300048904 Bacteria 2071
279 Ga0496101_0239749 3300048904 Bacteria 1411
280 Ga0496103_0002993 3300048906 Bacteria 10446
281 Ga0496104_0018688 3300048907 Bacteria 6328
282 Ga0496104_0056417 3300048907 Bacteria 3714
283 Ga0496105_0026649 3300048908 Bacteria 4718
284 Ga0496105_0055269 3300048908 Bacteria 3278
285 Ga0496108_0003387 3300048911 Bacteria 12801
286 Ga0496110_0016807 3300048913 Bacteria 6112
287 Ga0496114_0219917 3300048917 Bacteria 1667
288 Ga0496115_0373907 3300048918 Bacteria 1160
289 Ga0496116_0000060 3300048919 Bacteria 272219
290 Ga0496117_0058804 3300048920 Bacteria 2660
291 Ga0496117_0156740 3300048920 Bacteria 1339
292 Ga0496118_0112790 3300048921 Bacteria 1798
293 Ga0496121_0000226 3300048924 Bacteria 121831
294 Ga0496121_0000670 3300048924 Bacteria 63957
295 Ga0496121_0001672 3300048924 Bacteria 36560
296 Ga0496121_0042391 3300048924 Bacteria 3960
297 Ga0496122_0004853 3300048925 Bacteria 16371
298 Ga0496122_0017562 3300048925 Bacteria 6679
299 Ga0496123_0000457 3300048926 Bacteria 71921
300 Ga0496123_0007175 3300048926 Bacteria 10573
301 Ga0496124_0003896 3300048927 Bacteria 17845
302 Ga0496124_0006882 3300048927 Bacteria 12224
303 Ga0496124_0008630 3300048927 Bacteria 10620
304 Ga0496124_0020435 3300048927 Bacteria 6117
305 Ga0496125_0002945 3300048928 Bacteria 21421
306 Ga0496125_0023519 3300048928 Bacteria 5685
307 Ga0496126_0002255 3300048929 Bacteria 26590
308 Ga0496126_0012613 3300048929 Bacteria 8648
309 Ga0496126_0099165 3300048929 Bacteria 2552
310 Ga0496126_0230961 3300048929 Bacteria 1550
311 Ga0501290_000118 3300049513 Bacteria 11992
312 Ga0501292_000014 3300049515 Bacteria 64546
313 Ga0501294_000170 3300049517 Bacteria 7894
314 Ga0501315_007346 3300049531 Bacteria 1253
315 Ga0501032_0000358 3300049569 Bacteria 38004
316 Ga0501033_0000601 3300049570 Bacteria 33366
317 Ga0501033_0027033 3300049570 Bacteria 4316
318 Ga0501034_0018888 3300049571 Bacteria 7061
319 Ga0501037_0000089 3300049573 Bacteria 85102
320 Ga0501037_0159284 3300049573 Bacteria 1610
321 Ga0501037_0307460 3300049573 Bacteria 1100
322 Ga0501038_0117851 3300049574 Bacteria 2193
323 Ga0501038_0153631 3300049574 Bacteria 1875
324 Ga0501040_0084051 3300049576 Bacteria 2208
325 Ga0501043_0000007 3300049579 Bacteria 224595
326 Ga0501047_0065015 3300049581 Bacteria 3517
327 Ga0501047_0075523 3300049581 Bacteria 3243
328 Ga0501047_0084697 3300049581 Bacteria 3047
329 Ga0501048_0151418 3300049582 Bacteria 1641
330 Ga0501069_0000001 3300049585 Bacteria 289100
331 Ga0501069_0003478 3300049585 Bacteria 8111
332 Ga0501069_0053419 3300049585 Bacteria 2250
333 Ga0501070_0000071 3300049586 Bacteria 86669
334 Ga0501070_0001014 3300049586 Bacteria 25206
335 Ga0501070_0001781 3300049586 Bacteria 19026
336 Ga0501073_0023792 3300049589 Bacteria 4398
337 Ga0501073_0108543 3300049589 Bacteria 1926
338 Ga0501074_0000003 3300049590 Bacteria 116101
339 Ga0501074_0027427 3300049590 Bacteria 4130
340 Ga0501076_0080842 3300049592 Bacteria 2609
341 Ga0501202_001676 3300049652 Bacteria 3587
342 Ga0501222_000177 3300049662 Bacteria 11651
343 Ga0501223_000303 3300049663 Bacteria 12289
344 Ga0501224_000403 3300049664 Bacteria 5152
345 Ga0501227_001744 3300049665 Bacteria 4824
346 Ga0501257_001045 3300049686 Bacteria 5585
347 Ga0501261_000003 3300049690 Bacteria 106942
348 Ga0501225_0015970 3300049705 Bacteria 2086
349 Ga0501245_008551 3300049708 Bacteria 1460
350 Ga0501080_0000470 3300049742 Bacteria 31361
351 Ga0501080_0010814 3300049742 Bacteria 8350
352 Ga0501080_0253254 3300049742 Bacteria 1605
353 Ga0501083_0000080 3300049744 Bacteria 64705
354 Ga0501279_000007 3300049775 Bacteria 141756
355 Ga0501280_000007 3300049776 Bacteria 75585
356 Ga0501281_00199 3300049777 Bacteria 6888
357 Ga0501282_000078 3300049778 Bacteria 11629
358 Ga0501283_000584 3300049779 Bacteria 4798
359 Ga0501035_0000037 3300049822 Bacteria 160921
360 Ga0501035_0001584 3300049822 Bacteria 23082
361 Ga0501035_0021925 3300049822 Bacteria 5868
362 Ga0501044_0000018 3300049823 Bacteria 225885
363 Ga0501044_0007966 3300049823 Bacteria 11640
364 Ga0501044_0118526 3300049823 Bacteria 2650
365 Ga0501044_0141954 3300049823 Bacteria 2390
366 Ga0501044_0200606 3300049823 Bacteria 1953
367 nmdc:mga0yw44_573_c1 3300050492 Bacteria 13295
368 nmdc:mga06z11_132_c1 3300050494 Bacteria 29648
369 nmdc:mga04h51_262_c1 3300050495 Bacteria 13675
370 nmdc:mga07m45_63051_c1 3300050496 Bacteria 2102
371 nmdc:mga08y16_173764_c1 3300050511 Bacteria 2237
372 nmdc:mga08y16_310793_c1 3300050511 Bacteria 1623
373 nmdc:mga0n895_6962_c1 3300050512 Bacteria 9652
374 nmdc:mga0rr50_54245_c1 3300050513 Bacteria 2985
375 nmdc:mga08x19_2055_c1 3300050514 Bacteria 12341
376 nmdc:mga0a205_1054_c1 3300050515 Bacteria 22949
377 nmdc:mga0a205_35238_c1 3300050515 Bacteria 4805
378 Ga0495619_0127979 3300053085 Bacteria 1744
379 Ga0500643_000001 3300053087 Bacteria 1440111
