F461547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 542 | 257 | 541 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0062457|Ga0501070_0062457_2060_2542 |
| Length | 160 |
| Sequence | MLRATACVVARGRFGLGRQLQRFHFRIAAMADTRRPLSPHLQIYKWQVQMVTSILHRATGIALAVGTLLVVWGLLSLAAGEAAFDQFKICIGSVPGMILLAGWSWALFYHLCNGIRHLLQDTGAGYAIPQFVRSSWLSVVVSLVLVAIVWACVLTSGGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 180 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 192 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 193 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 203 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 218 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 219 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 220 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 248 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 3.32 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.74 |
| Nodule | 0 |
| Rhizoplane | 1.66 |
| Rhizosphere | 71.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1453 | 2162886007 | Bacteria | 3318 |
| 2 | JGI24739J22299_10000042 | 3300001989 | Bacteria | 34840 |
| 3 | JGI24739J22299_10000091 | 3300001989 | Bacteria | 26347 |
| 4 | JGI24737J22298_10002031 | 3300001990 | Bacteria | 7238 |
| 5 | JGI24737J22298_10030880 | 3300001990 | Bacteria | 1675 |
| 6 | JGI24735J21928_10006310 | 3300002067 | Bacteria | 3912 |
| 7 | JGI25162J39368_1000529 | 3300002737 | Bacteria | 28464 |
| 8 | JGI25157J39369_1000446 | 3300002741 | Bacteria | 26463 |
| 9 | JGI25157J39369_1000950 | 3300002741 | Bacteria | 13652 |
| 10 | JGI25157J39369_1001638 | 3300002741 | Bacteria | 7690 |
| 11 | JGI25157J39369_1002462 | 3300002741 | Bacteria | 4576 |
| 12 | JGI25157J39369_1003251 | 3300002741 | Bacteria | 3412 |
| 13 | JGI25163J39215_1000279 | 3300002771 | Bacteria | 18007 |
| 14 | JGI25163J39215_1000580 | 3300002771 | Bacteria | 10307 |
| 15 | JGI25164J39214_1000102 | 3300002772 | Bacteria | 83707 |
| 16 | JGI25164J39214_1000142 | 3300002772 | Bacteria | 68956 |
| 17 | JGI25164J39214_1000561 | 3300002772 | Bacteria | 16869 |
| 18 | JGI25164J39214_1000564 | 3300002772 | Bacteria | 16819 |
| 19 | JGI25165J46597_1000058 | 3300003214 | Bacteria | 212833 |
| 20 | JGI25165J46597_1000090 | 3300003214 | Bacteria | 168833 |
| 21 | JGI25165J46597_1001122 | 3300003214 | Bacteria | 16865 |
| 22 | JGI25165J46597_1001290 | 3300003214 | Bacteria | 14538 |
| 23 | rootH1_10127202 | 3300003316 | Bacteria | 1374 |
| 24 | rootH2_10011619 | 3300003320 | Bacteria | 16641 |
| 25 | rootH2_10069172 | 3300003320 | Bacteria | 2806 |
| 26 | rootH1_10142898 | 3300003323 | Bacteria | 1151 |
| 27 | Ga0006558J51389_1026097 | 3300003558 | Bacteria | 1260 |
| 28 | Ga0006560J51390_1026969 | 3300003565 | Bacteria | 1220 |
| 29 | Ga0006554J51385_1023919 | 3300003567 | Bacteria | 1464 |
| 30 | Ga0006562J51391_1022432 | 3300003578 | Bacteria | 5470 |
| 31 | Ga0006562J51391_1022433 | 3300003578 | Bacteria | 3793 |
| 32 | Ga0055538_1000714 | 3300003751 | Bacteria | 9924 |
| 33 | Ga0055539_1000821 | 3300003752 | Bacteria | 7316 |
