F461595

General Info

Members Datasets Scaffolds Average Seq Length
543 262 1086 393

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100040419|Ga0068864_1000404191
Length 428
Sequence VSREGSDQVHRRKGTLGTRFFGLRLVAHYFLVEKSRKAKDLRSFMPKLSIKDLNLSGQRVLVRVDFNVPIKDGKVEDDTRIRASLPTIEYALEHGAKVILASHLGRPKGQRVDKYSLKPVADHLSTLLKRPVLFADDCVDDEAEAMASKLALGEVLLLENLRFHPEEEKNDDGFAKKLARPCDVFVNDAFGAAHRAHASTVGVTKYVNKAAAGLLMEKELEYLGKCINHPEHPFVAILGGAKVSDKIPVINALIDRGVDKILIGGAMAYTFLKAEGFTVGKSLVEDNMLSTALAIKKRAEENDIDFLLPTDHQVVDSYEPIKGQQIVAKTIPIEFTNIGLVGLDIGIETVGHFSKALADARMIIWNGPMGVFEEPPFDQGTIGVAHAVAEAADRGAIVVVGGGDSVAAILEFLAGEELPGVAALTDKD

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.42
Nodule 0
Rhizoplane 1.84
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100040419 3300005618 Bacteria 3990
2 CNAas_1000040 3300000532 Bacteria 8742
3 JGI24751J29686_10000030 3300002459 Bacteria 92588
4 JGI25406J46586_10004412 3300003203 Bacteria 6553
5 Ga0065714_10064504 3300005288 Bacteria 46817
6 Ga0065712_10007288 3300005290 Bacteria 2600
7 Ga0065712_10015493 3300005290 Bacteria 2490
8 Ga0065712_10067766 3300005290 Bacteria 46828
9 Ga0065715_10089158 3300005293 Bacteria 13366
10 Ga0070676_10009459 3300005328 Bacteria 5265
11 Ga0070683_100000782 3300005329 Bacteria 23454
12 Ga0070683_100033711 3300005329 Bacteria 4670
13 Ga0070683_100260024 3300005329 Bacteria 1651
14 Ga0070683_100271933 3300005329 Unclassified 1612
15 Ga0070690_100029080 3300005330 Bacteria 3425
16 Ga0070670_100002791 3300005331 Bacteria 14445
17 Ga0070670_100129551 3300005331 Bacteria 2178
18 Ga0070670_100195300 3300005331 Bacteria 1758
19 Ga0068869_100031649 3300005334 Bacteria 3721
20 Ga0068869_100221871 3300005334 Bacteria 1499
21 Ga0070680_100000906 3300005336 Bacteria 20990
22 Ga0070680_100002278 3300005336 Bacteria 14193
23 Ga0070680_100188871 3300005336 Bacteria 1736
24 Ga0068868_100039981 3300005338 Bacteria 3647
25 Ga0068868_100063212 3300005338 Bacteria 2936
26 Ga0068868_100189998 3300005338 Bacteria 1708
27 Ga0070660_100110462 3300005339 Bacteria 2187
28 Ga0070689_100006471 3300005340 Bacteria 8110
29 Ga0070689_100059585 3300005340 Bacteria 2967
30 Ga0070692_10074309 3300005345 Bacteria 1818
31 Ga0070675_100157604 3300005354 Bacteria 1950
32 Ga0070673_100134851 3300005364 Bacteria 2077
33 Ga0070673_100225285 3300005364 Bacteria 1624
34 Ga0070659_100004306 3300005366 Bacteria 10162
35 Ga0070667_100208881 3300005367 Bacteria 1735
36 Ga0070714_100004206 3300005435 Bacteria 10839
37 Ga0070714_100014598 3300005435 Bacteria 6312
38 Ga0070713_100001935 3300005436 Bacteria 13372
39 Ga0070713_100033262 3300005436 Bacteria 4128
40 Ga0070713_100262500 3300005436 Bacteria 1579
41 Ga0070711_100023210 3300005439 Bacteria 4031
42 Ga0070711_100048099 3300005439 Bacteria 2914
43 Ga0070700_100000719 3300005441 Bacteria 16343
44 Ga0070694_100008855 3300005444 Bacteria 6165
45 Ga0070694_100131549 3300005444 Bacteria 1808
46 Ga0070708_100000288 3300005445 Bacteria 37866
47 Ga0070663_100081643 3300005455 Unclassified 2377
48 Ga0070681_10007327 3300005458 Bacteria 10774
49 Ga0070681_10007744 3300005458 Bacteria 10498
50 Ga0070681_10051872 3300005458 Bacteria 4091
51 Ga0070681_10287069 3300005458 Bacteria 1556
52 Ga0070706_100000125 3300005467 Bacteria 94689
53 Ga0070706_100002798 3300005467 Bacteria 17448
54 Ga0070706_100198172 3300005467 Bacteria 1876
55 Ga0070707_100003600 3300005468 Bacteria 14608
56 Ga0070707_100007466 3300005468 Bacteria 10152
57 Ga0070707_100269503 3300005468 Bacteria 1655
58 Ga0070707_100343404 3300005468 Bacteria 1450
59 Ga0070698_100005037 3300005471 Bacteria 14476
60 Ga0070698_100006865 3300005471 Bacteria 12329
61 Ga0070698_100026885 3300005471 Bacteria 5984
62 Ga0070699_100000880 3300005518 Bacteria 27937
63 Ga0070699_100094221 3300005518 Bacteria 2621
64 Ga0070679_100077077 3300005530 Bacteria 3322
65 Ga0070679_100081171 3300005530 Unclassified 3232
66 Ga0070684_100000004 3300005535 Bacteria 231043
67 Ga0070684_100018692 3300005535 Bacteria 5716
68 Ga0070684_100138444 3300005535 Bacteria 2200
69 Ga0070697_100108356 3300005536 Bacteria 2312
70 Ga0068853_100054585 3300005539 Bacteria 3443
71 Ga0070672_100016594 3300005543 Bacteria 5276
72 Ga0070672_100033246 3300005543 Bacteria 3904
73 Ga0070686_100022101 3300005544 Bacteria 3786
74 Ga0070696_100001812 3300005546 Bacteria 14026
75 Ga0070696_100148651 3300005546 Bacteria 1718
76 Ga0070693_100054472 3300005547 Bacteria 2300
77 Ga0070665_100096315 3300005548 Bacteria 2964
78 Ga0070704_100000897 3300005549 Bacteria 14913
79 Ga0068855_100007695 3300005563 Bacteria 13014
80 Ga0068855_100018074 3300005563 Bacteria 8473
81 Ga0068855_100021336 3300005563 Bacteria 7767
82 Ga0068855_100107352 3300005563 Bacteria 3207
83 Ga0068855_100141525 3300005563 Bacteria 2742
84 Ga0070664_100047571 3300005564 Bacteria 3624
85 Ga0070664_100075926 3300005564 Bacteria 2887
86 Ga0068856_100004681 3300005614 Bacteria 13582
87 Ga0068856_100039174 3300005614 Bacteria 4653
88 Ga0068856_100056752 3300005614 Bacteria 3865
89 Ga0068856_100367001 3300005614 Unclassified 1458
90 Ga0068856_100423527 3300005614 Bacteria 1351
91 Ga0070702_100010971 3300005615 Bacteria 4490
92 Ga0070702_100038951 3300005615 Bacteria 2650