380 Ga0500651_0000843 3300053093 Bacteria 15035
381 Ga0500641_0080725 3300053096 Bacteria 1380
382 Ga0500562_006107 3300053108 Bacteria 3034
383 Ga0500597_000537 3300053120 Bacteria 8142
384 Ga0500618_002660 3300053125 Bacteria 6572
385 Ga0500652_035040 3300053131 Bacteria 1991
386 Ga0500655_000020 3300053133 Bacteria 44643
387 Ga0500590_007681 3300053148 Bacteria 5349
388 Ga0500616_0003880 3300053153 Bacteria 10997
389 Ga0500616_0005100 3300053153 Bacteria 9055
390 Ga0500616_0008406 3300053153 Bacteria 6414
391 Ga0500622_0002559 3300053156 Bacteria 13025
392 Ga0500624_000032 3300053157 Bacteria 104403
393 Ga0500639_006606 3300053163 Bacteria 5991
394 Ga0500637_0000109 3300053178 Bacteria 29639
395 Ga0500570_000051 3300053724 Bacteria 28955
396 Ga0500645_000117 3300053730 Bacteria 63086
397 Ga0501082_0000006 3300060353 Bacteria 127786
398 Ga0501082_0066160 3300060353 Bacteria 3112
399 Ga0501082_0133030 3300060353 Bacteria 2158
400 Ga0501082_0281540 3300060353 Bacteria 1447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027866 Ga0209813_10006995 Ga0209813_100069951 274
2 iso_pu_bacteria 2551306086 2551694806 287
3 3300048929 Ga0496126_0230961 Ga0496126_0230961_23_898 291
4 iso_pu_bacteria 2964712639 2964713612 295
5 iso_pu_bacteria 2937126314 2937131477 296
6 iso_pu_bacteria 2970156795 2970157547 296
7 3300026075 Ga0207708_10331663 Ga0207708_103316632 301
8 3300048921 Ga0496118_0112790 Ga0496118_0112790_864_1775 301
9 3300049581 Ga0501047_0084697 Ga0501047_0084697_2088_3026 310
10 3300049592 Ga0501076_0080842 Ga0501076_0080842_336_1298 311
11 3300060353 Ga0501082_0281540 Ga0501082_0281540_459_1430 311
12 3300038443 Ga0395901_0343287 Ga0395901_0343287_582_1520 312
13 3300046522 Ga0495643_0095592 Ga0495643_0095592_10_948 312
14 3300047472 Ga0495686_0096261 Ga0495686_0096261_12_950 312
15 3300048904 Ga0496101_0110261 Ga0496101_0110261_1085_2029 312
16 3300038443 Ga0395901_0272687 Ga0395901_0272687_26_967 313
17 iso_pu_bacteria 2921289301 2921293613 317
18 3300044673 Ga0453683_0000207 Ga0453683_0000207_48699_49745 319
19 3300036712 Ga0316584_0023791 Ga0316584_0023791_815_1873 325
20 3300060353 Ga0501082_0133030 Ga0501082_0133030_231_1322 327
21 3300042876 Ga0451577_0196174 Ga0451577_0196174_597_1748 330
22 3300005337 Ga0070682_100000582 Ga0070682_1000005823 335
23 3300045976 Ga0466967_0079926 Ga0466967_0079926_1799_2923 337
24 3300046472 Ga0495580_0022029 Ga0495580_0022029_719_1852 337
25 3300039062 Ga0400483_174473 Ga0400483_174473_2733_3758 338
26 3300005366 Ga0070659_100086402 Ga0070659_1000864021 340
27 3300048904 Ga0496101_0239749 Ga0496101_0239749_38_1180 340
28 3300050492 nmdc:mga0yw44_573_c1 nmdc:mga0yw44_573_c1_9908_10933 340
29 3300053085 Ga0495619_0127979 Ga0495619_0127979_133_1275 340
30 3300053153 Ga0500616_0008406 Ga0500616_0008406_1251_2384 340
31 iso_pu_bacteria 2643221605 2644041064 340
32 iso_pu_bacteria 2808606401 2809064125 340
33 iso_pu_bacteria 2808606404 2809080093 340
34 iso_pu_bacteria 2808606405 2809084554 340
35 3300005518 Ga0070699_100050631 Ga0070699_1000506313 341
36 3300049690 Ga0501261_000003 Ga0501261_000003_32729_33754 341
37 3300053120 Ga0500597_000537 Ga0500597_000537_3592_4617 341
38 3300053157 Ga0500624_000032 Ga0500624_000032_31486_32511 341
39 3300053178 Ga0500637_0000109 Ga0500637_0000109_6874_7899 341
40 3300005327 Ga0070658_10005683 Ga0070658_1000568310 342
41 3300005329 Ga0070683_100035921 Ga0070683_1000359214 342
42 3300005336 Ga0070680_100214869 Ga0070680_1002148692 342
43 3300005339 Ga0070660_100000302 Ga0070660_10000030219 342
44 3300005344 Ga0070661_100001875 Ga0070661_10000187511 342
45 3300005366 Ga0070659_100002958 Ga0070659_10000295811 342
46 3300005457 Ga0070662_100003900 Ga0070662_1000039009 342
47 3300005457 Ga0070662_100198446 Ga0070662_1001984462 342
48 3300005530 Ga0070679_100000815 Ga0070679_10000081514 342
49 3300005535 Ga0070684_100058959 Ga0070684_1000589592 342
50 3300005535 Ga0070684_100072938 Ga0070684_1000729382 342
51 3300005563 Ga0068855_100022740 Ga0068855_1000227407 342
52 3300005564 Ga0070664_100005265 Ga0070664_10000526510 342
53 3300005577 Ga0068857_100104229 Ga0068857_1001042292 342
54 3300005578 Ga0068854_100003929 Ga0068854_1000039294 342
55 3300005614 Ga0068856_100007469 Ga0068856_1000074692 342
56 3300005616 Ga0068852_100142904 Ga0068852_1001429042 342
57 3300011119 Ga0105246_10016020 Ga0105246_100160204 342
58 3300013100 Ga0157373_10002669 Ga0157373_1000266913 342
59 3300013100 Ga0157373_10031761 Ga0157373_100317614 342
60 3300013102 Ga0157371_10002890 Ga0157371_100028904 342
61 3300013104 Ga0157370_10001318 Ga0157370_1000131823 342
62 3300013105 Ga0157369_10004018 Ga0157369_100040184 342
63 3300013307 Ga0157372_10000795 Ga0157372_1000079524 342
64 3300013308 Ga0157375_10241341 Ga0157375_102413412 342
65 3300025919 Ga0207657_10000204 Ga0207657_1000020449 342
