F461554

General Info

Members Datasets Scaffolds Average Seq Length
542 501 1084 358

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_111022_c1|nmdc:mga0rr50_111022_c1_861_1934
Length 357
Sequence MIMRKSELNRRARLRVGRRTMLAGMAALAGTTVLGFPAIRVRAAQTLKVGTYGGYFKDSFDQHIYPDFTKETGIEVESIAEPTGEAWLVQLDQAARGGVAPADISMMAQVTRLKGQSAKLWAPLDESKLPNTKNLYDHFVARYDDQKIAALGAVSWYITLVTNTKVYPTPPNSWKELWNPANKGKIGLLALASNSFLLEITSKTWFGGTDLLGSQEGIEKALAKLAEVKPNVALWYRDEGQFQHDVTGLAASQGQPVRSTFPQEGGVLDSGSWCVSKASKALDEAHAFINYMCRPDIQAKLSRNVGTAPTVKRELLDLNPKEFAAVASDIPPIIPRYDLYATRDDWLNQKWTELIAG

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
27 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
30 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
31 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
32 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
33 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
34 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
50 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
60 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
61 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
67 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
70 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
101 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
128 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
129 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
130 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
138 2509276019 Ensifer aridi TW10 Isolate Nodule
139 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
140 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
141 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
142 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
143 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
144 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
145 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
146 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
147 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
148 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
149 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
150 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
151 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
152 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
153 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
154 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
155 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
156 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
157 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
158 2516143018 Ensifer sp. BR816 Isolate Nodule
159 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
160 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
161 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
162 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
163 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
164 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
165 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
166 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
167 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
168 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
169 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
170 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
171 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
172 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
173 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
174 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
175 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
176 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
177 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
178 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
179 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
180 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
181 2643221557 Ensifer sp. Root558 Isolate Unclassified
182 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
183 2643221607 Rhizobium sp. Root73 Isolate Unclassified
184 2643221610 Ensifer sp. Root74 Isolate Unclassified
185 2643221618 Ensifer sp. Root231 Isolate Unclassified
186 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
187 2643221626 Ensifer sp. Root31 Isolate Unclassified
188 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
189 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
190 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
191 2643221655 Ensifer sp. Root1252 Isolate Unclassified
192 2643221659 Ensifer sp. Root127 Isolate Unclassified
193 2643221668 Ensifer sp. Root423 Isolate Unclassified
194 2643221675 Ensifer sp. Root1298 Isolate Unclassified
195 2643221680 Ensifer sp. Root1312 Isolate Unclassified
196 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
197 2643221688 Rhizobium sp. Root482 Isolate Unclassified
198 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
199 2643221698 Ensifer sp. Root142 Isolate Unclassified
200 2643221712 Ensifer sp. Root258 Isolate Unclassified
201 2643221718 Rhizobium sp. Root268 Isolate Unclassified
202 2643221719 Rhizobium sp. Root274 Isolate Unclassified
203 2643221723 Ensifer sp. Root278 Isolate Unclassified
204 2643221726 Ensifer sp. Root954 Isolate Unclassified
205 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
206 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
207 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
208 2738543024 Aminobacter sp. AP02 Isolate Unclassified
209 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
210 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
211 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
212 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
213 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
214 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
215 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
216 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
217 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
218 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
219 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
220 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
221 2791355260 Rhizobium sp. L9 Isolate Nodule
222 2791355264 Rhizobium sp. S9 Isolate Nodule
223 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
224 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
225 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
226 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
227 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
228 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
229 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
230 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
231 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
232 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
233 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
234 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
235 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
236 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
237 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
238 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
239 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
240 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
241 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
242 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
243 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
244 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
245 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
246 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
247 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
248 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
249 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
250 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
251 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