93 Ga0068859_100009084 3300005617 Bacteria 10038
94 Ga0068859_100022162 3300005617 Bacteria 6369
95 Ga0068859_100054415 3300005617 Bacteria 4025
96 Ga0068859_100059991 3300005617 Bacteria 3833
97 Ga0068859_100072850 3300005617 Bacteria 3472
98 Ga0068864_100012799 3300005618 Bacteria 6936
99 Ga0068864_100016856 3300005618 Bacteria 6088
100 Ga0068864_100024814 3300005618 Bacteria 5043
101 Ga0068864_100036952 3300005618 Bacteria 4165
102 Ga0068864_100045644 3300005618 Bacteria 3759
103 Ga0068866_10114216 3300005718 Bacteria 1511
104 Ga0068861_100047932 3300005719 Bacteria 3227
105 Ga0068861_100125700 3300005719 Bacteria 2074
106 Ga0068851_10010828 3300005834 Bacteria 4262
107 Ga0068863_100077675 3300005841 Bacteria 3142
108 Ga0068858_100015305 3300005842 Bacteria 7215
109 Ga0068858_100070213 3300005842 Bacteria 3246
110 Ga0068858_100360199 3300005842 Bacteria 1394
111 Ga0068860_100019352 3300005843 Bacteria 6604
112 Ga0068860_100089275 3300005843 Bacteria 2934
113 Ga0081455_10032863 3300005937 Bacteria 4669
114 Ga0081538_10007618 3300005981 Bacteria 9333
115 Ga0081538_10021911 3300005981 Bacteria 4646
116 Ga0081538_10034673 3300005981 Bacteria 3331
117 Ga0081539_10006601 3300005985 Bacteria 11020
118 Ga0070717_10029849 3300006028 Bacteria 4379
119 Ga0070717_10196318 3300006028 Bacteria 1765
120 Ga0075365_10000131 3300006038 Bacteria 22979
121 Ga0075365_10012716 3300006038 Bacteria 5009
122 Ga0075363_100014550 3300006048 Bacteria 3848
123 Ga0075364_10000706 3300006051 Bacteria 17509
124 Ga0075364_10001601 3300006051 Bacteria 12385
125 Ga0075364_10026996 3300006051 Bacteria 3666
126 Ga0075364_10208196 3300006051 Bacteria 1326
127 Ga0075362_10052795 3300006177 Bacteria 1823
128 Ga0075367_10002737 3300006178 Bacteria 8151
129 Ga0075369_10001648 3300006186 Bacteria 7695
130 Ga0075427_10000404 3300006194 Bacteria 4867
131 Ga0097621_100090191 3300006237 Bacteria 2564
132 Ga0075370_10000232 3300006353 Bacteria 19959
133 Ga0068871_100004539 3300006358 Bacteria 9680
134 Ga0068871_100006668 3300006358 Bacteria 8189
135 Ga0068871_100098014 3300006358 Bacteria 2452
136 Ga0075428_100009001 3300006844 Bacteria 11076
137 Ga0075428_100103241 3300006844 Bacteria 3109
138 Ga0075428_100178367 3300006844 Bacteria 2300
139 Ga0075430_100076170 3300006846 Bacteria 2811
140 Ga0075431_100207480 3300006847 Bacteria 2003
141 Ga0075431_100299919 3300006847 Bacteria 1623
142 Ga0075433_10045889 3300006852 Unclassified 3799
143 Ga0075433_10313912 3300006852 Bacteria 1387
144 Ga0075434_100019404 3300006871 Bacteria 6580
145 Ga0075434_100035585 3300006871 Bacteria 4923
146 Ga0075434_100173547 3300006871 Bacteria 2176
147 Ga0075429_100003016 3300006880 Bacteria 14272
148 Ga0075429_100041444 3300006880 Bacteria 4010
149 Ga0075436_100016731 3300006914 Bacteria 5019
150 Ga0075436_100080015 3300006914 Bacteria 2264
151 Ga0097620_100009084 3300006931 Bacteria 10038
152 Ga0097620_100022163 3300006931 Bacteria 6369
153 Ga0097620_100054415 3300006931 Bacteria 4025
154 Ga0097620_100059986 3300006931 Bacteria 3833
155 Ga0097620_100072856 3300006931 Bacteria 3472
156 Ga0075435_100000569 3300007076 Bacteria 22675
157 Ga0105240_10000167 3300009093 Bacteria 133279
158 Ga0105240_10001386 3300009093 Bacteria 41666
159 Ga0105240_10001428 3300009093 Bacteria 40901
160 Ga0105240_10001660 3300009093 Bacteria 37767
161 Ga0105240_10011426 3300009093 Bacteria 12368
162 Ga0105240_10137155 3300009093 Bacteria 2929
163 Ga0105240_10158004 3300009093 Bacteria 2695
164 Ga0105240_10293426 3300009093 Bacteria 1863
165 Ga0111539_10078972 3300009094 Bacteria 3870
166 Ga0105245_10002831 3300009098 Bacteria 15586
167 Ga0105245_10032874 3300009098 Bacteria 4594
168 Ga0105245_10204841 3300009098 Bacteria 1896
169 Ga0105247_10001044 3300009101 Bacteria 20780
170 Ga0105247_10106465 3300009101 Bacteria 1799
171 Ga0114129_10021586 3300009147 Bacteria 9139
172 Ga0114129_10033645 3300009147 Bacteria 7242
173 Ga0114129_10578413 3300009147 Bacteria 1458
174 Ga0114129_10605711 3300009147 Bacteria 1419
175 Ga0105243_10000474 3300009148 Bacteria 41200
176 Ga0105243_10025565 3300009148 Bacteria 4514
177 Ga0105241_10022194 3300009174 Bacteria 4699
178 Ga0105241_10221177 3300009174 Bacteria 1592
179 Ga0105241_10245040 3300009174 Bacteria 1517
180 Ga0105242_10005047 3300009176 Bacteria 10192
181 Ga0105242_10015883 3300009176 Bacteria 5849
182 Ga0105242_10154263 3300009176 Bacteria 2005
183 Ga0105242_10209748 3300009176 Bacteria 1735
184 Ga0105248_10007483 3300009177 Bacteria 11979
185 Ga0105248_10008842 3300009177 Bacteria 11064
186 Ga0105248_10023062 3300009177 Bacteria 6913
187 Ga0105248_10028561 3300009177 Bacteria 6215
188 Ga0105248_10069702 3300009177 Bacteria 3948
189 Ga0105248_10099217 3300009177 Bacteria 3281
190 Ga0105248_10103613 3300009177 Bacteria 3207
191 Ga0105248_10174288 3300009177 Bacteria 2425
192 Ga0105248_10222334 3300009177 Bacteria 2126
193 Ga0105237_10000829 3300009545 Bacteria 42345
194 Ga0105237_10012727 3300009545 Bacteria 8851
195 Ga0105237_10016752 3300009545 Bacteria 7609
196 Ga0105237_10063758 3300009545 Bacteria 3683
197 Ga0105238_10012864 3300009551 Bacteria 8444
198 Ga0105238_10017522 3300009551 Bacteria 7283
