F461662

General Info

Members Datasets Scaffolds Average Seq Length
543 360 1086 263

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0285003|Ga0495645_0285003_92_1015
Length 307
Sequence LASTVRIVTVRAWATGGAIKPGGRGDAGXXXXGIMGGVTDSPQPPVHWSYLMDMDGVLVHEEHLIPGADAFIAELTAHRANFVVVTNNPIYTRRDLRARLLSSGLDIPEDRIWTSALATAKFLDSQRPGGSAFVIGEVGLTTAMHEAGYVLTDRDPDYVVLGDTRTYSFETITTAIRLIEAGAKFVATNPDATGPSRAGSLPAAGAVAALIEKATGRTPYFVGKPNPLMMRSALRAIGAHSESTLMIGDRMDTDVIAGMEAGLATILVLTGISSLATVEQYPYRPSLVIDSVADLIGRTADPFATGE

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
163 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
266 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
272 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
273 2547132424 Nocardia nova SH22a Isolate Unclassified
274 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
275 2582580736 Prauserella sp. Am3 Isolate Unclassified
276 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
277 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
278 2643221566 Microbacterium sp. Root166 Isolate Unclassified
279 2643221575 Microbacterium sp. Root61 Isolate Unclassified
280 2643221649 Leifsonia sp. Root4 Isolate Unclassified
281 2643221692 Nocardia sp. Root136 Isolate Unclassified
282 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
283 2738541293 Rhizobium sp. GV031 Isolate Unclassified
284 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
285 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
286 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
287 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
288 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
289 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
290 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
291 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
292 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
293 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
294 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
295 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
296 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
297 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
298 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
299 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
300 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
301 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
302 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
303 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
304 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
305 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
306 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
307 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
308 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
309 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
310 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
311 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
312 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
313 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
314 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
315 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
316 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
317 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
318 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
319 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
320 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
321 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
322 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
323 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
324 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
325 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
326 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
327 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
328 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
329 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
330 2919069694 Microbacterium sp. 1154 Isolate Unclassified
331 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
332 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
333 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
334 2922554459 Rhodococcus sp. 66b Isolate Unclassified
335 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
336 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
337 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
338 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
339 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
340 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
341 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
342 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
343 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
344 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
345 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
346 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
347 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
348 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
349 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
350 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
351 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
352 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
353 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
354 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
355 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
356 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
357 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
358 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
359 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
360 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.87
Metatranscriptomes 0.55
Isolates 16.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.74
Bulb 0
Endosphere 8.1
Nodule 0
Rhizoplane 10.5
Rhizosphere 59.67
Stem 0
Stem Tuber 0.18
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0285003 3300046543 Bacteria 1085
2 JGI25406J46586_10001705 3300003203 Bacteria 10340