252 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
253 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
254 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
255 2844163670 Ensifer sp. 1H6 Isolate Unclassified
256 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
257 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
258 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
259 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
260 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
261 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
262 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
263 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
264 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
265 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
266 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
267 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
268 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
269 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
270 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
271 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
272 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
273 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
274 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
275 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
276 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
277 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
278 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
279 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
280 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
281 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
282 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
283 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
284 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
285 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
286 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
287 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
288 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
289 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
290 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
291 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
292 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
293 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
294 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
295 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
296 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
297 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
298 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
299 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
300 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
301 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
302 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
303 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
304 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
305 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
306 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
307 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
308 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
309 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
310 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
311 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
312 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
313 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
314 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
315 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
316 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
317 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
318 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
319 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
320 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
321 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
322 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
323 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
324 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
325 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
326 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
327 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
328 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
329 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
330 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
331 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
332 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
333 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
334 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
335 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
336 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
337 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
338 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
339 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
340 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
341 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
342 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
343 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
344 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
345 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
346 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
347 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
348 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
349 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
350 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
351 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
352 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
353 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
354 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
355 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
356 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
357 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
358 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
359 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
360 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
361 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
362 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
363 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
364 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
365 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
366 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
367 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
368 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
369 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
370 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
371 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
372 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
373 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
374 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
375 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
376 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
377 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
378 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
379 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
380 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
381 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
382 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
383 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
384 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
385 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
386 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
387 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
388 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
389 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
390 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