199 Ga0105238_10065839 3300009551 Bacteria 3625
200 Ga0105238_10262421 3300009551 Unclassified 1707
201 Ga0105249_10042107 3300009553 Bacteria 4152
202 Ga0105239_10060038 3300010375 Bacteria 4173
203 Ga0105239_10115797 3300010375 Bacteria 2974
204 Ga0105239_10246599 3300010375 Bacteria 2006
205 Ga0105246_10155413 3300011119 Bacteria 1736
206 Ga0157373_10044616 3300013100 Bacteria 3165
207 Ga0157373_10145533 3300013100 Bacteria 1667
208 Ga0157370_10002862 3300013104 Bacteria 20601
209 Ga0157370_10003363 3300013104 Bacteria 18832
210 Ga0157370_10006287 3300013104 Bacteria 13141
211 Ga0157369_10003673 3300013105 Bacteria 18224
212 Ga0157369_10007008 3300013105 Bacteria 13006
213 Ga0157369_10253444 3300013105 Bacteria 1836
214 Ga0157369_10359119 3300013105 Bacteria 1513
215 Ga0157374_10020037 3300013296 Bacteria 5930
216 Ga0157374_10079474 3300013296 Bacteria 3108
217 Ga0157378_10000048 3300013297 Bacteria 104914
218 Ga0157378_10113691 3300013297 Bacteria 2486
219 Ga0157378_10285054 3300013297 Bacteria 1594
220 Ga0157378_10495468 3300013297 Unclassified 1220
221 Ga0163162_10001226 3300013306 Bacteria 23960
222 Ga0163162_10051608 3300013306 Bacteria 4127
223 Ga0157372_10008271 3300013307 Bacteria 11061
224 Ga0157372_10009953 3300013307 Bacteria 10112
225 Ga0157372_10020556 3300013307 Bacteria 7123
226 Ga0157372_10061979 3300013307 Bacteria 4189
227 Ga0157372_10436681 3300013307 Bacteria 1526
228 Ga0157375_10006519 3300013308 Bacteria 10158
229 Ga0157375_10016090 3300013308 Bacteria 6710
230 Ga0157375_10092066 3300013308 Bacteria 3095
231 Ga0157375_10181807 3300013308 Bacteria 2254
232 Ga0157375_10283018 3300013308 Bacteria 1821
233 Ga0163163_10000156 3300014325 Bacteria 70968
234 Ga0163163_10001640 3300014325 Bacteria 18838
235 Ga0163163_10012445 3300014325 Bacteria 7751
236 Ga0163163_10055468 3300014325 Bacteria 3916
237 Ga0163163_10074422 3300014325 Bacteria 3388
238 Ga0163163_10086733 3300014325 Bacteria 3140
239 Ga0163163_10110398 3300014325 Bacteria 2778
240 Ga0163163_10118636 3300014325 Bacteria 2678
241 Ga0163163_10159202 3300014325 Bacteria 2303
242 Ga0163163_10199489 3300014325 Bacteria 2049
243 Ga0157380_10338839 3300014326 Bacteria 1402
244 Ga0157379_10115066 3300014968 Bacteria 2418
245 Ga0157376_10041415 3300014969 Bacteria 3770
246 Ga0157376_10070740 3300014969 Bacteria 2962
247 Ga0157376_10337230 3300014969 Bacteria 1439
248 Ga0213876_10033944 3300021384 Bacteria 2690
249 Ga0213875_10003665 3300021388 Bacteria 8678
250 Ga0213875_10017491 3300021388 Bacteria 3462
251 Ga0213875_10036350 3300021388 Bacteria 2323
252 Ga0213875_10049995 3300021388 Unclassified 1959
253 Ga0213871_10000014 3300021441 Bacteria 11633
254 Ga0207697_10012891 3300025315 Bacteria 3495
255 Ga0207656_10005843 3300025321 Bacteria 4384
256 Ga0207642_10025243 3300025899 Bacteria 2401
257 Ga0207710_10002769 3300025900 Bacteria 8015
258 Ga0207688_10084682 3300025901 Bacteria 1815
259 Ga0207643_10099183 3300025908 Bacteria 1707
260 Ga0207643_10110418 3300025908 Bacteria 1620
261 Ga0207684_10000130 3300025910 Bacteria 137931
262 Ga0207654_10002715 3300025911 Bacteria 8982
263 Ga0207654_10150104 3300025911 Bacteria 1495
264 Ga0207707_10007109 3300025912 Bacteria 9751
265 Ga0207707_10009246 3300025912 Bacteria 8551
266 Ga0207707_10164853 3300025912 Bacteria 1937
267 Ga0207695_10000735 3300025913 Bacteria 63549
268 Ga0207695_10003343 3300025913 Bacteria 22693
269 Ga0207695_10004632 3300025913 Bacteria 18649
270 Ga0207695_10017603 3300025913 Bacteria 8305
271 Ga0207695_10266307 3300025913 Bacteria 1610
272 Ga0207695_10272370 3300025913 Bacteria 1588
273 Ga0207671_10011368 3300025914 Bacteria 7251
274 Ga0207671_10028990 3300025914 Bacteria 4135
275 Ga0207663_10032914 3300025916 Bacteria 3082
276 Ga0207660_10006402 3300025917 Bacteria 7631
277 Ga0207657_10079238 3300025919 Bacteria 2764
278 Ga0207652_10043700 3300025921 Bacteria 3815
279 Ga0207646_10004920 3300025922 Bacteria 14288
280 Ga0207646_10076346 3300025922 Bacteria 2994
281 Ga0207681_10014247 3300025923 Bacteria 4936
282 Ga0207681_10111353 3300025923 Bacteria 1992
283 Ga0207694_10010833 3300025924 Bacteria 6882
284 Ga0207694_10093532 3300025924 Bacteria 2375
285 Ga0207694_10119397 3300025924 Bacteria 2104
286 Ga0207650_10000010 3300025925 Bacteria 454110
287 Ga0207650_10251584 3300025925 Bacteria 1431
288 Ga0207659_10091918 3300025926 Bacteria 2268
289 Ga0207687_10001155 3300025927 Bacteria 18001
290 Ga0207687_10019742 3300025927 Bacteria 4467
291 Ga0207687_10318592 3300025927 Bacteria 1258
292 Ga0207700_10002092 3300025928 Bacteria 11391
293 Ga0207700_10045360 3300025928 Bacteria 3243
294 Ga0207686_10006948 3300025934 Bacteria 6093
295 Ga0207686_10009804 3300025934 Bacteria 5204
296 Ga0207686_10010553 3300025934 Bacteria 5032
297 Ga0207686_10016548 3300025934 Bacteria 4139
298 Ga0207686_10053520 3300025934 Bacteria 2524
299 Ga0207686_10157152 3300025934 Bacteria 1590
300 Ga0207709_10029126 3300025935 Bacteria 3199
301 Ga0207670_10004103 3300025936 Bacteria 7799
302 Ga0207704_10090651 3300025938 Bacteria 2007
303 Ga0207691_10013743 3300025940 Bacteria 7735
304 Ga0207691_10078508 3300025940 Bacteria 2972
305 Ga0207711_10008004 3300025941 Bacteria 8842