66 3300025920 Ga0207649_10002992 Ga0207649_100029926 342
67 3300025921 Ga0207652_10009267 Ga0207652_100092679 342
68 3300025932 Ga0207690_10000429 Ga0207690_100004299 342
69 3300025933 Ga0207706_10008807 Ga0207706_100088079 342
70 3300025933 Ga0207706_10009592 Ga0207706_1000959211 342
71 3300025941 Ga0207711_10023321 Ga0207711_100233213 342
72 3300025944 Ga0207661_10329389 Ga0207661_103293892 342
73 3300025949 Ga0207667_10000862 Ga0207667_1000086222 342
74 3300025949 Ga0207667_10018145 Ga0207667_100181455 342
75 3300025981 Ga0207640_10003223 Ga0207640_100032233 342
76 3300026041 Ga0207639_10000549 Ga0207639_1000054916 342
77 3300026078 Ga0207702_10042759 Ga0207702_100427592 342
78 3300026116 Ga0207674_10110916 Ga0207674_101109162 342
79 3300026142 Ga0207698_10117007 Ga0207698_101170072 342
80 3300036712 Ga0316584_0060957 Ga0316584_0060957_129_1163 342
81 3300042008 Ga0439450_001670 Ga0439450_001670_1371_2426 342
82 3300046512 Ga0495610_0000041 Ga0495610_0000041_28366_29394 342
83 3300046512 Ga0495610_0045134 Ga0495610_0045134_1121_2149 342
84 3300046512 Ga0495610_0059745 Ga0495610_0059745_463_1491 342
85 3300046520 Ga0495637_0041157 Ga0495637_0041157_155_1183 342
86 3300046522 Ga0495643_0040049 Ga0495643_0040049_1038_2072 342
87 3300047470 Ga0495681_0000022 Ga0495681_0000022_26671_27699 342
88 3300047472 Ga0495686_0006128 Ga0495686_0006128_6851_7879 342
89 3300048917 Ga0496114_0219917 Ga0496114_0219917_141_1175 342
90 3300049573 Ga0501037_0159284 Ga0501037_0159284_430_1464 342
91 3300049573 Ga0501037_0307460 Ga0501037_0307460_12_1046 342
92 3300049823 Ga0501044_0118526 Ga0501044_0118526_1282_2316 342
93 3300053125 Ga0500618_002660 Ga0500618_002660_23_1051 342
94 3300053153 Ga0500616_0003880 Ga0500616_0003880_93_1121 342
95 3300003784 Ga0055534_1008924 Ga0055534_10089242 343
96 3300025291 Ga0209675_1000248 Ga0209675_100024810 343
97 3300025934 Ga0207686_10024098 Ga0207686_100240983 343
98 3300045051 Ga0451576_0080330 Ga0451576_0080330_958_2145 343
99 iso_pu_bacteria 3000405567 3000405857 343
100 3300001904 JGI24736J21556_1002547 JGI24736J21556_10025473 344
101 3300001915 JGI24741J21665_1001432 JGI24741J21665_10014324 344
102 3300001979 JGI24740J21852_10003286 JGI24740J21852_100032863 344
103 3300001989 JGI24739J22299_10034812 JGI24739J22299_100348122 344
104 3300001990 JGI24737J22298_10000747 JGI24737J22298_100007473 344
105 3300002067 JGI24735J21928_10004263 JGI24735J21928_100042633 344
106 3300002076 JGI24749J21850_1000336 JGI24749J21850_10003367 344
107 3300002076 JGI24749J21850_1002962 JGI24749J21850_10029622 344
108 3300005289 Ga0065704_10013118 Ga0065704_100131183 344
109 3300005295 Ga0065707_10087643 Ga0065707_100876434 344
110 3300005327 Ga0070658_10000970 Ga0070658_1000097027 344
111 3300005327 Ga0070658_10011645 Ga0070658_100116458 344
112 3300005327 Ga0070658_10130669 Ga0070658_101306691 344
113 3300005331 Ga0070670_100012709 Ga0070670_1000127097 344
114 3300005353 Ga0070669_100032639 Ga0070669_1000326394 344
115 3300005353 Ga0070669_100262963 Ga0070669_1002629631 344
116 3300005367 Ga0070667_100045921 Ga0070667_1000459212 344
117 3300005455 Ga0070663_100001266 Ga0070663_10000126614 344
118 3300005539 Ga0068853_100148660 Ga0068853_1001486602 344
119 3300005614 Ga0068856_100004268 Ga0068856_10000426812 344
120 3300005616 Ga0068852_100091439 Ga0068852_1000914393 344
121 3300009092 Ga0105250_10019249 Ga0105250_100192493 344
122 3300009094 Ga0111539_10389098 Ga0111539_103890982 344
123 3300009148 Ga0105243_10132115 Ga0105243_101321153 344
124 3300009177 Ga0105248_10004976 Ga0105248_100049763 344
125 3300009177 Ga0105248_10051586 Ga0105248_100515864 344
126 3300009177 Ga0105248_10063910 Ga0105248_100639103 344
127 3300009545 Ga0105237_10036584 Ga0105237_100365844 344
128 3300009978 Ga0105148_100175 Ga0105148_1001756 344
129 3300013100 Ga0157373_10034603 Ga0157373_100346034 344
130 3300013306 Ga0163162_10026469 Ga0163162_100264696 344
131 3300013307 Ga0157372_10275268 Ga0157372_102752682 344
132 3300014325 Ga0163163_10140478 Ga0163163_101404781 344
133 3300014326 Ga0157380_10056381 Ga0157380_100563813 344
134 3300014326 Ga0157380_10302443 Ga0157380_103024431 344
135 3300025909 Ga0207705_10120573 Ga0207705_101205732 344
136 3300025919 Ga0207657_10003773 Ga0207657_1000377317 344
137 3300025933 Ga0207706_10270626 Ga0207706_102706262 344
138 3300025949 Ga0207667_10059691 Ga0207667_100596912 344
139 3300026041 Ga0207639_10005034 Ga0207639_100050344 344
140 3300026067 Ga0207678_10009859 Ga0207678_100098595 344
141 3300026078 Ga0207702_10004107 Ga0207702_100041074 344
142 3300031901 Ga0307406_10091267 Ga0307406_100912672 344
143 3300035112 Ga0373932_0026502 Ga0373932_0026502_140_1174 344
144 3300036647 Ga0316582_0009912 Ga0316582_0009912_2285_3325 344
145 3300037418 Ga0395900_0023139 Ga0395900_0023139_2229_3263 344
146 3300037418 Ga0395900_0055333 Ga0395900_0055333_837_1871 344