391 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
392 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
393 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
394 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
395 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
396 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
397 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
398 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
399 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
400 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
401 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
402 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
403 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
404 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
405 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
406 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
407 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
408 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
409 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
410 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
411 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
412 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
413 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
414 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
415 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
416 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
417 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
418 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
419 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
420 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
421 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
422 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
423 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
424 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
425 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
426 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
427 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
428 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
429 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
430 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
431 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
432 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
433 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
434 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
435 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
436 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
437 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
438 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
439 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
440 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
441 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
442 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
443 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
444 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
445 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
446 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
447 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
448 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
449 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
450 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
451 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
452 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
453 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
454 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
455 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
456 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
457 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
458 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
459 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
460 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
461 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
462 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
463 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
464 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
465 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
466 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
467 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
468 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
469 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
470 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
471 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
472 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
473 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
474 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
475 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
476 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
477 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
478 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
479 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
480 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
481 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
482 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
483 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
484 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
485 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
486 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
487 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
488 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
489 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
490 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
491 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
492 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
493 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
494 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
495 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
496 8024501048 Rhizobium sp. H4 Isolate Nodule
497 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
498 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
499 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
500 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
501 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 31.73
Metatranscriptomes 0.37
Isolates 67.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 54.06
Rhizoplane 1.48
Rhizosphere 19.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_111022_c1 3300050513 Bacteria 2169
2 JGI25159J45721_1000008 3300002987 Bacteria 172667
3 JGI25151J46595_10003122 3300003187 Bacteria 9317
4 JGI25151J46595_10017394 3300003187 Bacteria 3119
5 JGI25160J50197_1000033 3300003354 Bacteria 172667
6 JGI25161J50226_1001629 3300003374 Bacteria 6503
7 Ga0055526_1010424 3300003771 Bacteria 4325
8 Ga0055536_1002310 3300003781 Bacteria 10795
9 Ga0055530_10026263 3300003791 Bacteria 1613
10 Ga0055531_10003421 3300003794 Bacteria 10129
11 Ga0055543_1000026 3300004625 Bacteria 136177
12 Ga0065165_1000513 3300005262 Bacteria 59506
13 Ga0065704_10131113 3300005289 Bacteria 1627
14 Ga0070689_100195145 3300005340 Bacteria 1650
15 Ga0070663_100085726 3300005455 Bacteria 2325
16 Ga0070665_100009630 3300005548 Bacteria 9772
17 Ga0070702_100209085 3300005615 Bacteria 1297
18 Ga0081455_10032972 3300005937 Bacteria 4660
19 Ga0081538_10020532 3300005981 Bacteria 4855
20 Ga0081540_1002570 3300005983 Bacteria 14730
21 Ga0075364_10070331 3300006051 Bacteria 2304
22 Ga0075433_10098307 3300006852 Bacteria 2591
23 Ga0079104_1029042 3300006946 Bacteria 1397
24 Ga0114129_10202362 3300009147 Bacteria 2689
25 Ga0105239_10499238 3300010375 Bacteria 1383
26 Ga0157373_10067011 3300013100 Bacteria 2539
27 Ga0157373_10158817 3300013100 Bacteria 1591
28 Ga0171463_1007 3300013249 Bacteria 301198
29 Ga0183363_1058 3300015690 Bacteria 33958
30 Ga0163161_10321003 3300017792 Bacteria 1224
31 Ga0214544_1000010 3300021320 Bacteria 270164