3 Ga0006562J51391_1035822 3300003578 Bacteria 35489
4 Ga0006562J51391_1035823 3300003578 Bacteria 23870
5 Ga0055527_1000025 3300003760 Bacteria 195817
6 Ga0055542_1000048 3300003762 Bacteria 195800
7 Ga0055529_1000057 3300003763 Bacteria 195807
8 Ga0065714_10105198 3300005288 Bacteria 1570
9 Ga0065714_10174392 3300005288 Bacteria 989
10 Ga0068869_100072338 3300005334 Bacteria 2554
11 Ga0070682_100196331 3300005337 Bacteria 1421
12 Ga0070682_100299385 3300005337 Bacteria 1180
13 Ga0068868_100214995 3300005338 Bacteria 1608
14 Ga0070660_100122243 3300005339 Bacteria 2078
15 Ga0070687_100335508 3300005343 Bacteria 971
16 Ga0070668_100003012 3300005347 Bacteria 12454
17 Ga0070675_100314777 3300005354 Bacteria 1382
18 Ga0070671_100011017 3300005355 Bacteria 7256
19 Ga0070659_100054658 3300005366 Bacteria 3145
20 Ga0070667_100028279 3300005367 Bacteria 4667
21 Ga0070714_100318616 3300005435 Bacteria 1454
22 Ga0070713_100020924 3300005436 Bacteria 5023
23 Ga0070710_10003125 3300005437 Bacteria 7843
24 Ga0070711_100012215 3300005439 Bacteria 5360
25 Ga0070700_100087614 3300005441 Bacteria 2024
26 Ga0070663_100030530 3300005455 Bacteria 3694
27 Ga0070662_100041184 3300005457 Bacteria 3294
28 Ga0070685_10012936 3300005466 Bacteria 4394
29 Ga0070665_100015335 3300005548 Bacteria 7695
30 Ga0070665_100061927 3300005548 Bacteria 3752
31 Ga0070665_100066664 3300005548 Bacteria 3611
32 Ga0068855_100008064 3300005563 Bacteria 12727
33 Ga0070664_100094123 3300005564 Bacteria 2598
34 Ga0068857_100001313 3300005577 Bacteria 19546
35 Ga0068856_100057039 3300005614 Bacteria 3855
36 Ga0068856_100078448 3300005614 Bacteria 3274
37 Ga0068856_100086452 3300005614 Bacteria 3115
38 Ga0068856_100322716 3300005614 Bacteria 1561
39 Ga0068852_100048847 3300005616 Bacteria 3617
40 Ga0068859_100187186 3300005617 Bacteria 2154
41 Ga0068864_100096812 3300005618 Bacteria 2612
42 Ga0068864_100252715 3300005618 Bacteria 1637
43 Ga0068861_100199756 3300005719 Bacteria 1677
44 Ga0068851_10000030 3300005834 Bacteria 114502
45 Ga0068863_100000739 3300005841 Bacteria 32639
46 Ga0068863_100078686 3300005841 Bacteria 3123
47 Ga0068858_100000519 3300005842 Bacteria 40469
48 Ga0068860_100464607 3300005843 Bacteria 1260
49 Ga0081455_10000037 3300005937 Bacteria 136059
50 Ga0081539_10000027 3300005985 Bacteria 328691
51 Ga0081539_10020904 3300005985 Bacteria 4397
52 Ga0081539_10028326 3300005985 Bacteria 3525
53 Ga0075365_10002952 3300006038 Bacteria 8598
54 Ga0075365_10003092 3300006038 Bacteria 8457
55 Ga0075368_10025252 3300006042 Bacteria 2279
56 Ga0075363_100043833 3300006048 Bacteria 2368
57 Ga0075364_10004083 3300006051 Bacteria 8377
58 Ga0075364_10010518 3300006051 Bacteria 5592
59 Ga0075364_10045154 3300006051 Bacteria 2867
60 Ga0075364_10169576 3300006051 Bacteria 1475
61 Ga0075364_10178344 3300006051 Bacteria 1437
62 Ga0075367_10002632 3300006178 Bacteria 8253
63 Ga0075369_10018684 3300006186 Bacteria 2825
64 Ga0068865_100484107 3300006881 Bacteria 1029
65 Ga0097620_100187203 3300006931 Bacteria 2154
66 Ga0105240_10004010 3300009093 Bacteria 22684
67 Ga0105240_10230528 3300009093 Bacteria 2152
68 Ga0105240_10525075 3300009093 Bacteria 1313
69 Ga0111539_10276000 3300009094 Bacteria 1956
70 Ga0105245_10065180 3300009098 Bacteria 3294
71 Ga0105245_10104885 3300009098 Bacteria 2621
72 Ga0105247_10161198 3300009101 Bacteria 1485
73 Ga0105243_10003119 3300009148 Bacteria 13622
74 Ga0105243_10192633 3300009148 Bacteria 1782
75 Ga0105243_10439704 3300009148 Bacteria 1221
76 Ga0105241_10001584 3300009174 Bacteria 17411
77 Ga0105241_10392059 3300009174 Bacteria 1216
78 Ga0105242_10088339 3300009176 Bacteria 2604
79 Ga0105237_10000724 3300009545 Bacteria 45653
80 Ga0105238_10009308 3300009551 Bacteria 9835
81 Ga0105238_10761109 3300009551 Bacteria 983
82 Ga0105249_10111029 3300009553 Bacteria 2592
83 Ga0105239_10053909 3300010375 Bacteria 4410
84 Ga0105239_10254116 3300010375 Bacteria 1974
85 Ga0105239_10268518 3300010375 Bacteria 1918
86 Ga0157369_10000554 3300013105 Bacteria 49088
87 Ga0157369_10415232 3300013105 Bacteria 1395
88 Ga0157369_10451408 3300013105 Bacteria 1331
89 Ga0163162_10239554 3300013306 Bacteria 1945
90 Ga0163162_10848102 3300013306 Bacteria 1029
91 Ga0157372_10199223 3300013307 Bacteria 2319
92 Ga0157372_10424698 3300013307 Bacteria 1549
93 Ga0157372_10466051 3300013307 Bacteria 1473
94 Ga0157375_10114190 3300013308 Bacteria 2802
95 Ga0157375_10364587 3300013308 Bacteria 1611
96 Ga0163163_10191894 3300014325 Bacteria 2091
97 Ga0157380_10691731 3300014326 Bacteria 1023
98 Ga0157377_10256194 3300014745 Bacteria 1136
99 Ga0157379_10021886 3300014968 Bacteria 5664
100 Ga0157379_10397847 3300014968 Bacteria 1266
101 Ga0157376_10536399 3300014969 Bacteria 1156
102 Ga0157376_10868692 3300014969 Bacteria 918
103 Ga0163161_10054786 3300017792 Bacteria 2895
104 Ga0213874_10000090 3300021377 Bacteria 14202
105 Ga0213876_10056051 3300021384 Bacteria 2080
106 Ga0209672_100011 3300025228 Bacteria 856297
107 Ga0209147_101653 3300025229 Bacteria 7342
108 Ga0209258_102977 3300025242 Bacteria 3927
109 Ga0209148_1000023 3300025254 Bacteria 680511
110 Ga0209148_1004511 3300025254 Bacteria 3410
111 Ga0209148_1010221 3300025254 Bacteria 1790
112 Ga0209455_1000023 3300025272 Bacteria 680449
113 Ga0207656_10000001 3300025321 Bacteria 1323684
114 Ga0207656_10184626 3300025321 Bacteria 1002
115 Ga0207655_1007736 3300025728 Bacteria 6932
116 Ga0207692_10001325 3300025898 Bacteria 9218
117 Ga0207688_10049120 3300025901 Bacteria 2357
118 Ga0207647_10024556 3300025904 Bacteria 3974
119 Ga0207647_10049809 3300025904 Bacteria 2597
120 Ga0207643_10120934 3300025908 Bacteria 1551
121 Ga0207705_10061787 3300025909 Bacteria 2706
122 Ga0207705_10127854 3300025909 Bacteria 1889
123 Ga0207705_10156139 3300025909 Bacteria 1712
124 Ga0207654_10000001 3300025911 Bacteria 1816198
125 Ga0207695_10001789 3300025913 Bacteria 33914
126 Ga0207671_10000001 3300025914 Bacteria 1318881
127 Ga0207671_10044045 3300025914 Bacteria 3300
128 Ga0207693_10006897 3300025915 Bacteria 9380
129 Ga0207663_10489372 3300025916 Bacteria 954
130 Ga0207662_10195156 3300025918 Bacteria 1308
131 Ga0207657_10001206 3300025919 Bacteria 27523
132 Ga0207657_10063354 3300025919 Bacteria 3162