| 34 | Ga0055527_1000105 | 3300003760 | Bacteria | 60329 |
| 35 | Ga0055527_1000253 | 3300003760 | Bacteria | 32992 |
| 36 | Ga0055535_1000034 | 3300003761 | Bacteria | 181954 |
| 37 | Ga0055535_1000150 | 3300003761 | Bacteria | 74086 |
| 38 | Ga0055535_1000488 | 3300003761 | Bacteria | 35722 |
| 39 | Ga0055535_1000765 | 3300003761 | Bacteria | 23814 |
| 40 | Ga0055535_1000789 | 3300003761 | Bacteria | 23078 |
| 41 | Ga0055535_1008250 | 3300003761 | Bacteria | 1898 |
| 42 | Ga0055542_1000198 | 3300003762 | Bacteria | 74085 |
| 43 | Ga0055542_1000685 | 3300003762 | Bacteria | 26937 |
| 44 | Ga0055542_1001221 | 3300003762 | Bacteria | 14371 |
| 45 | Ga0055542_1002647 | 3300003762 | Bacteria | 5596 |
| 46 | Ga0055542_1010441 | 3300003762 | Bacteria | 1696 |
| 47 | Ga0055529_1000083 | 3300003763 | Bacteria | 146729 |
| 48 | Ga0055529_1000305 | 3300003763 | Bacteria | 56629 |
| 49 | Ga0055529_1000343 | 3300003763 | Bacteria | 51957 |
| 50 | Ga0055529_1000443 | 3300003763 | Bacteria | 41149 |
| 51 | Ga0055529_1000667 | 3300003763 | Bacteria | 24036 |
| 52 | Ga0055534_1012094 | 3300003784 | Bacteria | 1724 |
| 53 | Ga0055528_1026599 | 3300003790 | Bacteria | 1655 |
| 54 | Ga0055531_10011520 | 3300003794 | Bacteria | 4251 |
| 55 | Ga0065165_1003017 | 3300005262 | Bacteria | 12699 |
| 56 | Ga0070658_10084617 | 3300005327 | Bacteria | 2608 |
| 57 | Ga0070676_10073029 | 3300005328 | Bacteria | 2063 |
| 58 | Ga0070683_100510265 | 3300005329 | Bacteria | 1149 |
| 59 | Ga0070670_100457303 | 3300005331 | Bacteria | 1132 |
| 60 | Ga0068869_100029649 | 3300005334 | Bacteria | 3836 |
| 61 | Ga0070666_10000005 | 3300005335 | Bacteria | 343092 |
| 62 | Ga0070666_10158341 | 3300005335 | Bacteria | 1582 |
| 63 | Ga0070680_100171468 | 3300005336 | Bacteria | 1826 |
| 64 | Ga0070682_100222268 | 3300005337 | Bacteria | 1345 |
| 65 | Ga0068868_100127646 | 3300005338 | Bacteria | 2079 |
| 66 | Ga0070660_100014647 | 3300005339 | Bacteria | 5656 |
| 67 | Ga0070660_100060185 | 3300005339 | Bacteria | 2947 |
| 68 | Ga0070660_100263617 | 3300005339 | Bacteria | 1407 |
| 69 | Ga0070660_101233886 | 3300005339 | Bacteria | 634 |
| 70 | Ga0070691_10927065 | 3300005341 | Bacteria | 539 |
| 71 | Ga0070661_100037225 | 3300005344 | Bacteria | 3539 |
| 72 | Ga0070661_100101390 | 3300005344 | Bacteria | 2141 |
| 73 | Ga0070661_100412929 | 3300005344 | Bacteria | 1069 |
| 74 | Ga0070692_10003905 | 3300005345 | Bacteria | 6145 |
| 75 | Ga0070692_10638255 | 3300005345 | Bacteria | 709 |
| 76 | Ga0070668_100047703 | 3300005347 | Bacteria | 3293 |
| 77 | Ga0070669_100084069 | 3300005353 | Bacteria | 2374 |
| 78 | Ga0070671_100398732 | 3300005355 | Bacteria | 1177 |
| 79 | Ga0070688_100379867 | 3300005365 | Bacteria | 1041 |
| 80 | Ga0070659_100002615 | 3300005366 | Bacteria | 12808 |
| 81 | Ga0070659_100010942 | 3300005366 | Bacteria | 6696 |
| 82 | Ga0070659_100429987 | 3300005366 | Bacteria | 1117 |
| 83 | Ga0070659_100535392 | 3300005366 | Bacteria | 1001 |
| 84 | Ga0070659_100828250 | 3300005366 | Bacteria | 806 |
| 85 | Ga0070667_100268654 | 3300005367 | Bacteria | 1529 |
| 86 | Ga0070667_101052342 | 3300005367 | Bacteria | 760 |