32 Ga0214542_1000023 3300021321 Bacteria 191557
33 Ga0214542_1032369 3300021321 Bacteria 1855
34 Ga0214543_1000019 3300021327 Bacteria 267908
35 Ga0214543_1001578 3300021327 Bacteria 44277
36 Ga0228711_1000017 3300022739 Bacteria 121084
37 Ga0228710_1000005 3300022740 Bacteria 233531
38 Ga0209436_100593 3300025208 Bacteria 15488
39 Ga0209130_1000017 3300025284 Bacteria 388431
40 Ga0209676_1000100 3300025292 Bacteria 229621
41 Ga0209676_1016804 3300025292 Bacteria 2622
42 Ga0209025_1000121 3300025294 Bacteria 208700
43 Ga0209025_1000153 3300025294 Bacteria 170548
44 Ga0209564_1000372 3300025295 Bacteria 83053
45 Ga0209758_1000203 3300025297 Bacteria 132184
46 Ga0209758_1013780 3300025297 Bacteria 4371
47 Ga0209758_1020283 3300025297 Bacteria 3153
48 Ga0209256_1000401 3300025299 Bacteria 68618
49 Ga0209256_1000735 3300025299 Bacteria 43205
50 Ga0207426_1000006 3300025302 Bacteria 1025969
51 Ga0209051_1001964 3300025303 Bacteria 15813
52 Ga0209257_1001793 3300025304 Bacteria 23611
53 Ga0209257_1007978 3300025304 Bacteria 6190
54 Ga0207645_10097504 3300025907 Bacteria 1894
55 Ga0207670_10143039 3300025936 Bacteria 1765
56 Ga0207678_10091031 3300026067 Bacteria 2607
57 Ga0207648_10364434 3300026089 Bacteria 1304
58 Ga0207675_100408928 3300026118 Bacteria 1338
59 Ga0207675_100463134 3300026118 Bacteria 1258
60 Ga0209281_1000082 3300027111 Bacteria 257684
61 Ga0209281_1000484 3300027111 Bacteria 55133
62 Ga0209282_1000006 3300027666 Bacteria 276998
63 Ga0268266_10006032 3300028379 Bacteria 11173
64 Ga0307515_10000017 3300028794 Bacteria 550465
65 Ga0307515_10006276 3300028794 Bacteria 23849
66 Ga0307513_10008934 3300031456 Bacteria 12738
67 Ga0307408_100129437 3300031548 Bacteria 1967
68 Ga0307408_100439665 3300031548 Bacteria 1129
69 Ga0316578_10109046 3300031728 Bacteria 1662
70 Ga0316577_10066367 3300031733 Bacteria 2015
71 Ga0315914_1000003 3300031967 Bacteria 314370
72 Ga0307414_10234649 3300032004 Bacteria 1515
73 Ga0315913_1000001 3300033430 Bacteria 284459
74 Ga0315915_1000008 3300033464 Bacteria 258517
75 Ga0316592_1031005 3300033524 Bacteria 1163
76 Ga0316574_0093568 3300035398 Bacteria 1919
77 Ga0316582_0085509 3300036647 Bacteria 2067
78 Ga0400483_083489 3300039062 Bacteria 3168
79 Ga0439436_0022785 3300041404 Bacteria 1854
80 Ga0439447_030074 3300041407 Bacteria 1371
81 Ga0439465_0003329 3300041413 Bacteria 5248
82 Ga0439465_0013227 3300041413 Bacteria 2577
83 Ga0439465_0029506 3300041413 Bacteria 1742
84 Ga0439449_0022731 3300042007 Bacteria 2348
85 Ga0450906_000790 3300042145 Bacteria 6917
86 Ga0450918_009503 3300042531 Bacteria 1704
87 Ga0495638_0000084 3300046460 Bacteria 153168
88 Ga0495605_0001482 3300046474 Bacteria 15305
89 Ga0495585_0007328 3300046492 Bacteria 6763
90 Ga0495606_0018227 3300046507 Bacteria 5273
91 Ga0495616_0048858 3300046513 Bacteria 2123
92 Ga0495620_0024749 3300046515 Bacteria 2851
93 Ga0495620_0098667 3300046515 Bacteria 1166
94 Ga0495631_0001485 3300046518 Bacteria 14214
95 Ga0495632_0045710 3300046519 Bacteria 2180
96 Ga0495648_0045433 3300046524 Bacteria 2732
97 Ga0495668_0008288 3300046616 Bacteria 6510
98 Ga0495611_0007619 3300046648 Bacteria 4595
99 Ga0495625_0002952 3300046660 Bacteria 17721
100 Ga0495672_0043343 3300047320 Bacteria 2706
101 Ga0495687_011197 3300047443 Bacteria 4841
102 Ga0495686_0050750 3300047472 Bacteria 2606
103 Ga0496101_0233664 3300048904 Bacteria 1430
104 Ga0496102_0059576 3300048905 Bacteria 3491
105 Ga0496103_0179448 3300048906 Bacteria 1361
106 Ga0496106_0149604 3300048909 Bacteria 1841
107 Ga0496108_0078024 3300048911 Bacteria 2803
108 Ga0496117_0003370 3300048920 Bacteria 18618
109 Ga0496117_0054638 3300048920 Bacteria 2796
110 Ga0496119_0102602 3300048922 Bacteria 1603
111 Ga0496120_0042145 3300048923 Bacteria 2667
112 Ga0496120_0043272 3300048923 Bacteria 2625
113 Ga0496121_0000003 3300048924 Bacteria 1191431
114 Ga0496121_0254482 3300048924 Bacteria 1216
115 Ga0496122_0000778 3300048925 Bacteria 61337
116 Ga0496122_0018240 3300048925 Bacteria 6498
117 Ga0496122_0060176 3300048925 Bacteria 2799
118 Ga0496123_0000018 3300048926 Bacteria 404553
119 Ga0496124_0001346 3300048927 Bacteria 36835
120 Ga0496124_0003732 3300048927 Bacteria 18370
121 Ga0496124_0005103 3300048927 Bacteria 14953
122 Ga0496125_0000161 3300048928 Bacteria 150707
123 Ga0496125_0000200 3300048928 Bacteria 126369
124 Ga0496126_0000212 3300048929 Bacteria 128871
125 Ga0496126_0064901 3300048929 Bacteria 3269
126 Ga0495678_037899 3300049459 Bacteria 1955
127 Ga0501318_007014 3300049534 Bacteria 1165
128 Ga0501033_0010396 3300049570 Bacteria 7136
129 Ga0501034_0280387 3300049571 Bacteria 1606
130 Ga0501036_0300161 3300049572 Bacteria 1343
131 Ga0501037_0063398 3300049573 Bacteria 2694
132 Ga0501038_0032435 3300049574 Bacteria 4609
133 Ga0501039_0030504 3300049575 Bacteria 4157
134 Ga0501042_0072564 3300049578 Bacteria 2463
135 Ga0501043_0027497 3300049579 Bacteria 4464
136 Ga0501046_0012466 3300049580 Bacteria 7236
137 Ga0501048_0006065 3300049582 Bacteria 9203
138 Ga0501067_0079688 3300049583 Bacteria 1815
139 Ga0501069_0022239 3300049585 Bacteria 3447
140 Ga0501070_0023869 3300049586 Bacteria 5125
141 Ga0501072_0123383 3300049588 Bacteria 2064
142 Ga0501072_0137749 3300049588 Bacteria 1946
143 Ga0501074_0013053 3300049590 Bacteria 6039
144 Ga0501076_0086845 3300049592 Bacteria 2514
145 Ga0501080_0015522 3300049742 Bacteria 7023
146 Ga0501080_0129810 3300049742 Bacteria 2333
147 Ga0501083_0152919 3300049744 Bacteria 1511
148 Ga0501035_0015069 3300049822 Bacteria 7133
149 Ga0501035_0067193 3300049822 Bacteria 3182
150 Ga0501044_0085807 3300049823 Bacteria 3181
151 Ga0501044_0171682 3300049823 Bacteria 2139
152 Ga0501045_0128314 3300049824 Bacteria 1885
153 nmdc:mga00v17_25897_c1 3300050491 Bacteria 3412
154 nmdc:mga00v17_6058_c1 3300050491 Bacteria 6399
155 nmdc:mga0yw44_160655_c1 3300050492 Bacteria 1471
156 nmdc:mga0yw44_28078_c1 3300050492 Bacteria 3233
157 nmdc:mga0yw44_420_c1 3300050492 Bacteria 14871
158 nmdc:mga06z11_108055_c1 3300050494 Bacteria 1537
159 nmdc:mga06z11_33569_c1 3300050494 Bacteria 2512
160 Ga0500578_0079942 3300053086 Bacteria 2080
161 Ga0500646_0047535 3300053090 Bacteria 1228
162 Ga0500557_023469 3300053105 Bacteria 1793
163 Ga0500569_000776 3300053109 Bacteria 5598
164 Ga0500594_0000634 3300053118 Bacteria 7511
165 Ga0500568_0000187 3300053139 Bacteria 54387
166 Ga0500568_0000559 3300053139 Bacteria 27350
167 Ga0500588_0012521 3300053146 Bacteria 2106
168 Ga0500616_0000181 3300053153 Bacteria 104316
169 Ga0500616_0000872 3300053153 Bacteria 33370
170 Ga0501084_0195402 3300054114 Bacteria 1707
171 Ga0501084_0391924 3300054114 Bacteria 1174
172 Ga0590071_008526 3300059421 Bacteria 2410
173 Ga0530510_0067829 3300061734 Bacteria 2588
174 Ga0530510_0251699 3300061734 Bacteria 1317
175 2509107984 2508501122 Bacteria 6292184
176 2509376840 2509276019 Bacteria 6802256
177 2510304137 2510065057 Bacteria 6649661
178 2510842167 2510461069 Bacteria 5505000
179 2511171362 2510917026 Bacteria 7046020
180 2511502574 2511231052 Bacteria 6974333
181 2512533943 2512047086 Bacteria 6850303
182 2512970298 2512875026 Bacteria 6861065
183 2513583205 2513237086 Bacteria 7265287
184 2513601362 2513237089 Bacteria 6553624
185 2513621020 2513237091 Bacteria 6900273
186 2513881743 2513237140 Bacteria 7076289
187 2513904887 2513237143 Bacteria 6664116
188 2513911592 2513237144 Bacteria 7530820
189 2513927791 2513237146 Bacteria 7166346
190 2513986625 2513237156 Bacteria 6402557
191 2513997490 2513237159 Bacteria 6810126
192 2514003191 2513237160 Bacteria 6650282
193 2514418725 2513237305 Bacteria 7293571
194 2514585953 2513237351 Bacteria 6968952
195 2515609357 2515154107 Bacteria 6795637
196 2516206004 2516143018 Bacteria 6951533
197 2516893949 2516653046 Bacteria 6989037
198 2517570664 2517487022 Bacteria 7227575
199 2524448231 2524023207 Bacteria 6813453
200 2551675339 2551306084 Bacteria 8942552
201 2551676749 2551306084 Bacteria 8942552
202 2551689377 2551306085 Bacteria 7347181
203 2551695493 2551306086 Bacteria 6843938