133 Ga0207657_10105689 3300025919 Bacteria 2330
134 Ga0207694_10001525 3300025924 Bacteria 19735
135 Ga0207687_10044653 3300025927 Bacteria 3059
136 Ga0207687_10263371 3300025927 Bacteria 1375
137 Ga0207700_10084558 3300025928 Bacteria 2487
138 Ga0207700_10453562 3300025928 Bacteria 1130
139 Ga0207644_10020826 3300025931 Bacteria 4461
140 Ga0207706_10051164 3300025933 Bacteria 3649
141 Ga0207686_10058727 3300025934 Bacteria 2426
142 Ga0207709_10010700 3300025935 Bacteria 5053
143 Ga0207709_10286919 3300025935 Bacteria 1218
144 Ga0207669_10423865 3300025937 Bacteria 1048
145 Ga0207704_10506001 3300025938 Bacteria 974
146 Ga0207689_10027217 3300025942 Bacteria 4787
147 Ga0207661_10155720 3300025944 Bacteria 1979
148 Ga0207667_10000732 3300025949 Bacteria 42642
149 Ga0207667_10005506 3300025949 Bacteria 15439
150 Ga0207667_10066757 3300025949 Bacteria 3749
151 Ga0207668_10018452 3300025972 Bacteria 4390
152 Ga0207640_10087636 3300025981 Bacteria 2146
153 Ga0207677_10245588 3300026023 Bacteria 1451
154 Ga0207703_10002134 3300026035 Bacteria 17404
155 Ga0207703_10447938 3300026035 Bacteria 1205
156 Ga0207678_10006266 3300026067 Bacteria 10565
157 Ga0207678_10009802 3300026067 Bacteria 8423
158 Ga0207708_10115249 3300026075 Bacteria 2090
159 Ga0207702_10057841 3300026078 Bacteria 3297
160 Ga0207702_10085273 3300026078 Bacteria 2752
161 Ga0207702_10242841 3300026078 Bacteria 1688
162 Ga0207641_10005872 3300026088 Bacteria 10418
163 Ga0207641_10063455 3300026088 Bacteria 3156
164 Ga0207641_10644447 3300026088 Bacteria 1040
165 Ga0207648_10475463 3300026089 Bacteria 1141
166 Ga0207676_10037601 3300026095 Bacteria 3690
167 Ga0207674_10004415 3300026116 Bacteria 16928
168 Ga0207674_10102126 3300026116 Bacteria 2848
169 Ga0207675_100037191 3300026118 Bacteria 4541
170 Ga0207683_10061236 3300026121 Bacteria 3312
171 Ga0207683_10386864 3300026121 Bacteria 1286
172 Ga0207698_10000112 3300026142 Bacteria 50642
173 Ga0207698_10004807 3300026142 Bacteria 8273
174 Ga0207698_10204064 3300026142 Bacteria 1773
175 Ga0207698_10476975 3300026142 Bacteria 1209
176 Ga0209813_10012088 3300027866 Bacteria 2272
177 Ga0268266_10012250 3300028379 Bacteria 7419
178 Ga0268266_10067189 3300028379 Bacteria 3103
179 Ga0268266_10171139 3300028379 Bacteria 1971
180 Ga0268265_10584825 3300028380 Bacteria 1065
181 Ga0268264_10565289 3300028381 Bacteria 1117
182 Ga0265319_1017244 3300028563 Bacteria 2749
183 Ga0265318_10016972 3300028577 Bacteria 2997
184 Ga0307515_10118916 3300028794 Bacteria 3011
185 Ga0307515_10142771 3300028794 Bacteria 2557
186 Ga0265338_10102272 3300028800 Bacteria 2330
187 Ga0307512_10004905 3300030522 Bacteria 14292
188 Ga0316176_1000700 3300030732 Bacteria 1813
189 Ga0265330_10198196 3300031235 Bacteria 849
190 Ga0265320_10010243 3300031240 Bacteria 5594
191 Ga0265325_10121044 3300031241 Bacteria 1262
192 Ga0265327_10002610 3300031251 Bacteria 18627
193 Ga0307513_10012416 3300031456 Bacteria 10516
194 Ga0307513_10338436 3300031456 Bacteria 1256
195 Ga0307509_10132009 3300031507 Bacteria 2451
196 Ga0265313_10030992 3300031595 Bacteria 2746
197 Ga0265314_10021241 3300031711 Bacteria 4996
198 Ga0307405_10200365 3300031731 Bacteria 1449
199 Ga0307413_10149615 3300031824 Bacteria 1625
200 Ga0307413_10346092 3300031824 Bacteria 1145
201 Ga0307518_10001607 3300031838 Bacteria 16671
202 Ga0307406_10000040 3300031901 Bacteria 76020
203 Ga0307407_10180374 3300031903 Bacteria 1399
204 Ga0307412_10177827 3300031911 Bacteria 1597
205 Ga0307409_100068981 3300031995 Bacteria 2799
206 Ga0307409_100202251 3300031995 Bacteria 1778
207 Ga0307416_100034930 3300032002 Bacteria 3833
208 Ga0307416_100390181 3300032002 Bacteria 1426
209 Ga0307411_10008663 3300032005 Bacteria 5288
210 Ga0307415_100224457 3300032126 Bacteria 1508
211 Ga0307507_10012015 3300033179 Bacteria 10794
212 Ga0307507_10023368 3300033179 Bacteria 6787
213 Ga0307507_10035716 3300033179 Bacteria 5098
214 Ga0307507_10065405 3300033179 Bacteria 3344
215 Ga0373923_0057490 3300035111 Bacteria 1645
216 Ga0373953_0014981 3300035117 Bacteria 2799
217 Ga0373957_0088465 3300035120 Bacteria 1229
218 Ga0373955_0216040 3300035172 Bacteria 1144
219 Ga0373937_0014823 3300036401 Bacteria 6884
220 Ga0395899_0013314 3300037312 Bacteria 6292
221 Ga0395900_0016459 3300037418 Bacteria 7540
222 Ga0395900_0083972 3300037418 Bacteria 3272
223 Ga0395898_0041027 3300037466 Bacteria 4573
224 Ga0395898_0073864 3300037466 Bacteria 3294
225 Ga0395898_0148152 3300037466 Bacteria 2246
226 Ga0395898_0229042 3300037466 Bacteria 1772
227 Ga0395898_0622044 3300037466 Bacteria 1022
228 Ga0395905_0272624 3300037471 Bacteria 1578
229 Ga0395905_0535660 3300037471 Bacteria 1072
230 Ga0436364_0533791 3300037853 Bacteria 7941
231 Ga0395901_0096901 3300038443 Bacteria 3091
232 Ga0395901_0103196 3300038443 Bacteria 2992
233 Ga0395901_0111627 3300038443 Bacteria 2871
234 Ga0395901_0210150 3300038443 Bacteria 2037
235 Ga0436365_0152968 3300039437 Bacteria 3484
236 Ga0436360_0860482 3300039438 Bacteria 3235
237 Ga0439465_0001624 3300041413 Bacteria 7321
238 Ga0451789_1066840 3300041443 Bacteria 2920
239 Ga0451793_0187004 3300041452 Bacteria 11346
240 Ga0451797_0546112 3300041453 Bacteria 4695
241 Ga0451837_0744169 3300041494 Bacteria 3061
242 Ga0451843_0740794 3300041509 Bacteria 1225
243 Ga0439449_0007085 3300042007 Bacteria 4268
244 Ga0450902_017168 3300042137 Bacteria 1181
245 Ga0439459_0008779 3300042438 Bacteria 1735
246 Ga0451577_0036216 3300042876 Bacteria 4443
247 Ga0466969_0013155 3300044656 Bacteria 4360
248 Ga0466972_0000436 3300044658 Bacteria 21584
249 Ga0466972_0002299 3300044658 Bacteria 9397
250 Ga0466972_0020094 3300044658 Bacteria 3339
251 Ga0466965_0005730 3300044683 Bacteria 5605
252 Ga0466965_0007426 3300044683 Bacteria 5031
253 Ga0466961_0124077 3300044693 Bacteria 1621
254 Ga0466963_0167145 3300044694 Bacteria 1532
255 Ga0466963_0410330 3300044694 Bacteria 955
256 Ga0453684_0000047 3300044712 Bacteria 560243
257 Ga0453684_0028698 3300044712 Bacteria 7927
258 Ga0453684_0040845 3300044712 Bacteria 6289
259 Ga0466968_0027424 3300044735 Bacteria 2344
260 Ga0466970_0031298 3300044765 Bacteria 2810
261 Ga0466970_0053751 3300044765 Bacteria 2151