306 Ga0207711_10015006 3300025941 Bacteria 6435
307 Ga0207711_10018972 3300025941 Bacteria 5721
308 Ga0207711_10036430 3300025941 Bacteria 4175
309 Ga0207711_10077141 3300025941 Bacteria 2904
310 Ga0207711_10256802 3300025941 Bacteria 1605
311 Ga0207711_10347458 3300025941 Bacteria 1373
312 Ga0207689_10014510 3300025942 Bacteria 6701
313 Ga0207689_10027470 3300025942 Bacteria 4763
314 Ga0207661_10000055 3300025944 Bacteria 86544
315 Ga0207661_10003574 3300025944 Bacteria 10812
316 Ga0207661_10025265 3300025944 Bacteria 4513
317 Ga0207661_10217742 3300025944 Bacteria 1686
318 Ga0207679_10060131 3300025945 Bacteria 2822
319 Ga0207667_10008109 3300025949 Bacteria 12517
320 Ga0207667_10020982 3300025949 Bacteria 7245
321 Ga0207667_10031888 3300025949 Bacteria 5683
322 Ga0207667_10037561 3300025949 Bacteria 5176
323 Ga0207667_10207542 3300025949 Bacteria 2008
324 Ga0207651_10000958 3300025960 Bacteria 12747
325 Ga0207712_10058160 3300025961 Bacteria 2731
326 Ga0207640_10124404 3300025981 Bacteria 1854
327 Ga0207658_10036943 3300025986 Bacteria 3505
328 Ga0207658_10139318 3300025986 Bacteria 1961
329 Ga0207658_10255876 3300025986 Bacteria 1490
330 Ga0207677_10119503 3300026023 Bacteria 1979
331 Ga0207703_10050255 3300026035 Bacteria 3374
332 Ga0207703_10096192 3300026035 Bacteria 2500
333 Ga0207703_10115430 3300026035 Bacteria 2297
334 Ga0207703_10148083 3300026035 Bacteria 2044
335 Ga0207703_10267996 3300026035 Bacteria 1546
336 Ga0207639_10041861 3300026041 Bacteria 3431
337 Ga0207678_10146740 3300026067 Bacteria 2014
338 Ga0207708_10001694 3300026075 Bacteria 16322
339 Ga0207702_10016738 3300026078 Bacteria 6069
340 Ga0207702_10021680 3300026078 Bacteria 5319
341 Ga0207702_10093190 3300026078 Bacteria 2641
342 Ga0207641_10052455 3300026088 Bacteria 3454
343 Ga0207641_10199549 3300026088 Bacteria 1844
344 Ga0207648_10114592 3300026089 Bacteria 2368
345 Ga0207676_10019146 3300026095 Bacteria 4989
346 Ga0207676_10019238 3300026095 Bacteria 4978
347 Ga0207676_10024955 3300026095 Bacteria 4431
348 Ga0207676_10045205 3300026095 Bacteria 3401
349 Ga0207676_10074544 3300026095 Bacteria 2734
350 Ga0207676_10138959 3300026095 Bacteria 2077
351 Ga0207674_10002399 3300026116 Bacteria 23688
352 Ga0207674_10012887 3300026116 Bacteria 9330
353 Ga0207675_100012425 3300026118 Bacteria 7956
354 Ga0207675_100094306 3300026118 Bacteria 2815
355 Ga0207675_100141622 3300026118 Bacteria 2285
356 Ga0207698_10040434 3300026142 Bacteria 3465
357 Ga0207698_10172799 3300026142 Bacteria 1905
358 Ga0268266_10286879 3300028379 Bacteria 1532
359 Ga0268264_10110084 3300028381 Bacteria 2411
360 Ga0268264_10144356 3300028381 Bacteria 2126
361 Ga0265323_10002678 3300028653 Bacteria 8045
362 Ga0265330_10025425 3300031235 Bacteria 2684
363 Ga0265328_10028138 3300031239 Bacteria 2104
364 Ga0265320_10000588 3300031240 Bacteria 27970
365 Ga0265325_10009463 3300031241 Bacteria 5686
366 Ga0265329_10011967 3300031242 Bacteria 3139
367 Ga0265329_10022277 3300031242 Bacteria 2121
368 Ga0265331_10002043 3300031250 Bacteria 13988
369 Ga0265331_10011289 3300031250 Bacteria 4898
370 Ga0265316_10001444 3300031344 Bacteria 25507
371 Ga0265316_10007310 3300031344 Bacteria 10419
372 Ga0265316_10027880 3300031344 Bacteria 4668
373 Ga0265316_10040714 3300031344 Bacteria 3723
374 Ga0265316_10050083 3300031344 Bacteria 3287
375 Ga0265316_10052849 3300031344 Bacteria 3185
376 Ga0265316_10067696 3300031344 Bacteria 2761
377 Ga0307408_100111679 3300031548 Bacteria 2100
378 Ga0265314_10000722 3300031711 Bacteria 39958
379 Ga0265314_10002745 3300031711 Bacteria 17599
380 Ga0265314_10005236 3300031711 Bacteria 11755
381 Ga0265314_10075441 3300031711 Bacteria 2243
382 Ga0265342_10135332 3300031712 Bacteria 1377
383 Ga0307405_10054866 3300031731 Bacteria 2490
384 Ga0307406_10031996 3300031901 Bacteria 3207
385 Ga0307406_10182882 3300031901 Bacteria 1528
386 Ga0307406_10220325 3300031901 Unclassified 1410
387 Ga0307412_10054712 3300031911 Bacteria 2650
388 Ga0307416_100274392 3300032002 Bacteria 1658
389 Ga0307414_10096307 3300032004 Bacteria 2214
390 Ga0373934_0018997 3300035086 Bacteria 2635
391 Ga0373934_0039861 3300035086 Bacteria 1852
392 Ga0373951_0000898 3300035091 Bacteria 8019
393 Ga0373923_0037861 3300035111 Bacteria 1974
394 Ga0373953_0016524 3300035117 Bacteria 2696
395 Ga0373954_0014269 3300035118 Bacteria 3543
396 Ga0373954_0028919 3300035118 Bacteria 2550
397 Ga0373954_0032434 3300035118 Bacteria 2414
398 Ga0373955_0046335 3300035172 Bacteria 2350
399 Ga0373955_0053265 3300035172 Bacteria 2209
400 Ga0373955_0142081 3300035172 Bacteria 1408
401 Ga0373924_0035004 3300035410 Bacteria 2036
402 Ga0373935_0100661 3300035692 Bacteria 1904
403 Ga0373935_0134972 3300035692 Bacteria 1662
404 Ga0373927_0003004 3300035695 Bacteria 12242
405 Ga0373927_0011587 3300035695 Bacteria 5873
406 Ga0373927_0016577 3300035695 Bacteria 4860
407 Ga0373927_0041065 3300035695 Bacteria 3000
408 Ga0373927_0133537 3300035695 Bacteria 1622
409 Ga0373947_0000400 3300035725 Bacteria 24469
410 Ga0373947_0032881 3300035725 Bacteria 3059
411 Ga0373947_0078770 3300035725 Unclassified 2035
412 Ga0373947_0131194 3300035725 Bacteria 1600
413 Ga0373937_0007280 3300036401 Bacteria 9578