147 3300037466 Ga0395898_0024439 Ga0395898_0024439_1445_2479 344
148 3300037471 Ga0395905_0000335 Ga0395905_0000335_34308_35342 344
149 3300037471 Ga0395905_0003607 Ga0395905_0003607_2318_3352 344
150 3300037471 Ga0395905_0213063 Ga0395905_0213063_233_1267 344
151 3300038443 Ga0395901_0005124 Ga0395901_0005124_2430_3464 344
152 3300038443 Ga0395901_0082984 Ga0395901_0082984_678_1712 344
153 3300039062 Ga0400483_050926 Ga0400483_050926_15791_16828 344
154 3300042007 Ga0439449_0020191 Ga0439449_0020191_1315_2349 344
155 3300042012 Ga0439455_0035550 Ga0439455_0035550_75_1109 344
156 3300042157 Ga0439458_0023075 Ga0439458_0023075_351_1385 344
157 3300044735 Ga0466968_0006718 Ga0466968_0006718_2891_3925 344
158 3300046453 Ga0495627_000127 Ga0495627_000127_18133_19167 344
159 3300046491 Ga0495584_0024270 Ga0495584_0024270_935_1969 344
160 3300046500 Ga0495596_0001157 Ga0495596_0001157_11535_12569 344
161 3300046512 Ga0495610_0000059 Ga0495610_0000059_21699_22733 344
162 3300046512 Ga0495610_0006974 Ga0495610_0006974_2128_3162 344
163 3300046520 Ga0495637_0003726 Ga0495637_0003726_6098_7132 344
164 3300046522 Ga0495643_0000004 Ga0495643_0000004_270703_271737 344
165 3300046522 Ga0495643_0000088 Ga0495643_0000088_18890_19924 344
166 3300046524 Ga0495648_0007834 Ga0495648_0007834_1673_2707 344
167 3300046524 Ga0495648_0024461 Ga0495648_0024461_1369_2403 344
168 3300046524 Ga0495648_0072641 Ga0495648_0072641_875_1909 344
169 3300046542 Ga0495597_0004966 Ga0495597_0004966_2434_3468 344
170 3300046558 Ga0495633_0000670 Ga0495633_0000670_11598_12632 344
171 3300046558 Ga0495633_0052411 Ga0495633_0052411_482_1516 344
172 3300046660 Ga0495625_0017725 Ga0495625_0017725_317_1351 344
173 3300046684 Ga0495669_0003062 Ga0495669_0003062_1273_2307 344
174 3300046692 Ga0495671_0000048 Ga0495671_0000048_19017_20051 344
175 3300047470 Ga0495681_0007055 Ga0495681_0007055_2804_3838 344
176 3300048906 Ga0496103_0002993 Ga0496103_0002993_8028_9068 344
177 3300048907 Ga0496104_0018688 Ga0496104_0018688_1254_2294 344
178 3300048907 Ga0496104_0056417 Ga0496104_0056417_83_1123 344
179 3300048908 Ga0496105_0026649 Ga0496105_0026649_3371_4411 344
180 3300048908 Ga0496105_0055269 Ga0496105_0055269_111_1151 344
181 3300048913 Ga0496110_0016807 Ga0496110_0016807_2480_3514 344
182 3300048918 Ga0496115_0373907 Ga0496115_0373907_56_1090 344
183 3300048920 Ga0496117_0156740 Ga0496117_0156740_140_1180 344
184 3300048925 Ga0496122_0017562 Ga0496122_0017562_301_1335 344
185 3300048926 Ga0496123_0007175 Ga0496123_0007175_1486_2520 344
186 3300048927 Ga0496124_0003896 Ga0496124_0003896_3150_4184 344
187 3300048928 Ga0496125_0002945 Ga0496125_0002945_15643_16677 344
188 3300048929 Ga0496126_0099165 Ga0496126_0099165_291_1325 344
189 3300049513 Ga0501290_000118 Ga0501290_000118_9901_10935 344
190 3300049515 Ga0501292_000014 Ga0501292_000014_95_1129 344
191 3300049517 Ga0501294_000170 Ga0501294_000170_5166_6200 344
192 3300049531 Ga0501315_007346 Ga0501315_007346_149_1183 344
193 3300049570 Ga0501033_0027033 Ga0501033_0027033_752_1789 344
194 3300049574 Ga0501038_0153631 Ga0501038_0153631_739_1773 344
195 3300049585 Ga0501069_0053419 Ga0501069_0053419_1055_2092 344
196 3300049586 Ga0501070_0001014 Ga0501070_0001014_16379_17416 344
197 3300049652 Ga0501202_001676 Ga0501202_001676_2138_3172 344
198 3300049662 Ga0501222_000177 Ga0501222_000177_6118_7152 344
199 3300049663 Ga0501223_000303 Ga0501223_000303_1575_2609 344
200 3300049664 Ga0501224_000403 Ga0501224_000403_3125_4159 344
201 3300049665 Ga0501227_001744 Ga0501227_001744_261_1295 344
202 3300049686 Ga0501257_001045 Ga0501257_001045_516_1550 344
203 3300049705 Ga0501225_0015970 Ga0501225_0015970_995_2029 344
204 3300049708 Ga0501245_008551 Ga0501245_008551_63_1097 344
205 3300049742 Ga0501080_0010814 Ga0501080_0010814_4475_5512 344
206 3300049775 Ga0501279_000007 Ga0501279_000007_59057_60091 344
207 3300049776 Ga0501280_000007 Ga0501280_000007_3602_4636 344
208 3300049777 Ga0501281_00199 Ga0501281_00199_2216_3250 344
209 3300049778 Ga0501282_000078 Ga0501282_000078_10207_11241 344
210 3300049779 Ga0501283_000584 Ga0501283_000584_2705_3739 344
211 3300049822 Ga0501035_0001584 Ga0501035_0001584_11959_12996 344
212 3300049823 Ga0501044_0200606 Ga0501044_0200606_566_1603 344
213 3300050494 nmdc:mga06z11_132_c1 nmdc:mga06z11_132_c1_9487_10521 344
214 3300050495 nmdc:mga04h51_262_c1 nmdc:mga04h51_262_c1_9487_10521 344
215 3300050496 nmdc:mga07m45_63051_c1 nmdc:mga07m45_63051_c1_943_1977 344
216 3300050511 nmdc:mga08y16_310793_c1 nmdc:mga08y16_310793_c1_517_1560 344
217 3300053093 Ga0500651_0000843 Ga0500651_0000843_3720_4754 344
218 3300053096 Ga0500641_0080725 Ga0500641_0080725_233_1273 344
219 3300053108 Ga0500562_006107 Ga0500562_006107_1984_3018 344
220 3300053133 Ga0500655_000020 Ga0500655_000020_12974_14008 344
221 3300053148 Ga0500590_007681 Ga0500590_007681_3316_4350 344