| 87 | Ga0070714_100000034 | 3300005435 | Bacteria | 130742 |
| 88 | Ga0070714_101766067 | 3300005435 | Bacteria | 604 |
| 89 | Ga0070710_10241069 | 3300005437 | Bacteria | 1158 |
| 90 | Ga0070711_100053534 | 3300005439 | Bacteria | 2782 |
| 91 | Ga0070711_100788002 | 3300005439 | Bacteria | 805 |
| 92 | Ga0070694_100133139 | 3300005444 | Bacteria | 1798 |
| 93 | Ga0070678_100002303 | 3300005456 | Bacteria | 10412 |
| 94 | Ga0070662_100039345 | 3300005457 | Bacteria | 3362 |
| 95 | Ga0070662_100273719 | 3300005457 | Bacteria | 1364 |
| 96 | Ga0070662_100867638 | 3300005457 | Bacteria | 769 |
| 97 | Ga0070681_10001208 | 3300005458 | Bacteria | 22475 |
| 98 | Ga0070681_10011042 | 3300005458 | Bacteria | 8930 |
| 99 | Ga0070681_10012125 | 3300005458 | Bacteria | 8550 |
| 100 | Ga0068867_100868889 | 3300005459 | Bacteria | 809 |
| 101 | Ga0068867_101820985 | 3300005459 | Bacteria | 573 |
| 102 | Ga0070679_100002407 | 3300005530 | Bacteria | 16967 |
| 103 | Ga0070679_100025171 | 3300005530 | Bacteria | 5838 |
| 104 | Ga0070679_100137234 | 3300005530 | Bacteria | 2427 |
| 105 | Ga0070679_100914185 | 3300005530 | Bacteria | 821 |
| 106 | Ga0070684_101913831 | 3300005535 | Bacteria | 560 |
| 107 | Ga0068853_100003663 | 3300005539 | Bacteria | 11785 |
| 108 | Ga0068853_100076470 | 3300005539 | Bacteria | 2923 |
| 109 | Ga0068853_100147205 | 3300005539 | Bacteria | 2117 |
| 110 | Ga0070696_100001218 | 3300005546 | Bacteria | 16719 |
| 111 | Ga0070696_100011587 | 3300005546 | Bacteria | 5908 |
| 112 | Ga0070696_100027352 | 3300005546 | Bacteria | 3885 |
| 113 | Ga0070693_100023546 | 3300005547 | Bacteria | 3293 |
| 114 | Ga0070693_100045860 | 3300005547 | Bacteria | 2480 |
| 115 | Ga0070693_100310412 | 3300005547 | Bacteria | 1066 |
| 116 | Ga0070665_100018710 | 3300005548 | Bacteria | 6945 |
| 117 | Ga0070665_100101467 | 3300005548 | Bacteria | 2881 |
| 118 | Ga0068855_100015915 | 3300005563 | Bacteria | 9048 |
| 119 | Ga0068855_100102918 | 3300005563 | Bacteria | 3286 |
| 120 | Ga0068855_100281616 | 3300005563 | Bacteria | 1846 |
| 121 | Ga0070664_100943826 | 3300005564 | Bacteria | 810 |
| 122 | Ga0068857_100011171 | 3300005577 | Bacteria | 7809 |
| 123 | Ga0068857_100014459 | 3300005577 | Bacteria | 6886 |
| 124 | Ga0068857_100136395 | 3300005577 | Bacteria | 2215 |
| 125 | Ga0068857_100213911 | 3300005577 | Bacteria | 1759 |
| 126 | Ga0068854_100013946 | 3300005578 | Bacteria | 5287 |
| 127 | Ga0068854_100015759 | 3300005578 | Bacteria | 5019 |
| 128 | Ga0068854_100115542 | 3300005578 | Bacteria | 2030 |
| 129 | Ga0068854_100819998 | 3300005578 | Bacteria | 812 |
| 130 | Ga0068856_100011722 | 3300005614 | Bacteria | 8502 |
| 131 | Ga0068856_100014629 | 3300005614 | Bacteria | 7581 |
| 132 | Ga0068856_100036247 | 3300005614 | Bacteria | 4836 |
| 133 | Ga0068856_100544617 | 3300005614 | Bacteria | 1182 |
| 134 | Ga0068856_100564780 | 3300005614 | Bacteria | 1159 |
| 135 | Ga0068852_100161254 | 3300005616 | Bacteria | 2094 |
| 136 | Ga0068859_100291417 | 3300005617 | Bacteria | 1725 |
| 137 | Ga0068859_101109272 | 3300005617 | Bacteria | 870 |