262 Ga0466970_0240618 3300044765 Bacteria 1013
263 Ga0466957_0437584 3300044842 Bacteria 899
264 Ga0466960_0000980 3300044901 Bacteria 10154
265 Ga0466960_0005461 3300044901 Bacteria 5038
266 Ga0466960_0007239 3300044901 Bacteria 4494
267 Ga0466959_0037385 3300045049 Bacteria 3587
268 Ga0466959_0037638 3300045049 Bacteria 3575
269 Ga0466958_0050385 3300045836 Bacteria 2521
270 Ga0466967_0483324 3300045976 Bacteria 1214
271 Ga0495592_0027356 3300046454 Bacteria 4325
272 Ga0495603_0004436 3300046455 Bacteria 8365
273 Ga0495603_0061098 3300046455 Bacteria 2226
274 Ga0495603_0173114 3300046455 Bacteria 1250
275 Ga0495603_0184224 3300046455 Bacteria 1208
276 Ga0495629_0001173 3300046459 Bacteria 20675
277 Ga0495641_0020966 3300046461 Bacteria 3299
278 Ga0495651_0002913 3300046462 Bacteria 13247
279 Ga0495653_0072792 3300046463 Bacteria 2565
280 Ga0495650_0000055 3300046471 Bacteria 308438
281 Ga0495582_0235831 3300046473 Bacteria 1048
282 Ga0495607_0015436 3300046501 Bacteria 4951
283 Ga0495608_0020121 3300046511 Bacteria 4588
284 Ga0495608_0400369 3300046511 Bacteria 840
285 Ga0495616_0065164 3300046513 Bacteria 1776
286 Ga0495618_0015795 3300046514 Bacteria 4609
287 Ga0495620_0051258 3300046515 Bacteria 1757
288 Ga0495628_0024621 3300046516 Bacteria 4924
289 Ga0495630_0055879 3300046517 Bacteria 2958
290 Ga0495666_0119204 3300046526 Bacteria 1237
291 Ga0495652_0015512 3300046529 Bacteria 6820
292 Ga0495665_0227995 3300046531 Bacteria 962
293 Ga0495640_0026222 3300046533 Bacteria 4214
294 Ga0495640_0309712 3300046533 Bacteria 979
295 Ga0495587_0104812 3300046536 Bacteria 1627
296 Ga0495667_0000218 3300046559 Bacteria 37859
297 Ga0495667_0043724 3300046559 Bacteria 2968
298 Ga0495668_0001192 3300046616 Bacteria 26402
299 Ga0495634_0161432 3300046642 Bacteria 1413
300 Ga0495635_0050751 3300046663 Bacteria 2859
301 Ga0495657_0009906 3300046675 Bacteria 7190
302 Ga0495599_0087161 3300046678 Bacteria 1949
303 Ga0495623_0021331 3300046679 Bacteria 4184
304 Ga0495646_0001401 3300046680 Bacteria 14334
305 Ga0495646_0180736 3300046680 Bacteria 1158
306 Ga0495613_0000886 3300046689 Bacteria 23052
307 Ga0495613_0143433 3300046689 Bacteria 1705
308 Ga0495600_0025572 3300046809 Bacteria 3805
309 Ga0495600_0124193 3300046809 Bacteria 1679
310 Ga0495604_0018620 3300047317 Bacteria 5563
311 Ga0495674_0048883 3300047319 Bacteria 3740
312 Ga0495674_0111396 3300047319 Bacteria 2320
313 Ga0495676_0025857 3300047321 Bacteria 5060
314 Ga0495680_0023107 3300047322 Bacteria 5173
315 Ga0495683_0000485 3300047323 Bacteria 30792
316 Ga0495684_0013488 3300047471 Bacteria 6287
317 Ga0495602_0029365 3300048088 Bacteria 5237
318 Ga0495614_0000362 3300048089 Bacteria 18201
319 Ga0496101_0088341 3300048904 Bacteria 2302
320 Ga0496101_0424149 3300048904 Bacteria 1048
321 Ga0496102_0000028 3300048905 Bacteria 224124
322 Ga0496102_0046560 3300048905 Bacteria 3939
323 Ga0496102_0173102 3300048905 Bacteria 2032
324 Ga0496102_0362264 3300048905 Bacteria 1365
325 Ga0496102_0389619 3300048905 Bacteria 1311
326 Ga0496102_0398299 3300048905 Bacteria 1294
327 Ga0496102_0522941 3300048905 Bacteria 1109
328 Ga0496102_0664605 3300048905 Bacteria 965
329 Ga0496103_0000024 3300048906 Bacteria 223336
330 Ga0496104_0002230 3300048907 Bacteria 16733
331 Ga0496104_0053518 3300048907 Bacteria 3814
332 Ga0496104_0112762 3300048907 Bacteria 2607
333 Ga0496104_0162129 3300048907 Bacteria 2144
334 Ga0496104_0262333 3300048907 Bacteria 1640
335 Ga0496104_0369720 3300048907 Bacteria 1346
336 Ga0496105_0002084 3300048908 Bacteria 14474
337 Ga0496105_0011930 3300048908 Bacteria 6881
338 Ga0496105_0061395 3300048908 Bacteria 3101
339 Ga0496105_0230680 3300048908 Bacteria 1505
340 Ga0496105_0447954 3300048908 Bacteria 1019
341 Ga0496106_0418493 3300048909 Bacteria 1077
342 Ga0496108_0011212 3300048911 Bacteria 7281
343 Ga0496108_0119185 3300048911 Bacteria 2263
344 Ga0496108_0167496 3300048911 Bacteria 1900
345 Ga0496108_0301226 3300048911 Bacteria 1396
346 Ga0496109_0004361 3300048912 Bacteria 11822
347 Ga0496109_0233177 3300048912 Bacteria 1732
348 Ga0496109_0334271 3300048912 Bacteria 1430
349 Ga0496110_0000263 3300048913 Bacteria 34033
350 Ga0496110_0058414 3300048913 Bacteria 3398
351 Ga0496110_0128140 3300048913 Bacteria 2290
352 Ga0496110_0252248 3300048913 Bacteria 1606
353 Ga0496110_0601772 3300048913 Bacteria 997
354 Ga0496111_0000129 3300048914 Bacteria 33233
355 Ga0496111_0071131 3300048914 Bacteria 2532
356 Ga0496112_0001584 3300048915 Bacteria 17575
357 Ga0496112_0003579 3300048915 Bacteria 12914
358 Ga0496112_0043409 3300048915 Bacteria 4402
359 Ga0496113_0053048 3300048916 Bacteria 3031
360 Ga0496113_0085432 3300048916 Bacteria 2424
361 Ga0496113_0418591 3300048916 Bacteria 1076
362 Ga0496114_0001569 3300048917 Bacteria 17365
363 Ga0496114_0003068 3300048917 Bacteria 12799
364 Ga0496114_0033941 3300048917 Bacteria 4207
365 Ga0496114_0126411 3300048917 Bacteria 2204
366 Ga0496114_0137723 3300048917 Bacteria 2111
367 Ga0496114_0195577 3300048917 Bacteria 1770
368 Ga0496114_0542131 3300048917 Bacteria 1028
369 Ga0496114_0678457 3300048917 Bacteria 905
370 Ga0496115_0086241 3300048918 Bacteria 2561
371 Ga0496116_0000307 3300048919 Bacteria 82318
372 Ga0496117_0000014 3300048920 Bacteria 584427
373 Ga0496117_0000081 3300048920 Bacteria 223343
374 Ga0496117_0001641 3300048920 Bacteria 31427
375 Ga0496117_0037273 3300048920 Bacteria 3624
376 Ga0496117_0041561 3300048920 Bacteria 3367
377 Ga0496118_0000062 3300048921 Bacteria 219267
378 Ga0496118_0000201 3300048921 Bacteria 104874
379 Ga0496119_0002317 3300048922 Bacteria 21003
380 Ga0496119_0003639 3300048922 Bacteria 15826
381 Ga0496119_0006947 3300048922 Bacteria 10326
382 Ga0496119_0010319 3300048922 Bacteria 7871
383 Ga0496119_0075634 3300048922 Bacteria 1956
384 Ga0496119_0132799 3300048922 Bacteria 1354
385 Ga0496120_0002621 3300048923 Bacteria 17821
386 Ga0496120_0002722 3300048923 Bacteria 17275
387 Ga0496120_0016161 3300048923 Bacteria 4886
388 Ga0496120_0036271 3300048923 Bacteria 2937
389 Ga0496120_0116549 3300048923 Bacteria 1387
390 Ga0496120_0139847 3300048923 Bacteria 1230
391 Ga0496121_0011376 3300048924 Bacteria 9892
392 Ga0496121_0040755 3300048924 Bacteria 4069