222 3300053156 Ga0500622_0002559 Ga0500622_0002559_11411_12445 344
223 3300053163 Ga0500639_006606 Ga0500639_006606_2901_3935 344
224 3300053724 Ga0500570_000051 Ga0500570_000051_7676_8710 344
225 3300005445 Ga0070708_100035343 Ga0070708_1000353433 346
226 3300005536 Ga0070697_100024108 Ga0070697_1000241082 346
227 3300006852 Ga0075433_10000823 Ga0075433_1000082319 346
228 3300006852 Ga0075433_10023180 Ga0075433_100231804 346
229 3300006871 Ga0075434_100003423 Ga0075434_1000034232 346
230 3300006914 Ga0075436_100002010 Ga0075436_10000201010 346
231 3300007076 Ga0075435_100024286 Ga0075435_1000242862 346
232 3300025922 Ga0207646_10100009 Ga0207646_101000092 346
233 3300050512 nmdc:mga0n895_6962_c1 nmdc:mga0n895_6962_c1_466_1599 346
234 3300050513 nmdc:mga0rr50_54245_c1 nmdc:mga0rr50_54245_c1_1060_2193 346
235 3300050514 nmdc:mga08x19_2055_c1 nmdc:mga08x19_2055_c1_7742_8875 346
236 3300050515 nmdc:mga0a205_1054_c1 nmdc:mga0a205_1054_c1_10854_11987 346
237 3300050515 nmdc:mga0a205_35238_c1 nmdc:mga0a205_35238_c1_2199_3332 346
238 3300053131 Ga0500652_035040 Ga0500652_035040_555_1682 346
239 3300053730 Ga0500645_000117 Ga0500645_000117_51588_52715 346
240 iso_pu_bacteria 2510917026 2511174808 346
241 iso_pu_bacteria 2585427634 2586002470 346
242 iso_pu_bacteria 2773857925 2774873516 346
243 iso_pu_bacteria 2882456835 2882458544 346
244 iso_pu_bacteria 2896253425 2896253895 346
245 iso_pu_bacteria 2919171160 2919175683 346
246 iso_pu_bacteria 3000865235 3000867510 346
247 iso_pu_bacteria 2643221580 2643911082 347
248 iso_pu_bacteria 2747842501 2748017723 347
249 iso_pu_bacteria 2880518877 2880523055 347
250 iso_pu_bacteria 2889914905 2889915596 347
251 3300005337 Ga0070682_100115892 Ga0070682_1001158921 348
252 3300005344 Ga0070661_100031882 Ga0070661_1000318821 348
253 3300005455 Ga0070663_100156634 Ga0070663_1001566341 348
254 3300005455 Ga0070663_100214214 Ga0070663_1002142142 348
255 3300005457 Ga0070662_100085238 Ga0070662_1000852382 348
256 3300009094 Ga0111539_10145086 Ga0111539_101450862 348
257 3300025909 Ga0207705_10000778 Ga0207705_1000077819 348
258 3300025909 Ga0207705_10016736 Ga0207705_100167363 348
259 3300025919 Ga0207657_10028075 Ga0207657_100280753 348
260 3300025932 Ga0207690_10043271 Ga0207690_100432711 348
261 3300025933 Ga0207706_10077630 Ga0207706_100776303 348
262 3300026067 Ga0207678_10026565 Ga0207678_100265654 348
263 3300026067 Ga0207678_10177348 Ga0207678_101773481 348
264 3300044901 Ga0466960_0055856 Ga0466960_0055856_180_1400 348
265 3300049581 Ga0501047_0075523 Ga0501047_0075523_1279_2346 348
266 3300050511 nmdc:mga08y16_173764_c1 nmdc:mga08y16_173764_c1_535_1746 348
267 iso_pu_bacteria 2511231052 2511501736 348
268 iso_pu_bacteria 2513237086 2513585303 348
269 iso_pu_bacteria 2513237091 2513619707 348
270 iso_pu_bacteria 2513237140 2513883715 348
271 iso_pu_bacteria 2513237143 2513905419 348
272 iso_pu_bacteria 2515154107 2515608607 348
273 iso_pu_bacteria 2516653046 2516893036 348
274 iso_pu_bacteria 2551306084 2551677785 348
275 iso_pu_bacteria 2551306085 2551686320 348
276 iso_pu_bacteria 2551306089 2551709472 348
277 iso_pu_bacteria 2551306090 2551717138 348
278 iso_pu_bacteria 2551306091 2551730458 348
279 iso_pu_bacteria 2551306092 2551738172 348
280 iso_pu_bacteria 2551306093 2551743023 348
281 iso_pu_bacteria 2643221588 2643951737 348
282 iso_pu_bacteria 2643221689 2644501158 348
283 iso_pu_bacteria 2855825444 2855825832 348
284 iso_pu_bacteria 2858800743 2858801831 348
285 iso_pu_bacteria 2896184354 2896186548 348
286 iso_pu_bacteria 2915986958 2915988026 348
287 iso_pu_bacteria 2916000859 2916001852 348
288 iso_pu_bacteria 2916007675 2916009640 348
289 iso_pu_bacteria 2916014648 2916018015 348
290 iso_pu_bacteria 2916021584 2916027384 348
291 iso_pu_bacteria 2916028427 2916035005 348
292 iso_pu_bacteria 2916035215 2916038054 348
293 iso_pu_bacteria 2916055098 2916055420 348
294 iso_pu_bacteria 2916068649 2916068843 348
295 iso_pu_bacteria 2921237296 2921240274 348
296 iso_pu_bacteria 2921244191 2921247222 348
297 iso_pu_bacteria 2921257292 2921262030 348
298 iso_pu_bacteria 2921263974 2921267552 348
299 iso_pu_bacteria 2921282425 2921289279 348
300 iso_pu_bacteria 2921296804 2921297183 348
301 iso_pu_bacteria 2924144063 2924146386 348
302 iso_pu_bacteria 2924150972 2924154646 348
303 iso_pu_bacteria 2924165586 2924168772 348
304 iso_pu_bacteria 2924172951 2924177424 348
305 iso_pu_bacteria 2924179722 2924180026 348
306 iso_pu_bacteria 2924186466 2924189722 348
307 iso_pu_bacteria 2924200457 2924205727 348
308 iso_pu_bacteria 2924207177 2924211321 348
309 iso_pu_bacteria 2924214083 2924217399 348
310 iso_pu_bacteria 2924221636 2924226215 348
311 iso_pu_bacteria 2924228884 2924232300 348
312 iso_pu_bacteria 2936996657 2937002610 348
313 iso_pu_bacteria 2937002841 2937006083 348