| 138 | Ga0068859_101992271 | 3300005617 | Bacteria | 641 |
| 139 | Ga0068866_10388608 | 3300005718 | Bacteria | 897 |
| 140 | Ga0068851_10437507 | 3300005834 | Bacteria | 775 |
| 141 | Ga0068870_10007797 | 3300005840 | Bacteria | 4789 |
| 142 | Ga0068858_100080401 | 3300005842 | Bacteria | 3028 |
| 143 | Ga0068858_101326167 | 3300005842 | Bacteria | 708 |
| 144 | Ga0068860_100158982 | 3300005843 | Bacteria | 2178 |
| 145 | Ga0068860_100549344 | 3300005843 | Bacteria | 1157 |
| 146 | Ga0068862_101094638 | 3300005844 | Bacteria | 792 |
| 147 | Ga0068862_101456606 | 3300005844 | Bacteria | 689 |
| 148 | Ga0075369_10071843 | 3300006186 | Bacteria | 1524 |
| 149 | Ga0068871_100154215 | 3300006358 | Bacteria | 1960 |
| 150 | Ga0068865_100005258 | 3300006881 | Bacteria | 7826 |
| 151 | Ga0068865_100089935 | 3300006881 | Bacteria | 2225 |
| 152 | Ga0097620_100291415 | 3300006931 | Bacteria | 1725 |
| 153 | Ga0097620_101109262 | 3300006931 | Bacteria | 870 |
| 154 | Ga0097620_101992159 | 3300006931 | Bacteria | 641 |
| 155 | Ga0105240_10128165 | 3300009093 | Bacteria | 3047 |
| 156 | Ga0105240_12100020 | 3300009093 | Bacteria | 586 |
| 157 | Ga0105245_11449815 | 3300009098 | Bacteria | 737 |
| 158 | Ga0105241_10196666 | 3300009174 | Bacteria | 1681 |
| 159 | Ga0105241_11198595 | 3300009174 | Bacteria | 719 |
| 160 | Ga0105242_10329868 | 3300009176 | Bacteria | 1403 |
| 161 | Ga0105237_10066156 | 3300009545 | Bacteria | 3610 |
| 162 | Ga0105237_10136351 | 3300009545 | Bacteria | 2448 |
| 163 | Ga0105237_11818842 | 3300009545 | Bacteria | 617 |
| 164 | Ga0105238_10000060 | 3300009551 | Bacteria | 129934 |
| 165 | Ga0105238_10001388 | 3300009551 | Bacteria | 24287 |
| 166 | Ga0105238_10012789 | 3300009551 | Bacteria | 8470 |
| 167 | Ga0105238_10069871 | 3300009551 | Bacteria | 3512 |
| 168 | Ga0105238_10130701 | 3300009551 | Bacteria | 2489 |
| 169 | Ga0105147_101220 | 3300009982 | Bacteria | 2067 |
| 170 | Ga0105239_10045014 | 3300010375 | Bacteria | 4837 |
| 171 | Ga0105239_10176072 | 3300010375 | Bacteria | 2393 |
| 172 | Ga0157373_10002017 | 3300013100 | Bacteria | 15391 |
| 173 | Ga0157373_10029000 | 3300013100 | Bacteria | 3989 |
| 174 | Ga0157373_10362225 | 3300013100 | Bacteria | 1035 |
| 175 | Ga0157371_10005539 | 3300013102 | Bacteria | 10625 |
| 176 | Ga0157370_10001227 | 3300013104 | Bacteria | 32113 |
| 177 | Ga0157370_10001569 | 3300013104 | Bacteria | 28272 |
| 178 | Ga0157370_10011574 | 3300013104 | Bacteria | 9209 |
| 179 | Ga0157370_10011968 | 3300013104 | Bacteria | 9044 |
| 180 | Ga0157369_10008129 | 3300013105 | Bacteria | 12028 |
| 181 | Ga0157374_10027757 | 3300013296 | Bacteria | 5111 |
| 182 | Ga0157378_10530126 | 3300013297 | Bacteria | 1180 |
| 183 | Ga0163162_10000294 | 3300013306 | Bacteria | 45823 |
| 184 | Ga0163162_10007449 | 3300013306 | Bacteria | 10644 |
| 185 | Ga0163162_10052559 | 3300013306 | Bacteria | 4092 |
| 186 | Ga0163162_10561032 | 3300013306 | Bacteria | 1269 |
| 187 | Ga0157372_10008772 | 3300013307 | Bacteria | 10737 |
| 188 | Ga0157372_10089260 | 3300013307 | Bacteria | 3502 |
| 189 | Ga0157372_10426742 | 3300013307 | Bacteria | 1545 |