393 Ga0496122_0009195 3300048925 Bacteria 10465
394 Ga0496122_0013845 3300048925 Bacteria 7854
395 Ga0496122_0035559 3300048925 Bacteria 4048
396 Ga0496122_0287471 3300048925 Bacteria 895
397 Ga0496123_0019228 3300048926 Bacteria 5390
398 Ga0496123_0023565 3300048926 Bacteria 4708
399 Ga0496123_0027278 3300048926 Bacteria 4257
400 Ga0496123_0057189 3300048926 Bacteria 2541
401 Ga0496124_0000194 3300048927 Bacteria 120672
402 Ga0496124_0012066 3300048927 Bacteria 8577
403 Ga0496124_0012231 3300048927 Bacteria 8489
404 Ga0496124_0031320 3300048927 Bacteria 4709
405 Ga0496124_0068818 3300048927 Bacteria 2941
406 Ga0496124_0074308 3300048927 Bacteria 2810
407 Ga0496124_0129122 3300048927 Bacteria 2010
408 Ga0496124_0136372 3300048927 Bacteria 1942
409 Ga0496124_0361929 3300048927 Bacteria 1022
410 Ga0496125_0001828 3300048928 Bacteria 29377
411 Ga0496125_0014555 3300048928 Bacteria 7657
412 Ga0496125_0030699 3300048928 Bacteria 4802
413 Ga0496126_0000148 3300048929 Bacteria 163288
414 Ga0496126_0008939 3300048929 Bacteria 10728
415 Ga0496126_0069208 3300048929 Bacteria 3149
416 Ga0496126_0128678 3300048929 Bacteria 2190
417 Ga0496126_0136810 3300048929 Bacteria 2112
418 Ga0501310_000690 3300049130 Bacteria 2993
419 Ga0501031_0208450 3300049568 Bacteria 1274
420 Ga0501033_0039586 3300049570 Bacteria 3521
421 Ga0501037_0143170 3300049573 Bacteria 1710
422 Ga0501047_0000217 3300049581 Bacteria 69120
423 Ga0501070_0026953 3300049586 Bacteria 4819
424 Ga0501070_0034818 3300049586 Bacteria 4209
425 Ga0501073_0000046 3300049589 Bacteria 78180
426 Ga0501080_0096410 3300049742 Bacteria 2746
427 nmdc:mga03n38_89998_c1 3300050490 Bacteria 1459
428 nmdc:mga00v17_4100_c1 3300050491 Bacteria 7543
429 nmdc:mga00v17_46052_c1 3300050491 Bacteria 2637
430 nmdc:mga00v17_53978_c1 3300050491 Bacteria 2451
431 nmdc:mga00v17_64815_c1 3300050491 Bacteria 2252
432 nmdc:mga00v17_8281_c1 3300050491 Bacteria 5592
433 nmdc:mga06z11_26079_c1 3300050494 Bacteria 2778
434 nmdc:mga04h51_17888_c1 3300050495 Bacteria 2080
435 nmdc:mga09592_306210_c1 3300050508 Bacteria 1377
436 nmdc:mga0sz30_50727_c1 3300050516 Bacteria 1759
437 Ga0495601_0135228 3300053077 Bacteria 1607
438 Ga0495619_0040791 3300053085 Bacteria 3034
439 Ga0495619_0256130 3300053085 Bacteria 1213
440 Ga0495619_0482940 3300053085 Bacteria 853
441 Ga0500566_0021659 3300053094 Bacteria 3778
442 Ga0500641_0060720 3300053096 Bacteria 1573
443 Ga0500556_0001137 3300053104 Bacteria 13017
444 Ga0500556_0001368 3300053104 Bacteria 10710
445 Ga0500562_042054 3300053108 Bacteria 1215
446 Ga0500593_000381 3300053117 Bacteria 17618
447 Ga0500655_001381 3300053133 Bacteria 4602
448 Ga0500559_0000474 3300053136 Bacteria 28589
449 Ga0500573_0051659 3300053140 Bacteria 2364
450 Ga0500577_0013269 3300053142 Bacteria 2512
451 Ga0500616_0012809 3300053153 Bacteria 4894
452 Ga0500616_0021867 3300053153 Bacteria 3577
453 Ga0500620_000054 3300053155 Bacteria 21041
454 2523387791 2523231044 Bacteria 6434991
455 2548699484 2547132424 Bacteria 8348532
456 2566991754 2565956761 Bacteria 6601618
457 2583149277 2582580736 Bacteria 5325865
458 2586057863 2585427649 Bacteria 9053857
459 2599723628 2599185236 Bacteria 6875203
460 2599724005 2599185236 Bacteria 6875203
461 2643847176 2643221566 Bacteria 3460379
462 2643887811 2643221575 Bacteria 4022601
463 2644278235 2643221649 Bacteria 3867359
464 2644514365 2643221692 Bacteria 7282860
465 2687581020 2687453129 Bacteria 4387428
466 2738802805 2738541293 Bacteria 7065685
467 2738887869 2738541308 Bacteria 7020677
468 2739202431 2738543005 Bacteria 5278128
469 2739235708 2738543011 Bacteria 5731169
470 2739362335 2738543034 Bacteria 6084756
471 2753076318 2751185734 Bacteria 8863695
472 2753300717 2751185788 Bacteria 4541048
473 2758225529 2757320536 Bacteria 3629334
474 2774379645 2773857758 Bacteria 3592392
475 2791911678 2791354901 Bacteria 8322202
476 2795780220 2795385470 Bacteria 8317180
477 2804847587 2802429296 Bacteria 7227771
478 2808629251 2808606306 Bacteria 3608896
479 2808884057 2808606368 Bacteria 3174172
480 2809593303 2808606522 Bacteria 9488490
481 2812325037 2811994872 Bacteria 4121241
482 2816504819 2816332139 Bacteria 9138787
483 2821271556 2821268502 Bacteria 3750023
484 2833712700 2833709550 Bacteria 4008291
485 2852635105 2852632344 Bacteria 3463163
486 2857535848 2857531043 Bacteria 6754041
487 2857722357 2857720070 Bacteria 3189373
488 2861527574 2861520306 Bacteria 8348283
489 2862993839 2862993130 Bacteria 3860849
490 2866612721 2866612099 Bacteria 7543886
491 2870625461 2870622029 Bacteria 3643329
492 2870728724 2870721527 Bacteria 9689237
493 2889305304 2889300758 Bacteria 5690814
494 2891331124 2891326441 Bacteria 6439512
495 2899365952 2899359706 Bacteria 10940472
496 2899374877 2899370129 Bacteria 6781179
497 2904502549 2904501621 Bacteria 3401437
498 2904512436 2904509784 Bacteria 3520416
499 2904541266 2904535858 Bacteria 6308016
500 2904767806 2904765812 Bacteria 5369154
501 2904774418 2904770941 Bacteria 5580202
502 2906802479 2906799679 Bacteria 4031749
503 2908678018 2908674828 Bacteria 3382763
504 2908679323 2908678064 Bacteria 3482747
505 2908813451 2908811453 Bacteria 5478616
506 2909075866 2909074476 Bacteria 3436050
507 2915363086 2915358134 Bacteria 6050864
508 2915768859 2915768154 Bacteria 8424322
509 2917740978 2917736166 Bacteria 9690793
510 2919041309 2919039151 Bacteria 3391018
511 2919044061 2919042368 Bacteria 3905917
512 2919052890 2919051321 Bacteria 4210889
513 2919069972 2919069694 Bacteria 3622919
514 2919423765 2919420072 Bacteria 5390363
515 2919436373 2919432681 Bacteria 5390474
516 2919715308 2919713450 Bacteria 7431245
517 2922560911 2922554459 Bacteria 6683962
518 2928093071 2928090899 Bacteria 3158267
519 2928107063 2928104781 Bacteria 3877447
520 2928143355 2928142448 Bacteria 5288925
521 2928501780 2928500415 Bacteria 3384541
522 2939660568 2939657138 Bacteria 3740283
523 2939661589 2939660829 Bacteria 3784848
524 2939746836 2939743619 Bacteria 5762299
525 2945969232 2945968032 Bacteria 4111363
526 2974295800 2974294766 Bacteria 3767688
527 2974320110 2974315732 Bacteria 4602776
528 2974324401 2974324384 Bacteria 3750535
529 2977264737 2977264416 Bacteria 3750737