414 Ga0373937_0019972 3300036401 Bacteria 6000
415 Ga0373937_0145970 3300036401 Bacteria 2215
416 Ga0373937_0147946 3300036401 Unclassified 2199
417 Ga0373925_0002373 3300037068 Bacteria 15107
418 Ga0373925_0088436 3300037068 Bacteria 2366
419 Ga0373925_0113117 3300037068 Bacteria 2099
420 Ga0436364_0014106 3300037853 Bacteria 9980
421 Ga0436364_0134857 3300037853 Bacteria 9145
422 Ga0436364_0228674 3300037853 Bacteria 21208
423 Ga0436364_0249540 3300037853 Bacteria 14870
424 Ga0436364_0334927 3300037853 Bacteria 4737
425 Ga0436364_0664274 3300037853 Bacteria 3067
426 Ga0436364_1394527 3300037853 Unclassified 1506
427 Ga0436365_0920056 3300039437 Bacteria 3750
428 Ga0436365_1006026 3300039437 Bacteria 4446
429 Ga0436365_1473770 3300039437 Bacteria 3152
430 Ga0436365_1689565 3300039437 Bacteria 1285
431 Ga0436365_1786451 3300039437 Bacteria 6119
432 Ga0436360_0906455 3300039438 Bacteria 16469
433 Ga0436361_0563692 3300039447 Bacteria 2258
434 Ga0436362_0892206 3300039453 Bacteria 6715
435 Ga0439458_0020633 3300042157 Bacteria 1522
436 Ga0451576_0074572 3300045051 Bacteria 3531
437 Ga0495592_0011626 3300046454 Bacteria 6666
438 Ga0495592_0055828 3300046454 Bacteria 2920
439 Ga0495592_0127309 3300046454 Bacteria 1785
440 Ga0495629_0140596 3300046459 Bacteria 1680
441 Ga0495651_0116071 3300046462 Bacteria 1973
442 Ga0495580_0003716 3300046472 Bacteria 12928
443 Ga0495580_0004230 3300046472 Bacteria 12074
444 Ga0495580_0211368 3300046472 Bacteria 1335
445 Ga0495582_0066794 3300046473 Bacteria 1987
446 Ga0495582_0164171 3300046473 Bacteria 1264
447 Ga0495664_0006026 3300046477 Bacteria 6683
448 Ga0495608_0174466 3300046511 Bacteria 1362
449 Ga0495628_0002968 3300046516 Bacteria 15218
450 Ga0495628_0060952 3300046516 Bacteria 2960
451 Ga0495665_0027644 3300046531 Bacteria 3044
452 Ga0495665_0079787 3300046531 Bacteria 1722
453 Ga0495645_0000916 3300046543 Bacteria 20098
454 Ga0495645_0009649 3300046543 Bacteria 6750
455 Ga0495645_0046484 3300046543 Bacteria 3164
456 Ga0495667_0011457 3300046559 Bacteria 6001
457 Ga0495667_0027050 3300046559 Bacteria 3866
458 Ga0495667_0100973 3300046559 Bacteria 1867
459 Ga0495635_0136398 3300046663 Bacteria 1672
460 Ga0495599_0003826 3300046678 Bacteria 8838
461 Ga0495623_0150097 3300046679 Bacteria 1378
462 Ga0495623_0160035 3300046679 Bacteria 1324
463 Ga0495646_0013469 3300046680 Bacteria 5198
464 Ga0495581_0150740 3300047315 Unclassified 1358
465 Ga0495604_0106488 3300047317 Bacteria 2051
466 Ga0495604_0185464 3300047317 Bacteria 1453
467 Ga0495674_0036685 3300047319 Bacteria 4411
468 Ga0495674_0049276 3300047319 Bacteria 3723
469 Ga0495674_0098392 3300047319 Unclassified 2491
470 Ga0495674_0118678 3300047319 Bacteria 2236
471 Ga0495674_0123336 3300047319 Bacteria 2188
472 Ga0495674_0213082 3300047319 Bacteria 1599
473 Ga0495684_0021554 3300047471 Bacteria 4961
474 Ga0495684_0086770 3300047471 Bacteria 2372
475 Ga0495602_0011355 3300048088 Bacteria 9215
476 Ga0496102_0037982 3300048905 Bacteria 4344
477 Ga0496104_0019778 3300048907 Bacteria 6165
478 Ga0496104_0047165 3300048907 Bacteria 4060
479 Ga0496104_0196422 3300048907 Bacteria 1930
480 Ga0496106_0069286 3300048909 Bacteria 2692
481 Ga0496108_0086892 3300048911 Bacteria 2655
482 Ga0496109_0031919 3300048912 Bacteria 4731
483 Ga0496112_0042226 3300048915 Bacteria 4461
484 Ga0496112_0191250 3300048915 Bacteria 2009
485 Ga0496112_0458881 3300048915 Bacteria 1212
486 Ga0501031_0020229 3300049568 Bacteria 4339
487 Ga0501032_0001362 3300049569 Bacteria 19394
488 Ga0501033_0022462 3300049570 Bacteria 4759
489 Ga0501036_0003624 3300049572 Bacteria 12349
490 Ga0501037_0001371 3300049573 Bacteria 17877
491 Ga0501038_0007946 3300049574 Bacteria 9775
492 Ga0501038_0018223 3300049574 Bacteria 6337
493 Ga0501039_0044857 3300049575 Bacteria 3415
494 Ga0501043_0004619 3300049579 Bacteria 11164
495 Ga0501046_0001140 3300049580 Bacteria 25891
496 Ga0501068_0002735 3300049584 Bacteria 9371
497 Ga0501069_0000135 3300049585 Bacteria 32299
498 Ga0501070_0004226 3300049586 Bacteria 12349
499 Ga0501072_0001379 3300049588 Bacteria 18248
500 Ga0501073_0001638 3300049589 Bacteria 16604
501 Ga0501074_0000835 3300049590 Bacteria 19579
502 Ga0501076_0056345 3300049592 Bacteria 3119
503 Ga0501077_0021108 3300049593 Bacteria 4120
504 Ga0501216_005724 3300049660 Bacteria 1883
505 Ga0501217_012341 3300049661 Bacteria 1902
506 Ga0501223_001670 3300049663 Bacteria 5094
507 Ga0501079_0005814 3300049741 Bacteria 9223
508 Ga0501080_0000101 3300049742 Bacteria 58881
509 Ga0501283_000325 3300049779 Bacteria 6309
510 Ga0501035_0027391 3300049822 Bacteria 5209
511 nmdc:mga03683_17375_c1 3300050489 Bacteria 2722
512 nmdc:mga03n38_430_c1 3300050490 Bacteria 10448
513 nmdc:mga00v17_127721_c1 3300050491 Bacteria 1623
514 nmdc:mga00v17_1445_c2 3300050491 Bacteria 10448
515 nmdc:mga00v17_1936_c1 3300050491 Bacteria 10705
516 nmdc:mga00v17_69_c1 3300050491 Bacteria 62156
517 nmdc:mga0yw44_107_c1 3300050492 Bacteria 29094
518 nmdc:mga0yw44_6475_c1 3300050492 Bacteria 5665
519 nmdc:mga06z11_5683_c1 3300050494 Bacteria 5023
520 nmdc:mga06z11_808_c1 3300050494 Bacteria 11440
521 nmdc:mga07m45_27_c1 3300050496 Bacteria 91154