| 190 | Ga0157372_10594097 | 3300013307 | Bacteria | 1290 |
| 191 | Ga0157372_10876806 | 3300013307 | Bacteria | 1042 |
| 192 | Ga0157375_12525027 | 3300013308 | Bacteria | 614 |
| 193 | Ga0182008_10004760 | 3300014497 | Bacteria | 7858 |
| 194 | Ga0182008_10007657 | 3300014497 | Bacteria | 5952 |
| 195 | Ga0182008_10228507 | 3300014497 | Bacteria | 954 |
| 196 | Ga0182008_10462063 | 3300014497 | Bacteria | 692 |
| 197 | Ga0157379_11703261 | 3300014968 | Bacteria | 618 |
| 198 | Ga0157376_10007093 | 3300014969 | Bacteria | 7956 |
| 199 | Ga0157376_10058476 | 3300014969 | Bacteria | 3229 |
| 200 | Ga0182006_1006458 | 3300015261 | Bacteria | 5447 |
| 201 | Ga0182006_1019261 | 3300015261 | Bacteria | 2874 |
| 202 | Ga0182006_1019850 | 3300015261 | Bacteria | 2823 |
| 203 | Ga0182007_10049487 | 3300015262 | Bacteria | 1388 |
| 204 | Ga0182007_10091395 | 3300015262 | Bacteria | 1002 |
| 205 | Ga0182007_10112168 | 3300015262 | Bacteria | 908 |
| 206 | Ga0182005_1002081 | 3300015265 | Bacteria | 7458 |
| 207 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 208 | Ga0206356_10558970 | 3300020070 | Bacteria | 3412 |
| 209 | Ga0206351_10475332 | 3300020077 | Bacteria | 807 |
| 210 | Ga0213876_10098043 | 3300021384 | Bacteria | 1553 |
| 211 | Ga0224712_10091259 | 3300022467 | Bacteria | 1276 |
| 212 | Ga0224712_10211084 | 3300022467 | Bacteria | 885 |
| 213 | Ga0209435_102859 | 3300025206 | Bacteria | 1996 |
| 214 | Ga0209435_112230 | 3300025206 | Bacteria | 920 |
| 215 | Ga0209435_112906 | 3300025206 | Bacteria | 890 |
| 216 | Ga0209760_100373 | 3300025207 | Bacteria | 11781 |
| 217 | Ga0209784_100016 | 3300025224 | Bacteria | 481036 |
| 218 | Ga0209566_101739 | 3300025225 | Bacteria | 5233 |
| 219 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 220 | Ga0209674_100244 | 3300025226 | Bacteria | 45968 |
| 221 | Ga0209674_100318 | 3300025226 | Bacteria | 31053 |
| 222 | Ga0209674_100489 | 3300025226 | Bacteria | 16826 |
| 223 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 224 | Ga0209672_100078 | 3300025228 | Bacteria | 156926 |
| 225 | Ga0209672_100265 | 3300025228 | Bacteria | 38562 |
| 226 | Ga0209672_100885 | 3300025228 | Bacteria | 13666 |
| 227 | Ga0209672_101218 | 3300025228 | Bacteria | 10392 |
| 228 | Ga0209563_100079 | 3300025230 | Bacteria | 203017 |
| 229 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 230 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 231 | Ga0207427_100050 | 3300025231 | Bacteria | 227233 |
| 232 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 233 | Ga0207427_106794 | 3300025231 | Bacteria | 1407 |
| 234 | Ga0209437_100012 | 3300025233 | Bacteria | 792625 |
| 235 | Ga0209437_100105 | 3300025233 | Bacteria | 220034 |
| 236 | Ga0209437_100120 | 3300025233 | Bacteria | 205054 |
| 237 | Ga0209437_100192 | 3300025233 | Bacteria | 122888 |
| 238 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 239 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 240 | Ga0209258_100039 | 3300025242 | Bacteria | 386366 |
| 241 | Ga0209258_100046 | 3300025242 | Bacteria | 369794 |