530 2984523992 2984523437 Bacteria 4508481
531 2984543802 2984542743 Bacteria 3569378
532 2984552794 2984551494 Bacteria 3877562
533 2984583328 2984580707 Bacteria 3351387
534 2995729041 2995726249 Bacteria 3470435
535 8002812045 8002811521 Bacteria 2942897
536 8003319665 8003314358 Bacteria 10575343
537 8016256013 8016254467 Bacteria 3797036
538 8025417355 8025413630 Bacteria 7014048
539 8047714214 8047710418 Bacteria 11023148
540 8054474732 8054472261 Bacteria 7464355
541 8055037325 8055034563 Bacteria 3562128
542 8055070442 8055066027 Bacteria 9479577
543 8056064390 8056060235 Bacteria 7259403
544 Ga0495645_0285003
545 JGI25406J46586_10001705
546 Ga0006562J51391_1035822
547 Ga0006562J51391_1035823
548 Ga0055527_1000025
549 Ga0055542_1000048
550 Ga0055529_1000057
551 Ga0065714_10105198
552 Ga0065714_10174392
553 Ga0068869_100072338
554 Ga0070682_100196331
555 Ga0070682_100299385
556 Ga0068868_100214995
557 Ga0070660_100122243
558 Ga0070687_100335508
559 Ga0070668_100003012
560 Ga0070675_100314777
561 Ga0070671_100011017
562 Ga0070659_100054658
563 Ga0070667_100028279
564 Ga0070714_100318616
565 Ga0070713_100020924
566 Ga0070710_10003125
567 Ga0070711_100012215
568 Ga0070700_100087614
569 Ga0070663_100030530
570 Ga0070662_100041184
571 Ga0070685_10012936
572 Ga0070665_100015335
573 Ga0070665_100061927
574 Ga0070665_100066664
575 Ga0068855_100008064
576 Ga0070664_100094123
577 Ga0068857_100001313
578 Ga0068856_100057039
579 Ga0068856_100078448
580 Ga0068856_100086452
581 Ga0068856_100322716
582 Ga0068852_100048847
583 Ga0068859_100187186
584 Ga0068864_100096812
585 Ga0068864_100252715
586 Ga0068861_100199756
587 Ga0068851_10000030
588 Ga0068863_100000739
589 Ga0068863_100078686
590 Ga0068858_100000519
591 Ga0068860_100464607
592 Ga0081455_10000037
593 Ga0081539_10000027
594 Ga0081539_10020904
595 Ga0081539_10028326
596 Ga0075365_10002952
597 Ga0075365_10003092
598 Ga0075368_10025252
599 Ga0075363_100043833
600 Ga0075364_10004083
601 Ga0075364_10010518
602 Ga0075364_10045154
603 Ga0075364_10169576
604 Ga0075364_10178344
605 Ga0075367_10002632
606 Ga0075369_10018684
607 Ga0068865_100484107
608 Ga0097620_100187203
609 Ga0105240_10004010
610 Ga0105240_10230528
611 Ga0105240_10525075
612 Ga0111539_10276000
613 Ga0105245_10065180
614 Ga0105245_10104885
615 Ga0105247_10161198
616 Ga0105243_10003119
617 Ga0105243_10192633
618 Ga0105243_10439704
619 Ga0105241_10001584
620 Ga0105241_10392059
621 Ga0105242_10088339
622 Ga0105237_10000724
623 Ga0105238_10009308
624 Ga0105238_10761109
625 Ga0105249_10111029
626 Ga0105239_10053909
627 Ga0105239_10254116
628 Ga0105239_10268518
629 Ga0157369_10000554
630 Ga0157369_10415232
631 Ga0157369_10451408
632 Ga0163162_10239554
633 Ga0163162_10848102
634 Ga0157372_10199223
635 Ga0157372_10424698
636 Ga0157372_10466051
637 Ga0157375_10114190
638 Ga0157375_10364587
639 Ga0163163_10191894
640 Ga0157380_10691731
641 Ga0157377_10256194
642 Ga0157379_10021886
643 Ga0157379_10397847
644 Ga0157376_10536399
645 Ga0157376_10868692
646 Ga0163161_10054786
647 Ga0213874_10000090
648 Ga0213876_10056051
649 Ga0209672_100011
650 Ga0209147_101653
651 Ga0209258_102977
652 Ga0209148_1000023
653 Ga0209148_1004511
654 Ga0209148_1010221
655 Ga0209455_1000023
656 Ga0207656_10000001
657 Ga0207656_10184626
658 Ga0207655_1007736
659 Ga0207692_10001325
660 Ga0207688_10049120
661 Ga0207647_10024556
662 Ga0207647_10049809
663 Ga0207643_10120934
664 Ga0207705_10061787
665 Ga0207705_10127854
666 Ga0207705_10156139
667 Ga0207654_10000001
668 Ga0207695_10001789
669 Ga0207671_10000001
670 Ga0207671_10044045
671 Ga0207693_10006897
672 Ga0207663_10489372
673 Ga0207662_10195156
674 Ga0207657_10001206
675 Ga0207657_10063354
676 Ga0207657_10105689
677 Ga0207694_10001525
678 Ga0207687_10044653
679 Ga0207687_10263371
680 Ga0207700_10084558
681 Ga0207700_10453562
682 Ga0207644_10020826
683 Ga0207706_10051164
684 Ga0207686_10058727
685 Ga0207709_10010700
686 Ga0207709_10286919
687 Ga0207669_10423865
688 Ga0207704_10506001
689 Ga0207689_10027217
690 Ga0207661_10155720
691 Ga0207667_10000732
692 Ga0207667_10005506
693 Ga0207667_10066757
694 Ga0207668_10018452
695 Ga0207640_10087636
696 Ga0207677_10245588
697 Ga0207703_10002134
698 Ga0207703_10447938
699 Ga0207678_10006266
700 Ga0207678_10009802
701 Ga0207708_10115249
702 Ga0207702_10057841
703 Ga0207702_10085273
704 Ga0207702_10242841
705 Ga0207641_10005872
706 Ga0207641_10063455
707 Ga0207641_10644447
708 Ga0207648_10475463
709 Ga0207676_10037601
710 Ga0207674_10004415
711 Ga0207674_10102126
712 Ga0207675_100037191
713 Ga0207683_10061236
714 Ga0207683_10386864
715 Ga0207698_10000112
716 Ga0207698_10004807
717 Ga0207698_10204064
718 Ga0207698_10476975
719 Ga0209813_10012088
720 Ga0268266_10012250
721 Ga0268266_10067189
722 Ga0268266_10171139
723 Ga0268265_10584825
724 Ga0268264_10565289
725 Ga0265319_1017244
726 Ga0265318_10016972
727 Ga0307515_10118916
728 Ga0307515_10142771
729 Ga0265338_10102272
730 Ga0307512_10004905
731 Ga0316176_1000700
732 Ga0265330_10198196
733 Ga0265320_10010243
734 Ga0265325_10121044
735 Ga0265327_10002610
736 Ga0307513_10012416
737 Ga0307513_10338436
738 Ga0307509_10132009
739 Ga0265313_10030992
740 Ga0265314_10021241
741 Ga0307405_10200365
742 Ga0307413_10149615
743 Ga0307413_10346092
744 Ga0307518_10001607
745 Ga0307406_10000040
746 Ga0307407_10180374
747 Ga0307412_10177827
748 Ga0307409_100068981
749 Ga0307409_100202251
750 Ga0307416_100034930
751 Ga0307416_100390181
752 Ga0307411_10008663
753 Ga0307415_100224457
754 Ga0307507_10012015
755 Ga0307507_10023368
756 Ga0307507_10035716
757 Ga0307507_10065405
758 Ga0373923_0057490
759 Ga0373953_0014981
760 Ga0373957_0088465
761 Ga0373955_0216040
762 Ga0373937_0014823
763 Ga0395899_0013314
764 Ga0395900_0016459
765 Ga0395900_0083972
766 Ga0395898_0041027
767 Ga0395898_0073864
768 Ga0395898_0148152
769 Ga0395898_0229042
770 Ga0395898_0622044
771 Ga0395905_0272624
772 Ga0395905_0535660
773 Ga0436364_0533791
774 Ga0395901_0096901
775 Ga0395901_0103196
776 Ga0395901_0111627
777 Ga0395901_0210150
778 Ga0436365_0152968
779 Ga0436360_0860482
780 Ga0439465_0001624
781 Ga0451789_1066840
782 Ga0451793_0187004
783 Ga0451797_0546112
784 Ga0451837_0744169
785 Ga0451843_0740794