314 iso_pu_bacteria 2937009748 2937010176 348
315 iso_pu_bacteria 2937016420 2937022921 348
316 iso_pu_bacteria 2937023124 2937025870 348
317 iso_pu_bacteria 2937042894 2937044978 348
318 iso_pu_bacteria 2937056579 2937057184 348
319 iso_pu_bacteria 2937063883 2937066375 348
320 iso_pu_bacteria 2937071275 2937073664 348
321 iso_pu_bacteria 2937113482 2937116311 348
322 iso_pu_bacteria 2937119839 2937120354 348
323 iso_pu_bacteria 2957382221 2957387411 348
324 iso_pu_bacteria 2957395598 2957399216 348
325 iso_pu_bacteria 2957402308 2957403262 348
326 iso_pu_bacteria 2957415311 2957419504 348
327 iso_pu_bacteria 2957422303 2957425314 348
328 iso_pu_bacteria 2957430029 2957434817 348
329 iso_pu_bacteria 2957450854 2957456913 348
330 iso_pu_bacteria 2957457609 2957462711 348
331 iso_pu_bacteria 2957464669 2957467850 348
332 iso_pu_bacteria 2957471148 2957477350 348
333 iso_pu_bacteria 2957478035 2957481530 348
334 iso_pu_bacteria 2957484790 2957485989 348
335 iso_pu_bacteria 2957491536 2957496061 348
336 iso_pu_bacteria 2957498199 2957499127 348
337 iso_pu_bacteria 2957505466 2957509382 348
338 iso_pu_bacteria 2960584000 2960584668 348
339 iso_pu_bacteria 2960597568 2960598139 348
340 iso_pu_bacteria 2960603979 2960610683 348
341 iso_pu_bacteria 2960637947 2960642169 348
342 iso_pu_bacteria 2960645483 2960651991 348
343 iso_pu_bacteria 2960667422 2960672817 348
344 iso_pu_bacteria 2964607997 2964612289 348
345 iso_pu_bacteria 2964615318 2964620275 348
346 iso_pu_bacteria 2964621998 2964628740 348
347 iso_pu_bacteria 2964628898 2964632293 348
348 iso_pu_bacteria 2964636051 2964638987 348
349 iso_pu_bacteria 2964643177 2964646779 348
350 iso_pu_bacteria 2964663802 2964669791 348
351 iso_pu_bacteria 2964670856 2964674012 348
352 iso_pu_bacteria 2964685014 2964685935 348
353 iso_pu_bacteria 2964691889 2964695416 348
354 iso_pu_bacteria 2964705432 2964711483 348
355 iso_pu_bacteria 2964719344 2964720470 348
356 iso_pu_bacteria 2967671571 2967675305 348
357 iso_pu_bacteria 2967699805 2967702719 348
358 iso_pu_bacteria 2967742019 2967745120 348
359 iso_pu_bacteria 2967748971 2967753847 348
360 iso_pu_bacteria 2967755722 2967757182 348
361 iso_pu_bacteria 2967769361 2967771454 348
362 iso_pu_bacteria 2967775926 2967781143 348
363 iso_pu_bacteria 2970033650 2970038648 348
364 iso_pu_bacteria 2970047711 2970052340 348
365 iso_pu_bacteria 2970054988 2970058205 348
366 iso_pu_bacteria 2970061556 2970068525 348
367 iso_pu_bacteria 2970068827 2970073698 348
368 iso_pu_bacteria 2970076120 2970078480 348
369 iso_pu_bacteria 2970082768 2970087299 348
370 iso_pu_bacteria 2970088815 2970092532 348
371 iso_pu_bacteria 2970095765 2970099703 348
372 iso_pu_bacteria 2970102677 2970105163 348
373 iso_pu_bacteria 2970109326 2970110454 348
374 iso_pu_bacteria 2970136068 2970140313 348
375 iso_pu_bacteria 2970149975 2970150393 348
376 iso_pu_bacteria 2970164137 2970166495 348
377 iso_pu_bacteria 2970170962 2970172354 348
378 iso_pu_bacteria 2970191845 2970192779 348
379 iso_pu_bacteria 2977523885 2977527936 348
380 iso_pu_bacteria 2977537788 2977542673 348
381 iso_pu_bacteria 2977558990 2977562209 348
382 iso_pu_bacteria 2977565890 2977569515 348
383 iso_pu_bacteria 2977572785 2977574983 348
384 iso_pu_bacteria 2989349275 2989352234 348
385 iso_pu_bacteria 2989771324 2989776156 348
386 iso_pu_bacteria 648276728 648737406 348
387 iso_pu_bacteria 8003992118 8003993687 348
388 3300003215 JGI25153J46596_10038379 JGI25153J46596_100383792 349
389 3300003794 Ga0055531_10006079 Ga0055531_100060796 349
390 3300006038 Ga0075365_10018672 Ga0075365_100186724 349
391 3300025297 Ga0209758_1002135 Ga0209758_100213521 349
392 3300025303 Ga0209051_1000544 Ga0209051_100054423 349
393 3300025304 Ga0209257_1003871 Ga0209257_10038717 349
394 3300025921 Ga0207652_10095825 Ga0207652_100958253 349
395 3300039062 Ga0400483_129390 Ga0400483_129390_1157_2245 349
396 3300049571 Ga0501034_0018888 Ga0501034_0018888_1646_2698 349
397 3300049576 Ga0501040_0084051 Ga0501040_0084051_842_2044 349
398 3300049581 Ga0501047_0065015 Ga0501047_0065015_1200_2258 349
399 3300060353 Ga0501082_0066160 Ga0501082_0066160_967_2025 349
400 3300005457 Ga0070662_100206180 Ga0070662_1002061802 350
401 3300005458 Ga0070681_10075204 Ga0070681_100752043 350
402 3300005530 Ga0070679_100036268 Ga0070679_1000362681 350
403 3300005563 Ga0068855_100082128 Ga0068855_1000821284 350
404 3300006042 Ga0075368_10000367 Ga0075368_100003678 350
405 3300006048 Ga0075363_100029967 Ga0075363_1000299672 350
406 3300006178 Ga0075367_10001292 Ga0075367_1000129211 350
407 3300006353 Ga0075370_10169265 Ga0075370_101692651 350
408 3300013100 Ga0157373_10041251 Ga0157373_100412513 350
409 3300025912 Ga0207707_10071606 Ga0207707_100716063 350
410 3300025921 Ga0207652_10200459 Ga0207652_102004591 350
411 3300025944 Ga0207661_10202985 Ga0207661_102029852 350