204 2551711098 2551306089 Bacteria 7162724
205 2551722021 2551306090 Bacteria 7953713
206 2551724392 2551306091 Bacteria 7086830
207 2551734084 2551306092 Bacteria 6992595
208 2558865803 2558860100 Bacteria 8458965
209 2585167632 2582581283 Bacteria 6030556
210 2585265866 2582581306 Bacteria 6450535
211 2585390056 2582581865 Bacteria 6644329
212 2585395261 2582581866 Bacteria 6859583
213 2585397495 2582581866 Bacteria 6859583
214 2585397520 2582581866 Bacteria 6859583
215 2585992613 2585427633 Bacteria 6413184
216 2586003374 2585427634 Bacteria 6455027
217 2599106498 2597490356 Bacteria 7030811
218 2599416776 2599185170 Bacteria 7295545
219 2600196915 2599185352 Bacteria 7228948
220 2616296922 2615840624 Bacteria 6557588
221 2643772301 2643221550 Bacteria 4619371
222 2643804457 2643221557 Bacteria 7184309
223 2643836567 2643221564 Bacteria 4193379
224 2644052124 2643221607 Bacteria 6314006
225 2644065228 2643221610 Bacteria 7480339
226 2644105519 2643221618 Bacteria 7717186
227 2644133728 2643221623 Bacteria 5239945
228 2644146522 2643221626 Bacteria 8069654
229 2644204917 2643221636 Bacteria 6583769
230 2644208631 2643221637 Bacteria 5345260
231 2644299407 2643221653 Bacteria 4569637
232 2644308270 2643221655 Bacteria 7722067
233 2644334097 2643221659 Bacteria 7890716
234 2644377637 2643221668 Bacteria 7306521
235 2644418166 2643221675 Bacteria 7473456
236 2644451422 2643221680 Bacteria 7473610
237 2644484867 2643221686 Bacteria 6310811
238 2644494160 2643221688 Bacteria 5260751
239 2644500573 2643221689 Bacteria 6042950
240 2644541691 2643221698 Bacteria 7756764
241 2644615552 2643221712 Bacteria 7729434
242 2644652161 2643221718 Bacteria 5345506
243 2644657635 2643221719 Bacteria 4568197
244 2644672706 2643221723 Bacteria 7095460
245 2644691598 2643221726 Bacteria 7455827
246 2657684805 2657244999 Bacteria 5946535
247 2692315107 2690316117 Bacteria 6800650
248 2723572973 2721755686 Bacteria 7343952
249 2739307662 2738543024 Bacteria 5603683
250 2739351054 2738543031 Bacteria 5769731
251 2753463280 2751185821 Bacteria 6189929
252 2765468613 2765235802 Bacteria 5618596
253 2770198879 2767802442 Bacteria 5747986
254 2776272894 2775506902 Bacteria 6208009
255 2776282263 2775506904 Bacteria 5954060
256 2776914780 2775507049 Bacteria 6284736
257 2792581594 2791355082 Bacteria 5973319
258 2792620414 2791355091 Bacteria 6135441
259 2792625772 2791355092 Bacteria 6248105
260 2792641840 2791355094 Bacteria 7011481
261 2792747067 2791355123 Bacteria 8049106
262 2793322854 2791355260 Bacteria 6598818
263 2793349212 2791355264 Bacteria 6429314
264 2802716655 2802428858 Bacteria 6636079
265 2802725466 2802428859 Bacteria 6667919
266 2802730442 2802428860 Bacteria 6525526
267 2802737586 2802428861 Bacteria 6534206
268 2802743024 2802428862 Bacteria 6633353
269 2802750448 2802428863 Bacteria 6410669
270 2804753064 2802429268 Bacteria 6094027
271 2805931854 2802429605 Bacteria 6875453
272 2819243980 2818991272 Bacteria 4622173
273 2838027052 2838022645 Bacteria 6494267
274 2838036890 2838035591 Bacteria 7166484
275 2838047163 2838042994 Bacteria 6046894
276 2838080573 2838074704 Bacteria 6785777
277 2838662072 2838661181 Bacteria 7385261
278 2838674485 2838668709 Bacteria 6671819
279 2838706826 2838701080 Bacteria 6669771
280 2839996566 2839993093 Bacteria 5512535
281 2840770319 2840764183 Bacteria 6358399
282 2842151528 2842146304 Bacteria 5957337
283 2842202656 2842198810 Bacteria 6608673
284 2842207934 2842205361 Bacteria 6340321
285 2842256679 2842250916 Bacteria 6579627
286 2842281271 2842278818 Bacteria 6340002
287 2842290515 2842285085 Bacteria 6011953
288 2842324304 2842317721 Bacteria 6793725
289 2842334821 2842333319 Bacteria 8899485
290 2842408353 2842402390 Bacteria 6681310
291 2842415062 2842409023 Bacteria 6687331
292 2842421657 2842415677 Bacteria 6596907
293 2842495696 2842489311 Bacteria 6620893
294 2842501166 2842495871 Bacteria 6820686
295 2842522269 2842521101 Bacteria 6569494
296 2844166434 2844163670 Bacteria 7266046
297 2846958141 2846952575 Bacteria 6587527
298 2847419832 2847417321 Bacteria 6913799
299 2847673290 2847670302 Bacteria 6165597
300 2848864657 2848858292 Bacteria 7391279
301 2848994848 2848992105 Bacteria 6810864
302 2850081844 2850079185 Bacteria 6848280
303 2854897894 2854896431 Bacteria 5869725
304 2854920663 2854916844 Bacteria 5725939
305 2855826671 2855825444 Bacteria 6785811
306 2855842065 2855839649 Bacteria 7135830
307 2855877348 2855872281 Bacteria 6964271
308 2856319241 2856314179 Bacteria 6477897
309 2856350172 2856349417 Bacteria 6230045
310 2858802739 2858800743 Bacteria 6603254
311 2871491206 2871488783 Bacteria 6929816
312 2874124164 2874123672 Bacteria 7238285
313 2874172328 2874168670 Bacteria 8062617
314 2878039630 2878035449 Bacteria 6555736
315 2878755625 2878753008 Bacteria 6922523
316 2881159108 2881155292 Bacteria 6461656
317 2881846486 2881845957 Bacteria 6611900
318 2881853683 2881853255 Bacteria 6698367
319 2881862357 2881861095 Bacteria 7128710
320 2882634659 2882632389 Bacteria 8154593
321 2882915336 2882912400 Bacteria 6801539
322 2885320997 2885318864 Bacteria 6729568
323 2885350502 2885342637 Bacteria 7011821
324 2885357891 2885350715 Bacteria 6787678
325 2889795537 2889790730 Bacteria 5689708
326 2889916098 2889914905 Bacteria 5702301
327 2891376919 2891373044 Bacteria 5202277
328 2894656798 2894652903 Bacteria 4587256
329 2896391279 2896384573 Bacteria 7700774
330 2897809624 2897803580 Bacteria 7000062
331 2903498910 2903492973 Bacteria 13473544
332 2904582517 2904578770 Bacteria 5302906
333 2906419313 2906414383 Bacteria 6580790
334 2913301723 2913295892 Bacteria 6333755
335 2915981207 2915980308 Bacteria 6624279
336 2915988395 2915986958 Bacteria 6739310
337 2915998579 2915993759 Bacteria 7016183
338 2916005655 2916000859 Bacteria 6865702
339 2916013509 2916007675 Bacteria 6898660
340 2916021452 2916014648 Bacteria 6946486
341 2916026854 2916021584 Bacteria 6854472
342 2916033022 2916028427 Bacteria 6748433
343 2916039293 2916035215 Bacteria 6755766
344 2916046514 2916041962 Bacteria 6820487
345 2916050490 2916048683 Bacteria 6543552
346 2916055965 2916055098 Bacteria 6758838
347 2916062068 2916061851 Bacteria 6737736
348 2916075714 2916068649 Bacteria 6943657
349 2916077203 2916076590 Bacteria 6596108
350 2919123996 2919119836 Bacteria 5208557
351 2919174402 2919171160 Bacteria 6499771
352 2920761118 2920760137 Bacteria 7427611
353 2920825694 2920822456 Bacteria 6897201
354 2921205460 2921201388 Bacteria 6926299
355 2921213961 2921208531 Bacteria 6745326
356 2921239327 2921237296 Bacteria 6876710
357 2921249937 2921244191 Bacteria 6568419
358 2921251714 2921250672 Bacteria 6677771
359 2921258896 2921257292 Bacteria 6808382
360 2921270268 2921263974 Bacteria 6864552
361 2921287203 2921282425 Bacteria 6826397
362 2921292039 2921289301 Bacteria 7316391
363 2921302397 2921296804 Bacteria 7176999
364 2924144910 2924144063 Bacteria 6883928
365 2924156129 2924150972 Bacteria 7169444
366 2924159954 2924158325 Bacteria 7188855
367 2924169494 2924165586 Bacteria 7260590
368 2924173559 2924172951 Bacteria 6749356
369 2924183794 2924179722 Bacteria 6843264
370 2924193158 2924186466 Bacteria 6876637
371 2924195081 2924193448 Bacteria 6955718
372 2924201607 2924200457 Bacteria 6757188
373 2924208220 2924207177 Bacteria 6917007
374 2924219181 2924214083 Bacteria 7080103
375 2924223579 2924221636 Bacteria 7113495
376 2924235206 2924228884 Bacteria 6633132
377 2924766701 2924762789 Bacteria 6561353
378 2924785605 2924784321 Bacteria 7416538
379 2929141496 2929138655 Bacteria 5810547
380 2933019341 2933016740 Bacteria 6355406
381 2937001210 2936996657 Bacteria 6298727
382 2937003920 2937002841 Bacteria 6934057
383 2937010770 2937009748 Bacteria 6746052
384 2937021809 2937016420 Bacteria 6782579
385 2937027397 2937023124 Bacteria 6815156
386 2937035696 2937029754 Bacteria 6424026
387 2937039359 2937036028 Bacteria 6846469
388 2937042916 2937042894 Bacteria 6741576
389 2937050347 2937049772 Bacteria 6757901
390 2937062864 2937056579 Bacteria 7107896