786 Ga0439449_0007085
787 Ga0450902_017168
788 Ga0439459_0008779
789 Ga0451577_0036216
790 Ga0466969_0013155
791 Ga0466972_0000436
792 Ga0466972_0002299
793 Ga0466972_0020094
794 Ga0466965_0005730
795 Ga0466965_0007426
796 Ga0466961_0124077
797 Ga0466963_0167145
798 Ga0466963_0410330
799 Ga0453684_0000047
800 Ga0453684_0028698
801 Ga0453684_0040845
802 Ga0466968_0027424
803 Ga0466970_0031298
804 Ga0466970_0053751
805 Ga0466970_0240618
806 Ga0466957_0437584
807 Ga0466960_0000980
808 Ga0466960_0005461
809 Ga0466960_0007239
810 Ga0466959_0037385
811 Ga0466959_0037638
812 Ga0466958_0050385
813 Ga0466967_0483324
814 Ga0495592_0027356
815 Ga0495603_0004436
816 Ga0495603_0061098
817 Ga0495603_0173114
818 Ga0495603_0184224
819 Ga0495629_0001173
820 Ga0495641_0020966
821 Ga0495651_0002913
822 Ga0495653_0072792
823 Ga0495650_0000055
824 Ga0495582_0235831
825 Ga0495607_0015436
826 Ga0495608_0020121
827 Ga0495608_0400369
828 Ga0495616_0065164
829 Ga0495618_0015795
830 Ga0495620_0051258
831 Ga0495628_0024621
832 Ga0495630_0055879
833 Ga0495666_0119204
834 Ga0495652_0015512
835 Ga0495665_0227995
836 Ga0495640_0026222
837 Ga0495640_0309712
838 Ga0495587_0104812
839 Ga0495667_0000218
840 Ga0495667_0043724
841 Ga0495668_0001192
842 Ga0495634_0161432
843 Ga0495635_0050751
844 Ga0495657_0009906
845 Ga0495599_0087161
846 Ga0495623_0021331
847 Ga0495646_0001401
848 Ga0495646_0180736
849 Ga0495613_0000886
850 Ga0495613_0143433
851 Ga0495600_0025572
852 Ga0495600_0124193
853 Ga0495604_0018620
854 Ga0495674_0048883
855 Ga0495674_0111396
856 Ga0495676_0025857
857 Ga0495680_0023107
858 Ga0495683_0000485
859 Ga0495684_0013488
860 Ga0495602_0029365
861 Ga0495614_0000362
862 Ga0496101_0088341
863 Ga0496101_0424149
864 Ga0496102_0000028
865 Ga0496102_0046560
866 Ga0496102_0173102
867 Ga0496102_0362264
868 Ga0496102_0389619
869 Ga0496102_0398299
870 Ga0496102_0522941
871 Ga0496102_0664605
872 Ga0496103_0000024
873 Ga0496104_0002230
874 Ga0496104_0053518
875 Ga0496104_0112762
876 Ga0496104_0162129
877 Ga0496104_0262333
878 Ga0496104_0369720
879 Ga0496105_0002084
880 Ga0496105_0011930
881 Ga0496105_0061395
882 Ga0496105_0230680
883 Ga0496105_0447954
884 Ga0496106_0418493
885 Ga0496108_0011212
886 Ga0496108_0119185
887 Ga0496108_0167496
888 Ga0496108_0301226
889 Ga0496109_0004361
890 Ga0496109_0233177
891 Ga0496109_0334271
892 Ga0496110_0000263
893 Ga0496110_0058414
894 Ga0496110_0128140
895 Ga0496110_0252248
896 Ga0496110_0601772
897 Ga0496111_0000129
898 Ga0496111_0071131
899 Ga0496112_0001584
900 Ga0496112_0003579
901 Ga0496112_0043409
902 Ga0496113_0053048
903 Ga0496113_0085432
904 Ga0496113_0418591
905 Ga0496114_0001569
906 Ga0496114_0003068
907 Ga0496114_0033941
908 Ga0496114_0126411
909 Ga0496114_0137723
910 Ga0496114_0195577
911 Ga0496114_0542131
912 Ga0496114_0678457
913 Ga0496115_0086241
914 Ga0496116_0000307
915 Ga0496117_0000014
916 Ga0496117_0000081
917 Ga0496117_0001641
918 Ga0496117_0037273
919 Ga0496117_0041561
920 Ga0496118_0000062
921 Ga0496118_0000201
922 Ga0496119_0002317
923 Ga0496119_0003639
924 Ga0496119_0006947
925 Ga0496119_0010319
926 Ga0496119_0075634
927 Ga0496119_0132799
928 Ga0496120_0002621
929 Ga0496120_0002722
930 Ga0496120_0016161
931 Ga0496120_0036271
932 Ga0496120_0116549
933 Ga0496120_0139847
934 Ga0496121_0011376
935 Ga0496121_0040755
936 Ga0496122_0009195
937 Ga0496122_0013845
938 Ga0496122_0035559
939 Ga0496122_0287471
940 Ga0496123_0019228
941 Ga0496123_0023565
942 Ga0496123_0027278
943 Ga0496123_0057189
944 Ga0496124_0000194
945 Ga0496124_0012066
946 Ga0496124_0012231
947 Ga0496124_0031320
948 Ga0496124_0068818
949 Ga0496124_0074308
950 Ga0496124_0129122
951 Ga0496124_0136372
952 Ga0496124_0361929
953 Ga0496125_0001828
954 Ga0496125_0014555
955 Ga0496125_0030699
956 Ga0496126_0000148
957 Ga0496126_0008939
958 Ga0496126_0069208
959 Ga0496126_0128678
960 Ga0496126_0136810
961 Ga0501310_000690
962 Ga0501031_0208450
963 Ga0501033_0039586
964 Ga0501037_0143170
965 Ga0501047_0000217
966 Ga0501070_0026953
967 Ga0501070_0034818
968 Ga0501073_0000046
969 Ga0501080_0096410
970 nmdc:mga03n38_89998_c1
971 nmdc:mga00v17_4100_c1
972 nmdc:mga00v17_46052_c1
973 nmdc:mga00v17_53978_c1
974 nmdc:mga00v17_64815_c1
975 nmdc:mga00v17_8281_c1
976 nmdc:mga06z11_26079_c1
977 nmdc:mga04h51_17888_c1
978 nmdc:mga09592_306210_c1
979 nmdc:mga0sz30_50727_c1
980 Ga0495601_0135228
981 Ga0495619_0040791
982 Ga0495619_0256130
983 Ga0495619_0482940
984 Ga0500566_0021659
985 Ga0500641_0060720
986 Ga0500556_0001137
987 Ga0500556_0001368
988 Ga0500562_042054
989 Ga0500593_000381
990 Ga0500655_001381
991 Ga0500559_0000474
992 Ga0500573_0051659
993 Ga0500577_0013269
994 Ga0500616_0012809
995 Ga0500616_0021867
996 Ga0500620_000054
997 2523387791
998 2548699484
999 2566991754
1000 2583149277
1001 2586057863
1002 2599723628
1003 2599724005
1004 2643847176
1005 2643887811
1006 2644278235
1007 2644514365
1008 2687581020
1009 2738802805
1010 2738887869
1011 2739202431
1012 2739235708
1013 2739362335
1014 2753076318
1015 2753300717
1016 2758225529
1017 2774379645
1018 2791911678
1019 2795780220
1020 2804847587
1021 2808629251
1022 2808884057
1023 2809593303
1024 2812325037
1025 2816504819
1026 2821271556
1027 2833712700
1028 2852635105
1029 2857535848
1030 2857722357
1031 2861527574
1032 2862993839
1033 2866612721
1034 2870625461
1035 2870728724
1036 2889305304
1037 2891331124
1038 2899365952
1039 2899374877
1040 2904502549
1041 2904512436
1042 2904541266
1043 2904767806
1044 2904774418
1045 2906802479
1046 2908678018
1047 2908679323
1048 2908813451
1049 2909075866
1050 2915363086
1051 2915768859
1052 2917740978
1053 2919041309
1054 2919044061
1055 2919052890
1056 2919069972
1057 2919423765
1058 2919436373
1059 2919715308
1060 2922560911
1061 2928093071
1062 2928107063
1063 2928143355
1064 2928501780
1065 2939660568
1066 2939661589
1067 2939746836
1068 2945969232
1069 2974295800
1070 2974320110
1071 2974324401
1072 2977264737
1073 2984523992
1074 2984543802
1075 2984552794
1076 2984583328
1077 2995729041
1078 8002812045
1079 8003319665
1080 8016256013
1081 8025417355
1082 8047714214
1083 8054474732
1084 8055037325
1085 8055070442
1086 8056064390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13344