412 3300025949 Ga0207667_10005990 Ga0207667_1000599011 350
413 3300026041 Ga0207639_10311177 Ga0207639_103111772 350
414 3300027866 Ga0209813_10000040 Ga0209813_1000004041 350
415 3300031548 Ga0307408_100018448 Ga0307408_1000184485 350
416 3300031901 Ga0307406_10036683 Ga0307406_100366834 350
417 3300031911 Ga0307412_10068320 Ga0307412_100683202 350
418 3300032002 Ga0307416_100129016 Ga0307416_1001290163 350
419 3300032126 Ga0307415_100152327 Ga0307415_1001523273 350
420 3300037466 Ga0395898_0367799 Ga0395898_0367799_185_1240 350
421 3300044673 Ga0453683_0047047 Ga0453683_0047047_1054_2208 350
422 3300045051 Ga0451576_0030393 Ga0451576_0030393_1420_2574 350
423 3300045051 Ga0451576_0034815 Ga0451576_0034815_3724_4878 350
424 3300047472 Ga0495686_0001997 Ga0495686_0001997_90_1142 350
425 3300048927 Ga0496124_0008630 Ga0496124_0008630_3332_4384 350
426 3300053087 Ga0500643_000001 Ga0500643_000001_227853_228911 350
427 3300053153 Ga0500616_0005100 Ga0500616_0005100_4768_5826 350
428 3300005328 Ga0070676_10000192 Ga0070676_1000019220 351
429 3300005578 Ga0068854_100111928 Ga0068854_1001119282 351
430 3300006946 Ga0079104_1010268 Ga0079104_10102682 351
431 3300009177 Ga0105248_10008726 Ga0105248_100087266 351
432 3300009545 Ga0105237_10000699 Ga0105237_1000069922 351
433 3300025904 Ga0207647_10031473 Ga0207647_100314733 351
434 3300025914 Ga0207671_10015875 Ga0207671_100158752 351
435 3300027111 Ga0209281_1000647 Ga0209281_100064734 351
436 3300031691 Ga0316579_10017064 Ga0316579_100170641 351
437 3300031901 Ga0307406_10060361 Ga0307406_100603613 351
438 3300032004 Ga0307414_10038196 Ga0307414_100381963 351
439 3300042007 Ga0439449_0003930 Ga0439449_0003930_783_1841 351
440 3300048924 Ga0496121_0000226 Ga0496121_0000226_3688_4743 351
441 3300049569 Ga0501032_0000358 Ga0501032_0000358_19019_20113 351
442 3300049570 Ga0501033_0000601 Ga0501033_0000601_16314_17408 351
443 3300049573 Ga0501037_0000089 Ga0501037_0000089_1292_2386 351
444 3300049579 Ga0501043_0000007 Ga0501043_0000007_208876_209970 351
445 3300049585 Ga0501069_0000001 Ga0501069_0000001_185216_186310 351
446 3300049586 Ga0501070_0000071 Ga0501070_0000071_27016_28110 351
447 3300049589 Ga0501073_0023792 Ga0501073_0023792_764_1858 351
448 3300049590 Ga0501074_0000003 Ga0501074_0000003_83742_84836 351
449 3300049742 Ga0501080_0000470 Ga0501080_0000470_12918_14012 351
450 3300049744 Ga0501083_0000080 Ga0501083_0000080_33246_34340 351
451 3300049822 Ga0501035_0000037 Ga0501035_0000037_113120_114214 351
452 3300049823 Ga0501044_0000018 Ga0501044_0000018_110979_112073 351
453 3300060353 Ga0501082_0000006 Ga0501082_0000006_38030_39217 352
454 iso_pu_bacteria 8002745576 8002748676 352
455 2162886007 SwRhRL2b_contig_738855 SwRhRL2b_0888.00003090 353
456 3300001976 JGI24752J21851_1000111 JGI24752J21851_10001118 353
457 3300002070 JGI24750J21931_1000118 JGI24750J21931_100011810 353
458 3300002074 JGI24748J21848_1000084 JGI24748J21848_100008422 353
459 3300002239 JGI24034J26672_10000018 JGI24034J26672_10000018134 353
460 3300002239 JGI24034J26672_10000076 JGI24034J26672_100000768 353
461 3300002459 JGI24751J29686_10000254 JGI24751J29686_100002544 353
462 3300005289 Ga0065704_10002540 Ga0065704_100025406 353
463 3300005289 Ga0065704_10070333 Ga0065704_1007033324 353
464 3300005330 Ga0070690_100000212 Ga0070690_10000021234 353
465 3300005335 Ga0070666_10000433 Ga0070666_100004337 353
466 3300005365 Ga0070688_100002657 Ga0070688_1000026573 353
467 3300005466 Ga0070685_10003150 Ga0070685_100031508 353
468 3300005544 Ga0070686_100000331 Ga0070686_1000003318 353
469 3300005548 Ga0070665_100000056 Ga0070665_10000005653 353
470 3300005548 Ga0070665_100129455 Ga0070665_1001294552 353
471 3300005577 Ga0068857_100170877 Ga0068857_1001708772 353
472 3300005617 Ga0068859_100011676 Ga0068859_1000116762 353
473 3300005618 Ga0068864_100011839 Ga0068864_1000118397 353
474 3300005719 Ga0068861_100078818 Ga0068861_1000788182 353
475 3300005719 Ga0068861_100223022 Ga0068861_1002230222 353
476 3300005841 Ga0068863_100000925 Ga0068863_10000092531 353
477 3300005842 Ga0068858_100006854 Ga0068858_1000068545 353
478 3300005843 Ga0068860_100001798 Ga0068860_10000179825 353
479 3300005843 Ga0068860_100203986 Ga0068860_1002039862 353
480 3300005844 Ga0068862_100000746 Ga0068862_10000074643 353
481 3300005844 Ga0068862_100003339 Ga0068862_1000033394 353
482 3300006931 Ga0097620_100011676 Ga0097620_1000116762 353
483 3300009148 Ga0105243_10000250 Ga0105243_1000025010 353
484 3300009174 Ga0105241_10025155 Ga0105241_100251553 353
485 3300009553 Ga0105249_10000443 Ga0105249_1000044319 353
486 3300017792 Ga0163161_10000760 Ga0163161_100007603 353
487 3300017792 Ga0163161_10023012 Ga0163161_100230123 353
488 3300017792 Ga0163161_10026928 Ga0163161_100269283 353
489 3300025229 Ga0209147_100302 Ga0209147_10030221 353
490 3300025298 Ga0209050_1000299 Ga0209050_100029980 353