391 2937064555 2937063883 Bacteria 7199456
392 2937073248 2937071275 Bacteria 6984483
393 2937080758 2937078374 Bacteria 6610289
394 2937090615 2937084907 Bacteria 6618516
395 2937097370 2937091812 Bacteria 6979387
396 2937101085 2937098957 Bacteria 7249374
397 2937112218 2937106411 Bacteria 6947143
398 2937117618 2937113482 Bacteria 6505872
399 2937124449 2937119839 Bacteria 6597547
400 2937131507 2937126314 Bacteria 6771275
401 2937826294 2937822353 Bacteria 7290551
402 2937848104 2937843397 Bacteria 5256375
403 2941504535 2941499720 Bacteria 7599444
404 2957380629 2957375807 Bacteria 6425588
405 2957382579 2957382221 Bacteria 6737050
406 2957389443 2957388812 Bacteria 6778072
407 2957401959 2957395598 Bacteria 6822399
408 2957408381 2957402308 Bacteria 6741770
409 2957410165 2957408893 Bacteria 6558585
410 2957420053 2957415311 Bacteria 6991633
411 2957428481 2957422303 Bacteria 7172205
412 2957431011 2957430029 Bacteria 7022557
413 2957440116 2957437181 Bacteria 6568994
414 2957450633 2957443900 Bacteria 6869977
415 2957452254 2957450854 Bacteria 6765715
416 2957462670 2957457609 Bacteria 6967680
417 2957465625 2957464669 Bacteria 6568877
418 2957475701 2957471148 Bacteria 6797643
419 2957478969 2957478035 Bacteria 6756658
420 2957488896 2957484790 Bacteria 6703082
421 2957497929 2957491536 Bacteria 6695180
422 2957501753 2957498199 Bacteria 7126688
423 2957509906 2957505466 Bacteria 7253085
424 2960589113 2960584000 Bacteria 6864594
425 2960591871 2960591022 Bacteria 6622873
426 2960602045 2960597568 Bacteria 6550735
427 2960607922 2960603979 Bacteria 6898737
428 2960614804 2960610863 Bacteria 6691244
429 2960618059 2960617483 Bacteria 6727748
430 2960630038 2960624210 Bacteria 6875384
431 2960634072 2960631154 Bacteria 6732508
432 2960642589 2960637947 Bacteria 7296468
433 2960651174 2960645483 Bacteria 7211087
434 2960659483 2960652885 Bacteria 7083688
435 2960667188 2960660292 Bacteria 7041660
436 2960673698 2960667422 Bacteria 6763020
437 2960674809 2960674078 Bacteria 6609048
438 2960680744 2960680706 Bacteria 6624464
439 2960692230 2960687367 Bacteria 6535474
440 2960696526 2960693952 Bacteria 6749742
441 2961130485 2961127735 Bacteria 7196641
442 2961176441 2961170736 Bacteria 7072258
443 2964614893 2964607997 Bacteria 7101408
444 2964617113 2964615318 Bacteria 6809089
445 2964627182 2964621998 Bacteria 6834995
446 2964632871 2964628898 Bacteria 7083044
447 2964636803 2964636051 Bacteria 7091832
448 2964646311 2964643177 Bacteria 6820887
449 2964651187 2964649959 Bacteria 6675118
450 2964662760 2964656573 Bacteria 7100150
451 2964669261 2964663802 Bacteria 7019362
452 2964675521 2964670856 Bacteria 6851364
453 2964682439 2964678106 Bacteria 6792020
454 2964689389 2964685014 Bacteria 6839111
455 2964693929 2964691889 Bacteria 6802758
456 2964704791 2964698721 Bacteria 6765331
457 2964706438 2964705432 Bacteria 7114648
458 2964716447 2964712639 Bacteria 6695970
459 2964721265 2964719344 Bacteria 7286602
460 2967670274 2967664464 Bacteria 6948836
461 2967676221 2967671571 Bacteria 7021409
462 2967685884 2967678726 Bacteria 7264382
463 2967691015 2967686174 Bacteria 6678622
464 2967698998 2967693043 Bacteria 6804451
465 2967711616 2967706974 Bacteria 7186053
466 2967720447 2967714385 Bacteria 7000047
467 2967724382 2967721400 Bacteria 7073753
468 2967732355 2967728569 Bacteria 6641507
469 2967739924 2967735183 Bacteria 6827012
470 2967745851 2967742019 Bacteria 6794534
471 2967749368 2967748971 Bacteria 6733771
472 2967759594 2967755722 Bacteria 6814706
473 2967767194 2967762386 Bacteria 6923502
474 2967770514 2967769361 Bacteria 6587838
475 2967776888 2967775926 Bacteria 6738189
476 2967998834 2967996073 Bacteria 6787468
477 2968007595 2968003550 Bacteria 6929263
478 2970025807 2970019648 Bacteria 7072033
479 2970027523 2970026789 Bacteria 6785236
480 2970036044 2970033650 Bacteria 7118744
481 2970046129 2970040964 Bacteria 6731123
482 2970048410 2970047711 Bacteria 7088379
483 2970056287 2970054988 Bacteria 6611507
484 2970065986 2970061556 Bacteria 7099761
485 2970071053 2970068827 Bacteria 7123112
486 2970082479 2970076120 Bacteria 6697332
487 2970088316 2970082768 Bacteria 6183754
488 2970094211 2970088815 Bacteria 6933825
489 2970100760 2970095765 Bacteria 6936963
490 2970104431 2970102677 Bacteria 6812532
491 2970115021 2970109326 Bacteria 6863976
492 2970120619 2970116247 Bacteria 6501857
493 2970123405 2970122695 Bacteria 6625855
494 2970135911 2970129317 Bacteria 6806560
495 2970140864 2970136068 Bacteria 7207982
496 2970144792 2970143518 Bacteria 6446480
497 2970154912 2970149975 Bacteria 6779706
498 2970161328 2970156795 Bacteria 7168044
499 2970168335 2970164137 Bacteria 6861252
500 2970173866 2970170962 Bacteria 6876229
501 2970181047 2970177841 Bacteria 6768001
502 2970186304 2970184632 Bacteria 7054431
503 2970196089 2970191845 Bacteria 7032787
504 2970509112 2970503327 Bacteria 7099517
505 2977519371 2977516862 Bacteria 6940108
506 2977530462 2977523885 Bacteria 6960446
507 2977536333 2977530762 Bacteria 6951399
508 2977543277 2977537788 Bacteria 6929320
509 2977545694 2977544691 Bacteria 6875412
510 2977553085 2977551784 Bacteria 7125765
511 2977565231 2977558990 Bacteria 6863948
512 2977567008 2977565890 Bacteria 6901543
513 2977574026 2977572785 Bacteria 6763888
514 2977585886 2977579622 Bacteria 6772100
515 2977824863 2977821940 Bacteria 6906439
516 2977831393 2977828996 Bacteria 7007971
517 2979813791 2979808191 Bacteria 7179355
518 2987667629 2987666974 Bacteria 6509233
519 2989352305 2989349275 Bacteria 6349068
520 2989772844 2989771324 Bacteria 5605128
521 2989780519 2989776772 Bacteria 4843317
522 2996316043 2996310559 Bacteria 6357320
523 3000137208 3000135777 Bacteria 6891109
524 3002145533 3002141150 Bacteria 5254435
525 3003935308 3003930520 Bacteria 5667563
526 3005413396 3005409236 Bacteria 7188837
527 643826728 643692032 Bacteria 6891900
528 648738768 648276728 Bacteria 6968865
529 8002290826 8002285264 Bacteria 6717907
530 8003994506 8003992118 Bacteria 7266902
531 8004002202 8003999396 Bacteria 7063185
532 8004377226 8004374579 Bacteria 6898112
533 8005292551 8005289223 Bacteria 6634003
534 8005304318 8005301065 Bacteria 6614431
535 8005690740 8005688590 Bacteria 6610080
536 8018131053 8018127388 Bacteria 7351159
537 8024503508 8024501048 Bacteria 6427847
538 8045867842 8045864390 Bacteria 5043873
539 8049295678 8049293176 Bacteria 6128433
540 8054006442 8054002106 Bacteria 7987183
541 8054560375 8054558443 Bacteria 5204801
542 8056876363 8056875544 Bacteria 4355797
543 nmdc:mga0rr50_111022_c1
544 JGI25159J45721_1000008
545 JGI25151J46595_10003122
546 JGI25151J46595_10017394
547 JGI25160J50197_1000033
548 JGI25161J50226_1001629
549 Ga0055526_1010424
550 Ga0055536_1002310
551 Ga0055530_10026263
552 Ga0055531_10003421
553 Ga0055543_1000026
554 Ga0065165_1000513
555 Ga0065704_10131113
556 Ga0070689_100195145
557 Ga0070663_100085726
558 Ga0070665_100009630
559 Ga0070702_100209085
560 Ga0081455_10032972
561 Ga0081538_10020532
562 Ga0081540_1002570
563 Ga0075364_10070331
564 Ga0075433_10098307
565 Ga0079104_1029042
566 Ga0114129_10202362
567 Ga0105239_10499238
568 Ga0157373_10067011
569 Ga0157373_10158817
570 Ga0171463_1007
571 Ga0183363_1058
572 Ga0163161_10321003
573 Ga0214544_1000010
574 Ga0214542_1000023
575 Ga0214542_1032369
576 Ga0214543_1000019
577 Ga0214543_1001578
578 Ga0228711_1000017
579 Ga0228710_1000005
580 Ga0209436_100593
581 Ga0209130_1000017
582 Ga0209676_1000100
583 Ga0209676_1016804
584 Ga0209025_1000121
585 Ga0209025_1000153
586 Ga0209564_1000372
587 Ga0209758_1000203
588 Ga0209758_1013780
589 Ga0209758_1020283
590 Ga0209256_1000401
591 Ga0209256_1000735
592 Ga0207426_1000006
593 Ga0209051_1001964
594 Ga0209257_1001793
595 Ga0209257_1007978
596 Ga0207645_10097504
597 Ga0207670_10143039
598 Ga0207678_10091031
599 Ga0207648_10364434
600 Ga0207675_100408928
601 Ga0207675_100463134
602 Ga0209281_1000082
603 Ga0209281_1000484
604 Ga0209282_1000006
605 Ga0268266_10006032
606 Ga0307515_10000017
607 Ga0307515_10006276
608 Ga0307513_10008934
609 Ga0307408_100129437