Hydrolase_6

Haloacid dehalogenase-like hydrolase

50

150

0.99

PF13242

Hydrolase_like

HAD-hyrolase-like

221

295

0.98

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

204

268

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

50

262

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c4n-assembly1.cif.gz_A nagd from e.coli k-12 strain 0.9656 8 253
4ift-assembly1.cif.gz_B crystal structure of double mutant thermostable nppase from geobacillus stearothermophilus 0.958 5 253
4ig4-assembly1.cif.gz_B crystal structure of single mutant thermostable nppase (n86s) from geobacillus stearothermophilus 0.9558 5 253
4kn8-assembly1.cif.gz_B crystal structure of bs-tpnppase 0.954 5 253
1ydf-assembly1.cif.gz_A crystal structure of a had-like phosphatase from streptococcus pneumoniae 0.9409 8 253
ID Description Score Start End Superfamily
af_P0AF24_157_246_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9759 164 252 3.40.50.1000
2c4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9748 8 253 3.40.50.1000
af_Q2FZX0_4_251_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9713 8 251 3.40.50.1000
af_P0AF24_1_250_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9708 8 253 3.40.50.1000
af_Q2FZX0_5_108_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9704 8 109 3.40.50.1000
ID Description Score Start End GO Terms
AF-D5USB7-F1-model_v4 HAD-superfamily hydrolase, subfamily IIA 0.9955 6 264 GO:0005737
GO:0016791
GO:0046872
AF-A0A7K2HTG0-F1-model_v4 HAD-IIA family hydrolase 0.9951 7 264 GO:0005737
GO:0016791
GO:0046872
AF-A0A535TWR7-F1-model_v4 TIGR01457 family HAD-type hydrolase 0.9948 13 134 GO:0005737
GO:0016791
AF-A0A1L7FG26-F1-model_v4 deleted 0.9944 2 263
AF-A0A4Q8AGN6-F1-model_v4 NagD protein 0.9938 8 258 GO:0005737
GO:0016791
GO:0046872

Map