| 242 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 243 | Ga0209258_100238 | 3300025242 | Bacteria | 102043 |
| 244 | Ga0209258_100308 | 3300025242 | Bacteria | 77195 |
| 245 | Ga0209646_1000582 | 3300025246 | Bacteria | 15094 |
| 246 | Ga0209646_1000774 | 3300025246 | Bacteria | 11002 |
| 247 | Ga0209646_1000800 | 3300025246 | Bacteria | 10718 |
| 248 | Ga0209026_1000012 | 3300025250 | Bacteria | 480426 |
| 249 | Ga0209026_1000140 | 3300025250 | Bacteria | 115081 |
| 250 | Ga0209026_1000158 | 3300025250 | Bacteria | 106333 |
| 251 | Ga0209026_1000249 | 3300025250 | Bacteria | 68455 |
| 252 | Ga0209026_1000623 | 3300025250 | Bacteria | 22318 |
| 253 | Ga0209026_1001417 | 3300025250 | Bacteria | 10663 |
| 254 | Ga0209677_102724 | 3300025253 | Bacteria | 6342 |
| 255 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 256 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 257 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 258 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 259 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 260 | Ga0209148_1000098 | 3300025254 | Bacteria | 233172 |
| 261 | Ga0209148_1000800 | 3300025254 | Bacteria | 23023 |
| 262 | Ga0209759_1000750 | 3300025256 | Bacteria | 28083 |
| 263 | Ga0209759_1002324 | 3300025256 | Bacteria | 8531 |
| 264 | Ga0209759_1003101 | 3300025256 | Bacteria | 6824 |
| 265 | Ga0209759_1005416 | 3300025256 | Bacteria | 4477 |
| 266 | Ga0209129_1005552 | 3300025258 | Bacteria | 4407 |
| 267 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 268 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 269 | Ga0209233_1000174 | 3300025261 | Bacteria | 144639 |
| 270 | Ga0209233_1000184 | 3300025261 | Bacteria | 134246 |
| 271 | Ga0209233_1000283 | 3300025261 | Bacteria | 70137 |
| 272 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 273 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 274 | Ga0209455_1000039 | 3300025272 | Bacteria | 437734 |
| 275 | Ga0209455_1000126 | 3300025272 | Bacteria | 165771 |
| 276 | Ga0209455_1000225 | 3300025272 | Bacteria | 76514 |
| 277 | Ga0209455_1002762 | 3300025272 | Bacteria | 6578 |
| 278 | Ga0209455_1017613 | 3300025272 | Bacteria | 1492 |
| 279 | Ga0209455_1025444 | 3300025272 | Bacteria | 1076 |
| 280 | Ga0209673_1006698 | 3300025273 | Bacteria | 5497 |
| 281 | Ga0209130_1007294 | 3300025284 | Bacteria | 3433 |
| 282 | Ga0209676_1004522 | 3300025292 | Bacteria | 7706 |
| 283 | Ga0209676_1100738 | 3300025292 | Bacteria | 615 |
| 284 | Ga0209025_1014734 | 3300025294 | Bacteria | 4780 |
| 285 | Ga0209025_1088587 | 3300025294 | Bacteria | 1020 |
| 286 | Ga0209758_1000683 | 3300025297 | Bacteria | 50557 |
| 287 | Ga0209758_1036407 | 3300025297 | Bacteria | 1921 |
| 288 | Ga0209758_1069191 | 3300025297 | Bacteria | 1120 |
| 289 | Ga0209050_1002075 | 3300025298 | Bacteria | 18403 |
| 290 | Ga0209050_1085080 | 3300025298 | Bacteria | 662 |
| 291 | Ga0209256_1004463 | 3300025299 | Bacteria | 8757 |
| 292 | Ga0209256_1005209 | 3300025299 | Bacteria | 7637 |
| 293 | Ga0209256_1005400 | 3300025299 | Bacteria | 7387 |
| 294 | Ga0209051_1038870 | 3300025303 | Bacteria | 1726 |