610 Ga0307408_100439665
611 Ga0316578_10109046
612 Ga0316577_10066367
613 Ga0315914_1000003
614 Ga0307414_10234649
615 Ga0315913_1000001
616 Ga0315915_1000008
617 Ga0316592_1031005
618 Ga0316574_0093568
619 Ga0316582_0085509
620 Ga0400483_083489
621 Ga0439436_0022785
622 Ga0439447_030074
623 Ga0439465_0003329
624 Ga0439465_0013227
625 Ga0439465_0029506
626 Ga0439449_0022731
627 Ga0450906_000790
628 Ga0450918_009503
629 Ga0495638_0000084
630 Ga0495605_0001482
631 Ga0495585_0007328
632 Ga0495606_0018227
633 Ga0495616_0048858
634 Ga0495620_0024749
635 Ga0495620_0098667
636 Ga0495631_0001485
637 Ga0495632_0045710
638 Ga0495648_0045433
639 Ga0495668_0008288
640 Ga0495611_0007619
641 Ga0495625_0002952
642 Ga0495672_0043343
643 Ga0495687_011197
644 Ga0495686_0050750
645 Ga0496101_0233664
646 Ga0496102_0059576
647 Ga0496103_0179448
648 Ga0496106_0149604
649 Ga0496108_0078024
650 Ga0496117_0003370
651 Ga0496117_0054638
652 Ga0496119_0102602
653 Ga0496120_0042145
654 Ga0496120_0043272
655 Ga0496121_0000003
656 Ga0496121_0254482
657 Ga0496122_0000778
658 Ga0496122_0018240
659 Ga0496122_0060176
660 Ga0496123_0000018
661 Ga0496124_0001346
662 Ga0496124_0003732
663 Ga0496124_0005103
664 Ga0496125_0000161
665 Ga0496125_0000200
666 Ga0496126_0000212
667 Ga0496126_0064901
668 Ga0495678_037899
669 Ga0501318_007014
670 Ga0501033_0010396
671 Ga0501034_0280387
672 Ga0501036_0300161
673 Ga0501037_0063398
674 Ga0501038_0032435
675 Ga0501039_0030504
676 Ga0501042_0072564
677 Ga0501043_0027497
678 Ga0501046_0012466
679 Ga0501048_0006065
680 Ga0501067_0079688
681 Ga0501069_0022239
682 Ga0501070_0023869
683 Ga0501072_0123383
684 Ga0501072_0137749
685 Ga0501074_0013053
686 Ga0501076_0086845
687 Ga0501080_0015522
688 Ga0501080_0129810
689 Ga0501083_0152919
690 Ga0501035_0015069
691 Ga0501035_0067193
692 Ga0501044_0085807
693 Ga0501044_0171682
694 Ga0501045_0128314
695 nmdc:mga00v17_25897_c1
696 nmdc:mga00v17_6058_c1
697 nmdc:mga0yw44_160655_c1
698 nmdc:mga0yw44_28078_c1
699 nmdc:mga0yw44_420_c1
700 nmdc:mga06z11_108055_c1
701 nmdc:mga06z11_33569_c1
702 Ga0500578_0079942
703 Ga0500646_0047535
704 Ga0500557_023469
705 Ga0500569_000776
706 Ga0500594_0000634
707 Ga0500568_0000187
708 Ga0500568_0000559
709 Ga0500588_0012521
710 Ga0500616_0000181
711 Ga0500616_0000872
712 Ga0501084_0195402
713 Ga0501084_0391924
714 Ga0590071_008526
715 Ga0530510_0067829
716 Ga0530510_0251699
717 2509107984
718 2509376840
719 2510304137
720 2510842167
721 2511171362
722 2511502574
723 2512533943
724 2512970298
725 2513583205
726 2513601362
727 2513621020
728 2513881743
729 2513904887
730 2513911592
731 2513927791
732 2513986625
733 2513997490
734 2514003191
735 2514418725
736 2514585953
737 2515609357
738 2516206004
739 2516893949
740 2517570664
741 2524448231
742 2551675339
743 2551676749
744 2551689377
745 2551695493
746 2551711098
747 2551722021
748 2551724392
749 2551734084
750 2558865803
751 2585167632
752 2585265866
753 2585390056
754 2585395261
755 2585397495
756 2585397520
757 2585992613
758 2586003374
759 2599106498
760 2599416776
761 2600196915
762 2616296922
763 2643772301
764 2643804457
765 2643836567
766 2644052124
767 2644065228
768 2644105519
769 2644133728
770 2644146522
771 2644204917
772 2644208631
773 2644299407
774 2644308270
775 2644334097
776 2644377637
777 2644418166
778 2644451422
779 2644484867
780 2644494160
781 2644500573
782 2644541691
783 2644615552
784 2644652161
785 2644657635
786 2644672706
787 2644691598
788 2657684805
789 2692315107
790 2723572973
791 2739307662
792 2739351054
793 2753463280
794 2765468613
795 2770198879
796 2776272894
797 2776282263
798 2776914780
799 2792581594
800 2792620414
801 2792625772
802 2792641840
803 2792747067
804 2793322854
805 2793349212
806 2802716655
807 2802725466
808 2802730442
809 2802737586
810 2802743024
811 2802750448
812 2804753064
813 2805931854
814 2819243980
815 2838027052
816 2838036890
817 2838047163
818 2838080573
819 2838662072
820 2838674485
821 2838706826
822 2839996566
823 2840770319
824 2842151528
825 2842202656
826 2842207934
827 2842256679
828 2842281271
829 2842290515
830 2842324304
831 2842334821
832 2842408353
833 2842415062
834 2842421657
835 2842495696
836 2842501166
837 2842522269
838 2844166434
839 2846958141
840 2847419832
841 2847673290
842 2848864657
843 2848994848
844 2850081844
845 2854897894
846 2854920663
847 2855826671
848 2855842065
849 2855877348
850 2856319241
851 2856350172
852 2858802739
853 2871491206
854 2874124164
855 2874172328
856 2878039630
857 2878755625
858 2881159108
859 2881846486
860 2881853683
861 2881862357
862 2882634659
863 2882915336
864 2885320997
865 2885350502
866 2885357891
867 2889795537
868 2889916098
869 2891376919
870 2894656798
871 2896391279
872 2897809624
873 2903498910
874 2904582517
875 2906419313
876 2913301723
877 2915981207
878 2915988395
879 2915998579
880 2916005655
881 2916013509
882 2916021452
883 2916026854
884 2916033022
885 2916039293
886 2916046514
887 2916050490
888 2916055965
889 2916062068
890 2916075714
891 2916077203
892 2919123996
893 2919174402
894 2920761118
895 2920825694
896 2921205460
897 2921213961
898 2921239327
899 2921249937
900 2921251714
901 2921258896
902 2921270268
903 2921287203
904 2921292039
905 2921302397
906 2924144910
907 2924156129
908 2924159954
909 2924169494
910 2924173559
911 2924183794
912 2924193158
913 2924195081
914 2924201607
915 2924208220
916 2924219181
917 2924223579
918 2924235206
919 2924766701
920 2924785605
921 2929141496
922 2933019341
923 2937001210
924 2937003920
925 2937010770
926 2937021809
927 2937027397
928 2937035696
929 2937039359
930 2937042916
931 2937050347
932 2937062864
933 2937064555
934 2937073248
935 2937080758
936 2937090615
937 2937097370
938 2937101085
939 2937112218
940 2937117618
941 2937124449
942 2937131507
943 2937826294
944 2937848104
945 2941504535
946 2957380629
947 2957382579
948 2957389443
949 2957401959
950 2957408381
951 2957410165
952 2957420053
953 2957428481
954 2957431011
955 2957440116
956 2957450633
957 2957452254
958 2957462670
959 2957465625
960 2957475701
961 2957478969
962 2957488896
963 2957497929
964 2957501753
965 2957509906
966 2960589113
967 2960591871
968 2960602045
969 2960607922
970 2960614804
971 2960618059
972 2960630038
973 2960634072
974 2960642589
975 2960651174
976 2960659483
977 2960667188
978 2960673698
979 2960674809
980 2960680744
981 2960692230
982 2960696526
983 2961130485
984 2961176441
985 2964614893
986 2964617113
987 2964627182
988 2964632871
989 2964636803
990 2964646311
991 2964651187
992 2964662760
993 2964669261
994 2964675521
995 2964682439
996 2964689389
997 2964693929
998 2964704791
999 2964706438
1000 2964716447
1001 2964721265
1002 2967670274
1003 2967676221
1004 2967685884
1005 2967691015
1006 2967698998
1007 2967711616
1008 2967720447
1009 2967724382
1010 2967732355
1011 2967739924
1012 2967745851
1013 2967749368
1014 2967759594
1015 2967767194
1016 2967770514
1017 2967776888
1018 2967998834
1019 2968007595
1020 2970025807
1021 2970027523
1022 2970036044
1023 2970046129
1024 2970048410
1025 2970056287
1026 2970065986
1027 2970071053
1028 2970082479
1029 2970088316
1030 2970094211
1031 2970100760
1032 2970104431
1033 2970115021
1034 2970120619
1035 2970123405
1036 2970135911
1037 2970140864
1038 2970144792
1039 2970154912
1040 2970161328
1041 2970168335
1042 2970173866
1043 2970181047
1044 2970186304
1045 2970196089
1046 2970509112
1047 2977519371
1048 2977530462
1049 2977536333
1050 2977543277
1051 2977545694
1052 2977553085
1053 2977565231
1054 2977567008
1055 2977574026
1056 2977585886
1057 2977824863
1058 2977831393
1059 2979813791
1060 2987667629
1061 2989352305
1062 2989772844
1063 2989780519
1064 2996316043
1065 3000137208
1066 3002145533
1067 3003935308
1068 3005413396
1069 643826728
1070 648738768
1071 8002290826
1072 8003994506
1073 8004002202
1074 8004377226
1075 8005292551
1076 8005304318
1077 8005690740
1078 8018131053
1079 8024503508
1080 8045867842
1081 8049295678
1082 8054006442
1083 8054560375
1084 8056876363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