491 3300025903 Ga0207680_10000009 Ga0207680_10000009455 353
492 3300025904 Ga0207647_10024442 Ga0207647_100244422 353
493 3300025909 Ga0207705_10000816 Ga0207705_100008164 353
494 3300025923 Ga0207681_10000258 Ga0207681_100002585 353
495 3300025923 Ga0207681_10000789 Ga0207681_100007893 353
496 3300025924 Ga0207694_10155820 Ga0207694_101558202 353
497 3300025925 Ga0207650_10000008 Ga0207650_10000008398 353
498 3300025925 Ga0207650_10150658 Ga0207650_101506582 353
499 3300025941 Ga0207711_10009661 Ga0207711_100096615 353
500 3300025941 Ga0207711_10010035 Ga0207711_100100353 353
501 3300025961 Ga0207712_10000046 Ga0207712_10000046143 353
502 3300025972 Ga0207668_10168285 Ga0207668_101682852 353
503 3300025986 Ga0207658_10007736 Ga0207658_100077368 353
504 3300025986 Ga0207658_10012083 Ga0207658_100120833 353
505 3300026088 Ga0207641_10000063 Ga0207641_1000006330 353
506 3300026095 Ga0207676_10001060 Ga0207676_100010603 353
507 3300026095 Ga0207676_10096655 Ga0207676_100966552 353
508 3300028379 Ga0268266_10000066 Ga0268266_10000066200 353
509 3300028380 Ga0268265_10001237 Ga0268265_1000123721 353
510 3300028380 Ga0268265_10001366 Ga0268265_100013663 353
511 3300028381 Ga0268264_10000130 Ga0268264_10000130162 353
512 3300028381 Ga0268264_10196747 Ga0268264_101967472 353
513 3300031711 Ga0265314_10144104 Ga0265314_101441041 353
514 3300046453 Ga0495627_000162 Ga0495627_000162_53118_54182 353
515 3300046471 Ga0495650_0001253 Ga0495650_0001253_4685_5752 353
516 3300046471 Ga0495650_0001847 Ga0495650_0001847_12963_14027 353
517 3300046492 Ga0495585_0001465 Ga0495585_0001465_9486_10580 353
518 3300046519 Ga0495632_0000332 Ga0495632_0000332_3348_4412 353
519 3300046530 Ga0495654_0014283 Ga0495654_0014283_261_1325 353
520 3300047470 Ga0495681_0000045 Ga0495681_0000045_53108_54172 353
521 3300048911 Ga0496108_0003387 Ga0496108_0003387_10754_11815 353
522 3300048919 Ga0496116_0000060 Ga0496116_0000060_103466_104539 353
523 3300048920 Ga0496117_0058804 Ga0496117_0058804_173_1246 353
524 3300048924 Ga0496121_0000670 Ga0496121_0000670_2605_3666 353
525 3300048924 Ga0496121_0001672 Ga0496121_0001672_2559_3632 353
526 3300048924 Ga0496121_0042391 Ga0496121_0042391_1416_2480 353
527 3300048925 Ga0496122_0004853 Ga0496122_0004853_13662_14735 353
528 3300048926 Ga0496123_0000457 Ga0496123_0000457_4848_5921 353
529 3300048927 Ga0496124_0006882 Ga0496124_0006882_6387_7460 353
530 3300048927 Ga0496124_0020435 Ga0496124_0020435_2675_3748 353
531 3300048928 Ga0496125_0023519 Ga0496125_0023519_1379_2452 353
532 3300048929 Ga0496126_0002255 Ga0496126_0002255_10687_11760 353
533 3300048929 Ga0496126_0012613 Ga0496126_0012613_2632_3693 353
534 3300049574 Ga0501038_0117851 Ga0501038_0117851_937_2004 353
535 3300049582 Ga0501048_0151418 Ga0501048_0151418_56_1123 353
536 3300049585 Ga0501069_0003478 Ga0501069_0003478_2606_3673 353
537 3300049586 Ga0501070_0001781 Ga0501070_0001781_4017_5084 353
538 3300049589 Ga0501073_0108543 Ga0501073_0108543_803_1870 353
539 3300049590 Ga0501074_0027427 Ga0501074_0027427_514_1581 353
540 3300049742 Ga0501080_0253254 Ga0501080_0253254_271_1338 353
541 3300049822 Ga0501035_0021925 Ga0501035_0021925_3696_4763 353
542 3300049823 Ga0501044_0007966 Ga0501044_0007966_7108_8175 353
543 3300049823 Ga0501044_0141954 Ga0501044_0141954_1145_2218 353
544 iso_pu_bacteria 2818991438 2819552014 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04303

PrpF

PrpF protein

26

399

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g7k-assembly3.cif.gz_C crystal structure of methylitaconate-delta-isomerase 0.8434 6 352
3g7k-assembly1.cif.gz_B crystal structure of methylitaconate-delta-isomerase 0.8045 6 352
3g7k-assembly3.cif.gz_C crystal structure of methylitaconate-delta-isomerase 0.8014 6 352
3g7k-assembly1.cif.gz_B crystal structure of methylitaconate-delta-isomerase 0.7906 6 352
6otv-assembly1.cif.gz_A crystal structure of putative isomerase ec2056 0.7696 5 352
ID Description Score Start End Superfamily
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9377 182 330 3.10.310.10
3g7kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9202 6 168 3.10.310.10
2pvzA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9149 6 168 3.10.310.10
3g7kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9144 177 333 3.10.310.10
af_P0AAV8_179_330_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.89 182 330 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A377XGZ1-F1-model_v4 FldA protein 0.9984 185 289 GO:0016853
AF-A0A3T1DSD4-F1-model_v4 deleted 0.9954 64 166
AF-K9NK90-F1-model_v4 deleted 0.9919 199 273
AF-A0A2M8Q6N3-F1-model_v4 4-oxalomesaconate tautomerase 0.9854 179 297 GO:0016853
AF-A0A441XJS6-F1-model_v4 4-oxalomesaconate tautomerase 0.9853 174 252 GO:0016853

Feature Viewer

pLDDT pTM Quality
92.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map