| 295 | Ga0209257_1000080 | 3300025304 | Bacteria | 312038 |
| 296 | Ga0209257_1001547 | 3300025304 | Bacteria | 26709 |
| 297 | Ga0209257_1008506 | 3300025304 | Bacteria | 5806 |
| 298 | Ga0209257_1029183 | 3300025304 | Bacteria | 1801 |
| 299 | Ga0207656_10299258 | 3300025321 | Bacteria | 796 |
| 300 | Ga0207692_10213131 | 3300025898 | Bacteria | 1141 |
| 301 | Ga0207642_10548362 | 3300025899 | Bacteria | 714 |
| 302 | Ga0207647_10001002 | 3300025904 | Bacteria | 21914 |
| 303 | Ga0207647_10004453 | 3300025904 | Bacteria | 10383 |
| 304 | Ga0207647_10008693 | 3300025904 | Bacteria | 7255 |
| 305 | Ga0207647_10083343 | 3300025904 | Bacteria | 1915 |
| 306 | Ga0207645_10082788 | 3300025907 | Bacteria | 2057 |
| 307 | Ga0207645_10308190 | 3300025907 | Bacteria | 1055 |
| 308 | Ga0207643_10229213 | 3300025908 | Bacteria | 1139 |
| 309 | Ga0207705_10067253 | 3300025909 | Bacteria | 2593 |
| 310 | Ga0207705_10284209 | 3300025909 | Bacteria | 1267 |
| 311 | Ga0207654_10360826 | 3300025911 | Bacteria | 1002 |
| 312 | Ga0207707_10006292 | 3300025912 | Bacteria | 10367 |
| 313 | Ga0207707_10009177 | 3300025912 | Bacteria | 8588 |
| 314 | Ga0207707_10023879 | 3300025912 | Bacteria | 5347 |
| 315 | Ga0207707_10038212 | 3300025912 | Bacteria | 4195 |
| 316 | Ga0207707_10040851 | 3300025912 | Bacteria | 4050 |
| 317 | Ga0207695_10002599 | 3300025913 | Bacteria | 26471 |
| 318 | Ga0207695_10080851 | 3300025913 | Bacteria | 3290 |
| 319 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 320 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 321 | Ga0207671_10496407 | 3300025914 | Bacteria | 973 |
| 322 | Ga0207663_10027658 | 3300025916 | Bacteria | 3309 |
| 323 | Ga0207663_10680632 | 3300025916 | Bacteria | 813 |
| 324 | Ga0207660_10045374 | 3300025917 | Bacteria | 3096 |
| 325 | Ga0207660_10148084 | 3300025917 | Bacteria | 1801 |
| 326 | Ga0207660_10816721 | 3300025917 | Bacteria | 761 |
| 327 | Ga0207657_10024017 | 3300025919 | Bacteria | 5660 |
| 328 | Ga0207657_10045229 | 3300025919 | Bacteria | 3865 |
| 329 | Ga0207657_10050843 | 3300025919 | Bacteria | 3604 |
| 330 | Ga0207657_10131673 | 3300025919 | Bacteria | 2049 |
| 331 | Ga0207657_10346073 | 3300025919 | Bacteria | 1173 |
| 332 | Ga0207657_10906164 | 3300025919 | Bacteria | 679 |
| 333 | Ga0207649_10048455 | 3300025920 | Bacteria | 2621 |
| 334 | Ga0207649_10316864 | 3300025920 | Bacteria | 1145 |
| 335 | Ga0207649_11178135 | 3300025920 | Bacteria | 605 |
| 336 | Ga0207652_10001336 | 3300025921 | Bacteria | 21912 |
| 337 | Ga0207652_10020621 | 3300025921 | Bacteria | 5431 |
| 338 | Ga0207652_10064579 | 3300025921 | Bacteria | 3167 |
| 339 | Ga0207652_10072216 | 3300025921 | Bacteria | 3001 |
| 340 | Ga0207681_10073632 | 3300025923 | Bacteria | 2390 |
| 341 | Ga0207694_10007514 | 3300025924 | Bacteria | 8262 |
| 342 | Ga0207694_10131346 | 3300025924 | Bacteria | 2007 |
| 343 | Ga0207694_10161066 | 3300025924 | Bacteria | 1812 |
| 344 | Ga0207694_10433922 | 3300025924 | Bacteria | 1095 |
| 345 | Ga0207694_10784292 | 3300025924 | Bacteria | 805 |
| 346 | Ga0207694_10971648 | 3300025924 | Bacteria | 718 |