522 nmdc:mga05p37_115117_c1 3300050507 Bacteria 3305
523 nmdc:mga09592_104835_c1 3300050508 Bacteria 2424
524 nmdc:mga09592_2716_c1 3300050508 Bacteria 14301
525 nmdc:mga0qj67_13451_c1 3300050509 Bacteria 6172
526 nmdc:mga0qj67_263446_c1 3300050509 Bacteria 1398
527 nmdc:mga0qj67_59373_c1 3300050509 Bacteria 3033
528 nmdc:mga08y16_13835_c1 3300050511 Bacteria 8493
529 nmdc:mga08y16_188097_c1 3300050511 Bacteria 2142
530 nmdc:mga0n895_89055_c1 3300050512 Unclassified 3087
531 nmdc:mga0rr50_8864_c1 3300050513 Bacteria 6283
532 nmdc:mga08x19_1203_c1 3300050514 Bacteria 16167
533 nmdc:mga08x19_89806_c1 3300050514 Bacteria 2027
534 nmdc:mga0a205_106821_c1 3300050515 Bacteria 2697
535 nmdc:mga0a205_72336_c1 3300050515 Bacteria 3331
536 nmdc:mga0a205_88175_c1 3300050515 Unclassified 2998
537 nmdc:mga0sz30_18_c2 3300050516 Bacteria 68595
538 Ga0495601_0026294 3300053077 Bacteria 3593
539 Ga0495619_0058143 3300053085 Bacteria 2566
540 Ga0500568_0000349 3300053139 Bacteria 35838
541 Ga0501084_0000244 3300054114 Bacteria 41061
542 Ga0501082_0000149 3300060353 Bacteria 58834
543 Ga0530510_0049310 3300061734 Bacteria 3043
544 Ga0068864_100040419
545 CNAas_1000040
546 JGI24751J29686_10000030
547 JGI25406J46586_10004412
548 Ga0065714_10064504
549 Ga0065712_10007288
550 Ga0065712_10015493
551 Ga0065712_10067766
552 Ga0065715_10089158
553 Ga0070676_10009459
554 Ga0070683_100000782
555 Ga0070683_100033711
556 Ga0070683_100260024
557 Ga0070683_100271933
558 Ga0070690_100029080
559 Ga0070670_100002791
560 Ga0070670_100129551
561 Ga0070670_100195300
562 Ga0068869_100031649
563 Ga0068869_100221871
564 Ga0070680_100000906
565 Ga0070680_100002278
566 Ga0070680_100188871
567 Ga0068868_100039981
568 Ga0068868_100063212
569 Ga0068868_100189998
570 Ga0070660_100110462
571 Ga0070689_100006471
572 Ga0070689_100059585
573 Ga0070692_10074309
574 Ga0070675_100157604
575 Ga0070673_100134851
576 Ga0070673_100225285
577 Ga0070659_100004306
578 Ga0070667_100208881
579 Ga0070714_100004206
580 Ga0070714_100014598
581 Ga0070713_100001935
582 Ga0070713_100033262
583 Ga0070713_100262500
584 Ga0070711_100023210
585 Ga0070711_100048099
586 Ga0070700_100000719
587 Ga0070694_100008855
588 Ga0070694_100131549
589 Ga0070708_100000288
590 Ga0070663_100081643
591 Ga0070681_10007327
592 Ga0070681_10007744
593 Ga0070681_10051872
594 Ga0070681_10287069
595 Ga0070706_100000125
596 Ga0070706_100002798
597 Ga0070706_100198172
598 Ga0070707_100003600
599 Ga0070707_100007466
600 Ga0070707_100269503
601 Ga0070707_100343404
602 Ga0070698_100005037
603 Ga0070698_100006865
604 Ga0070698_100026885
605 Ga0070699_100000880
606 Ga0070699_100094221
607 Ga0070679_100077077
608 Ga0070679_100081171
609 Ga0070684_100000004
610 Ga0070684_100018692
611 Ga0070684_100138444
612 Ga0070697_100108356
613 Ga0068853_100054585
614 Ga0070672_100016594
615 Ga0070672_100033246
616 Ga0070686_100022101
617 Ga0070696_100001812
618 Ga0070696_100148651
619 Ga0070693_100054472
620 Ga0070665_100096315
621 Ga0070704_100000897
622 Ga0068855_100007695
623 Ga0068855_100018074
624 Ga0068855_100021336
625 Ga0068855_100107352
626 Ga0068855_100141525
627 Ga0070664_100047571
628 Ga0070664_100075926
629 Ga0068856_100004681
630 Ga0068856_100039174
631 Ga0068856_100056752
632 Ga0068856_100367001
633 Ga0068856_100423527
634 Ga0070702_100010971
635 Ga0070702_100038951
636 Ga0068859_100009084
637 Ga0068859_100022162
638 Ga0068859_100054415
639 Ga0068859_100059991
640 Ga0068859_100072850
641 Ga0068864_100012799
642 Ga0068864_100016856
643 Ga0068864_100024814
644 Ga0068864_100036952
645 Ga0068864_100045644
646 Ga0068866_10114216
647 Ga0068861_100047932
648 Ga0068861_100125700
649 Ga0068851_10010828
650 Ga0068863_100077675
651 Ga0068858_100015305
652 Ga0068858_100070213
653 Ga0068858_100360199
654 Ga0068860_100019352
655 Ga0068860_100089275
656 Ga0081455_10032863
657 Ga0081538_10007618
658 Ga0081538_10021911
659 Ga0081538_10034673
660 Ga0081539_10006601
661 Ga0070717_10029849
662 Ga0070717_10196318
663 Ga0075365_10000131
664 Ga0075365_10012716
665 Ga0075363_100014550
666 Ga0075364_10000706
667 Ga0075364_10001601
668 Ga0075364_10026996
669 Ga0075364_10208196
670 Ga0075362_10052795
671 Ga0075367_10002737
672 Ga0075369_10001648
673 Ga0075427_10000404
674 Ga0097621_100090191
675 Ga0075370_10000232
676 Ga0068871_100004539
677 Ga0068871_100006668
678 Ga0068871_100098014
679 Ga0075428_100009001
680 Ga0075428_100103241
681 Ga0075428_100178367
682 Ga0075430_100076170
683 Ga0075431_100207480
684 Ga0075431_100299919
685 Ga0075433_10045889
686 Ga0075433_10313912
687 Ga0075434_100019404
688 Ga0075434_100035585
689 Ga0075434_100173547
690 Ga0075429_100003016
691 Ga0075429_100041444
692 Ga0075436_100016731
693 Ga0075436_100080015
694 Ga0097620_100009084
695 Ga0097620_100022163
696 Ga0097620_100054415
697 Ga0097620_100059986
698 Ga0097620_100072856
699 Ga0075435_100000569
700 Ga0105240_10000167
701 Ga0105240_10001386
702 Ga0105240_10001428
703 Ga0105240_10001660
704 Ga0105240_10011426
705 Ga0105240_10137155
706 Ga0105240_10158004
707 Ga0105240_10293426
708 Ga0111539_10078972
709 Ga0105245_10002831
710 Ga0105245_10032874
711 Ga0105245_10204841
712 Ga0105247_10001044
713 Ga0105247_10106465
714 Ga0114129_10021586