243

327

0.89

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

64

248

0.77

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

53

299

0.76

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

101

338

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu5-assembly1.cif.gz_A the crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis 0.8769 31 357
3pu5-assembly1.cif.gz_A the crystal structure of a putative extracellular solute-binding protein from bordetella parapertussis 0.8692 31 357
4eq7-assembly1.cif.gz_A structure of atu4243-gaba receptor 0.8532 33 357
4edp-assembly2.cif.gz_B 1.85 angstrom resolution crystal structure of an abc transporter from clostridium perfringens atcc 13124 0.8414 37 357
6dgv-assembly1.cif.gz_A igabasnfr fluorescent gaba sensor precursor 0.8335 33 313
ID Description Score Start End Superfamily
1potA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8768 145 269 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8662 33 327 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8561 35 111 3.40.190.10
5tu0A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.844 31 313 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8417 35 320 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7U1E8P0-F1-model_v4 deleted 0.9568 91 359
AF-A0A7U1E8P0-F1-model_v4 deleted 0.9499 91 359
AF-A0A7C1NQ11-F1-model_v4 Extracellular solute-binding protein 0.9179 1 359 GO:0015846
GO:0015888
GO:0019808
GO:0030288
GO:0030975
GO:0030976
AF-A0A7C1NQ11-F1-model_v4 Extracellular solute-binding protein 0.9154 1 359 GO:0015846
GO:0015888
GO:0019808
GO:0030288
GO:0030975
GO:0030976
AF-A0A3A0E922-F1-model_v4 Polyamine ABC transporter substrate-binding protein 0.8961 51 358 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Map