715 Ga0114129_10033645
716 Ga0114129_10578413
717 Ga0114129_10605711
718 Ga0105243_10000474
719 Ga0105243_10025565
720 Ga0105241_10022194
721 Ga0105241_10221177
722 Ga0105241_10245040
723 Ga0105242_10005047
724 Ga0105242_10015883
725 Ga0105242_10154263
726 Ga0105242_10209748
727 Ga0105248_10007483
728 Ga0105248_10008842
729 Ga0105248_10023062
730 Ga0105248_10028561
731 Ga0105248_10069702
732 Ga0105248_10099217
733 Ga0105248_10103613
734 Ga0105248_10174288
735 Ga0105248_10222334
736 Ga0105237_10000829
737 Ga0105237_10012727
738 Ga0105237_10016752
739 Ga0105237_10063758
740 Ga0105238_10012864
741 Ga0105238_10017522
742 Ga0105238_10065839
743 Ga0105238_10262421
744 Ga0105249_10042107
745 Ga0105239_10060038
746 Ga0105239_10115797
747 Ga0105239_10246599
748 Ga0105246_10155413
749 Ga0157373_10044616
750 Ga0157373_10145533
751 Ga0157370_10002862
752 Ga0157370_10003363
753 Ga0157370_10006287
754 Ga0157369_10003673
755 Ga0157369_10007008
756 Ga0157369_10253444
757 Ga0157369_10359119
758 Ga0157374_10020037
759 Ga0157374_10079474
760 Ga0157378_10000048
761 Ga0157378_10113691
762 Ga0157378_10285054
763 Ga0157378_10495468
764 Ga0163162_10001226
765 Ga0163162_10051608
766 Ga0157372_10008271
767 Ga0157372_10009953
768 Ga0157372_10020556
769 Ga0157372_10061979
770 Ga0157372_10436681
771 Ga0157375_10006519
772 Ga0157375_10016090
773 Ga0157375_10092066
774 Ga0157375_10181807
775 Ga0157375_10283018
776 Ga0163163_10000156
777 Ga0163163_10001640
778 Ga0163163_10012445
779 Ga0163163_10055468
780 Ga0163163_10074422
781 Ga0163163_10086733
782 Ga0163163_10110398
783 Ga0163163_10118636
784 Ga0163163_10159202
785 Ga0163163_10199489
786 Ga0157380_10338839
787 Ga0157379_10115066
788 Ga0157376_10041415
789 Ga0157376_10070740
790 Ga0157376_10337230
791 Ga0213876_10033944
792 Ga0213875_10003665
793 Ga0213875_10017491
794 Ga0213875_10036350
795 Ga0213875_10049995
796 Ga0213871_10000014
797 Ga0207697_10012891
798 Ga0207656_10005843
799 Ga0207642_10025243
800 Ga0207710_10002769
801 Ga0207688_10084682
802 Ga0207643_10099183
803 Ga0207643_10110418
804 Ga0207684_10000130
805 Ga0207654_10002715
806 Ga0207654_10150104
807 Ga0207707_10007109
808 Ga0207707_10009246
809 Ga0207707_10164853
810 Ga0207695_10000735
811 Ga0207695_10003343
812 Ga0207695_10004632
813 Ga0207695_10017603
814 Ga0207695_10266307
815 Ga0207695_10272370
816 Ga0207671_10011368
817 Ga0207671_10028990
818 Ga0207663_10032914
819 Ga0207660_10006402
820 Ga0207657_10079238
821 Ga0207652_10043700
822 Ga0207646_10004920
823 Ga0207646_10076346
824 Ga0207681_10014247
825 Ga0207681_10111353
826 Ga0207694_10010833
827 Ga0207694_10093532
828 Ga0207694_10119397
829 Ga0207650_10000010
830 Ga0207650_10251584
831 Ga0207659_10091918
832 Ga0207687_10001155
833 Ga0207687_10019742
834 Ga0207687_10318592
835 Ga0207700_10002092
836 Ga0207700_10045360
837 Ga0207686_10006948
838 Ga0207686_10009804
839 Ga0207686_10010553
840 Ga0207686_10016548
841 Ga0207686_10053520
842 Ga0207686_10157152
843 Ga0207709_10029126
844 Ga0207670_10004103
845 Ga0207704_10090651
846 Ga0207691_10013743
847 Ga0207691_10078508
848 Ga0207711_10008004
849 Ga0207711_10015006
850 Ga0207711_10018972
851 Ga0207711_10036430
852 Ga0207711_10077141
853 Ga0207711_10256802
854 Ga0207711_10347458
855 Ga0207689_10014510
856 Ga0207689_10027470
857 Ga0207661_10000055
858 Ga0207661_10003574
859 Ga0207661_10025265
860 Ga0207661_10217742
861 Ga0207679_10060131
862 Ga0207667_10008109
863 Ga0207667_10020982
864 Ga0207667_10031888
865 Ga0207667_10037561
866 Ga0207667_10207542
867 Ga0207651_10000958
868 Ga0207712_10058160
869 Ga0207640_10124404
870 Ga0207658_10036943
871 Ga0207658_10139318
872 Ga0207658_10255876
873 Ga0207677_10119503
874 Ga0207703_10050255
875 Ga0207703_10096192
876 Ga0207703_10115430
877 Ga0207703_10148083
878 Ga0207703_10267996
879 Ga0207639_10041861
880 Ga0207678_10146740
881 Ga0207708_10001694
882 Ga0207702_10016738
883 Ga0207702_10021680
884 Ga0207702_10093190
885 Ga0207641_10052455
886 Ga0207641_10199549
887 Ga0207648_10114592
888 Ga0207676_10019146
889 Ga0207676_10019238
890 Ga0207676_10024955
891 Ga0207676_10045205
892 Ga0207676_10074544
893 Ga0207676_10138959
894 Ga0207674_10002399
895 Ga0207674_10012887
896 Ga0207675_100012425
897 Ga0207675_100094306
898 Ga0207675_100141622
899 Ga0207698_10040434
900 Ga0207698_10172799
901 Ga0268266_10286879
902 Ga0268264_10110084
903 Ga0268264_10144356
904 Ga0265323_10002678
905 Ga0265330_10025425
906 Ga0265328_10028138
907 Ga0265320_10000588
908 Ga0265325_10009463
909 Ga0265329_10011967
910 Ga0265329_10022277
911 Ga0265331_10002043
912 Ga0265331_10011289
913 Ga0265316_10001444
914 Ga0265316_10007310
915 Ga0265316_10027880
916 Ga0265316_10040714
917 Ga0265316_10050083
918 Ga0265316_10052849
919 Ga0265316_10067696
920 Ga0307408_100111679
921 Ga0265314_10000722
922 Ga0265314_10002745
923 Ga0265314_10005236
924 Ga0265314_10075441
925 Ga0265342_10135332
926 Ga0307405_10054866
927 Ga0307406_10031996
928 Ga0307406_10182882
929 Ga0307406_10220325
930 Ga0307412_10054712
931 Ga0307416_100274392
932 Ga0307414_10096307
933 Ga0373934_0018997
934 Ga0373934_0039861
935 Ga0373951_0000898
936 Ga0373923_0037861
937 Ga0373953_0016524
938 Ga0373954_0014269
939 Ga0373954_0028919
940 Ga0373954_0032434
941 Ga0373955_0046335
942 Ga0373955_0053265
943 Ga0373955_0142081
944 Ga0373924_0035004
945 Ga0373935_0100661
946 Ga0373935_0134972
947 Ga0373927_0003004
948 Ga0373927_0011587
949 Ga0373927_0016577
950 Ga0373927_0041065
951 Ga0373927_0133537
952 Ga0373947_0000400
953 Ga0373947_0032881
954 Ga0373947_0078770
955 Ga0373947_0131194
956 Ga0373937_0007280
957 Ga0373937_0019972
958 Ga0373937_0145970
959 Ga0373937_0147946
960 Ga0373925_0002373
961 Ga0373925_0088436
962 Ga0373925_0113117
963 Ga0436364_0014106
964 Ga0436364_0134857
965 Ga0436364_0228674
966 Ga0436364_0249540
967 Ga0436364_0334927
968 Ga0436364_0664274
969 Ga0436364_1394527
970 Ga0436365_0920056
971 Ga0436365_1006026
972 Ga0436365_1473770
973 Ga0436365_1689565
974 Ga0436365_1786451
975 Ga0436360_0906455
976 Ga0436361_0563692
977 Ga0436362_0892206
978 Ga0439458_0020633
979 Ga0451576_0074572
980 Ga0495592_0011626
981 Ga0495592_0055828
982 Ga0495592_0127309
983 Ga0495629_0140596
984 Ga0495651_0116071
985 Ga0495580_0003716
986 Ga0495580_0004230
987 Ga0495580_0211368
988 Ga0495582_0066794
989 Ga0495582_0164171
990 Ga0495664_0006026
991 Ga0495608_0174466
992 Ga0495628_0002968
993 Ga0495628_0060952
994 Ga0495665_0027644
995 Ga0495665_0079787
996 Ga0495645_0000916
997 Ga0495645_0009649
998 Ga0495645_0046484
999 Ga0495667_0011457
1000 Ga0495667_0027050
1001 Ga0495667_0100973
1002 Ga0495635_0136398
1003 Ga0495599_0003826
1004 Ga0495623_0150097
1005 Ga0495623_0160035
1006 Ga0495646_0013469
1007 Ga0495581_0150740
1008 Ga0495604_0106488
1009 Ga0495604_0185464
1010 Ga0495674_0036685
1011 Ga0495674_0049276
1012 Ga0495674_0098392
1013 Ga0495674_0118678
1014 Ga0495674_0123336
1015 Ga0495674_0213082
1016 Ga0495684_0021554
1017 Ga0495684_0086770
1018 Ga0495602_0011355
1019 Ga0496102_0037982
1020 Ga0496104_0019778
1021 Ga0496104_0047165
1022 Ga0496104_0196422
1023 Ga0496106_0069286
1024 Ga0496108_0086892
1025 Ga0496109_0031919
1026 Ga0496112_0042226
1027 Ga0496112_0191250
1028 Ga0496112_0458881
1029 Ga0501031_0020229
1030 Ga0501032_0001362
1031 Ga0501033_0022462
1032 Ga0501036_0003624
1033 Ga0501037_0001371
1034 Ga0501038_0007946
1035 Ga0501038_0018223
1036 Ga0501039_0044857
1037 Ga0501043_0004619
1038 Ga0501046_0001140
1039 Ga0501068_0002735
1040 Ga0501069_0000135
1041 Ga0501070_0004226
1042 Ga0501072_0001379
1043 Ga0501073_0001638
1044 Ga0501074_0000835
1045 Ga0501076_0056345
1046 Ga0501077_0021108
1047 Ga0501216_005724
1048 Ga0501217_012341
1049 Ga0501223_001670
1050 Ga0501079_0005814
1051 Ga0501080_0000101
1052 Ga0501283_000325
1053 Ga0501035_0027391
1054 nmdc:mga03683_17375_c1
1055 nmdc:mga03n38_430_c1
1056 nmdc:mga00v17_127721_c1
1057 nmdc:mga00v17_1445_c2
1058 nmdc:mga00v17_1936_c1
1059 nmdc:mga00v17_69_c1
1060 nmdc:mga0yw44_107_c1
1061 nmdc:mga0yw44_6475_c1
1062 nmdc:mga06z11_5683_c1
1063 nmdc:mga06z11_808_c1
1064 nmdc:mga07m45_27_c1
1065 nmdc:mga05p37_115117_c1
1066 nmdc:mga09592_104835_c1
1067 nmdc:mga09592_2716_c1
1068 nmdc:mga0qj67_13451_c1
1069 nmdc:mga0qj67_263446_c1
1070 nmdc:mga0qj67_59373_c1
1071 nmdc:mga08y16_13835_c1
1072 nmdc:mga08y16_188097_c1
1073 nmdc:mga0n895_89055_c1
1074 nmdc:mga0rr50_8864_c1
1075 nmdc:mga08x19_1203_c1
1076 nmdc:mga08x19_89806_c1
1077 nmdc:mga0a205_106821_c1
1078 nmdc:mga0a205_72336_c1
1079 nmdc:mga0a205_88175_c1
1080 nmdc:mga0sz30_18_c2
1081 Ga0495601_0026294
1082 Ga0495619_0058143
1083 Ga0500568_0000349
1084 Ga0501084_0000244
1085 Ga0501082_0000149
1086 Ga0530510_0049310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00162

PGK

Phosphoglycerate kinase

50

418

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9761 1 402
3uwd-assembly1.cif.gz_A crystal structure of phosphoglycerate kinase from bacillus anthracis 0.9756 1 402
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9737 1 402
3uwd-assembly1.cif.gz_A crystal structure of phosphoglycerate kinase from bacillus anthracis 0.9732 1 402
1v6s-assembly2.cif.gz_B crystal structure of phosphoglycerate kinase from thermus thermophilus hb8 0.9706 4 399
ID Description Score Start End Superfamily
3q3vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9652 179 388 3.40.50.1260
af_A0A0P0V994_190_315_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9622 185 314 3.40.50.1260
af_P0A799_178_379_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9578 184 396 3.30.200.20
af_E9AGU0_8_189_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9559 5 171 3.40.50.1260
af_A0A1D6FSN1_1_174_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9546 223 400 3.40.50.1260
ID Description Score Start End GO Terms
AF-A0A5C8MQH9-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9853 1 265 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A7C5UQJ2-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9843 75 401 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-X1N9S6-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9837 77 337 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A059LCB8-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9825 49 255 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A382Y1K5-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9824 3 177 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531

Map