| 347 | Ga0207659_10490179 | 3300025926 | Bacteria | 1039 |
| 348 | Ga0207700_10068954 | 3300025928 | Bacteria | 2712 |
| 349 | Ga0207700_10304051 | 3300025928 | Bacteria | 1378 |
| 350 | Ga0207700_10711552 | 3300025928 | Bacteria | 897 |
| 351 | Ga0207664_10000021 | 3300025929 | Bacteria | 216875 |
| 352 | Ga0207664_10006216 | 3300025929 | Bacteria | 8201 |
| 353 | Ga0207690_10002181 | 3300025932 | Bacteria | 11936 |
| 354 | Ga0207690_10011077 | 3300025932 | Bacteria | 5378 |
| 355 | Ga0207690_10012273 | 3300025932 | Bacteria | 5127 |
| 356 | Ga0207690_10033257 | 3300025932 | Bacteria | 3314 |
| 357 | Ga0207690_10053311 | 3300025932 | Bacteria | 2713 |
| 358 | Ga0207690_10082830 | 3300025932 | Bacteria | 2244 |
| 359 | Ga0207690_11375325 | 3300025932 | Bacteria | 590 |
| 360 | Ga0207706_10058024 | 3300025933 | Bacteria | 3410 |
| 361 | Ga0207706_10062092 | 3300025933 | Bacteria | 3291 |
| 362 | Ga0207706_10354799 | 3300025933 | Bacteria | 1275 |
| 363 | Ga0207686_10203020 | 3300025934 | Bacteria | 1421 |
| 364 | Ga0207704_10009145 | 3300025938 | Bacteria | 4767 |
| 365 | Ga0207689_10007944 | 3300025942 | Bacteria | 9266 |
| 366 | Ga0207661_10310746 | 3300025944 | Bacteria | 1415 |
| 367 | Ga0207679_11224884 | 3300025945 | Bacteria | 689 |
| 368 | Ga0207667_10000626 | 3300025949 | Bacteria | 45737 |
| 369 | Ga0207667_10003601 | 3300025949 | Bacteria | 19116 |
| 370 | Ga0207667_10013920 | 3300025949 | Bacteria | 9190 |
| 371 | Ga0207667_10032128 | 3300025949 | Bacteria | 5658 |
| 372 | Ga0207667_10457012 | 3300025949 | Bacteria | 1297 |
| 373 | Ga0207668_10012033 | 3300025972 | Bacteria | 5281 |
| 374 | Ga0207640_10011142 | 3300025981 | Bacteria | 5084 |
| 375 | Ga0207640_10032424 | 3300025981 | Bacteria | 3239 |
| 376 | Ga0207640_11318594 | 3300025981 | Bacteria | 645 |
| 377 | Ga0207658_11062045 | 3300025986 | Bacteria | 739 |
| 378 | Ga0207703_10029726 | 3300026035 | Bacteria | 4313 |
| 379 | Ga0207639_10011219 | 3300026041 | Bacteria | 6216 |
| 380 | Ga0207639_10059429 | 3300026041 | Bacteria | 2944 |
| 381 | Ga0207639_10082743 | 3300026041 | Bacteria | 2545 |
| 382 | Ga0207678_10417116 | 3300026067 | Bacteria | 1164 |
| 383 | Ga0207678_10577913 | 3300026067 | Bacteria | 984 |
| 384 | Ga0207702_10000290 | 3300026078 | Bacteria | 58330 |
| 385 | Ga0207702_10002845 | 3300026078 | Bacteria | 16179 |
| 386 | Ga0207702_10010831 | 3300026078 | Bacteria | 7606 |
| 387 | Ga0207702_10132875 | 3300026078 | Bacteria | 2241 |
| 388 | Ga0207702_10454544 | 3300026078 | Bacteria | 1243 |
| 389 | Ga0207641_12001016 | 3300026088 | Bacteria | 581 |
| 390 | Ga0207648_10938767 | 3300026089 | Bacteria | 809 |
| 391 | Ga0207648_11509520 | 3300026089 | Bacteria | 632 |
| 392 | Ga0207674_10000218 | 3300026116 | Bacteria | 71563 |
| 393 | Ga0207674_10022041 | 3300026116 | Bacteria | 6849 |
| 394 | Ga0207674_10030751 | 3300026116 | Bacteria | 5643 |
| 395 | Ga0207674_10173995 | 3300026116 | Bacteria | 2105 |
| 396 | Ga0207674_10853495 | 3300026116 | Bacteria | 878 |
| 397 | Ga0207683_10017401 | 3300026121 | Bacteria | 6127 |
| 398 | Ga0207683_10949973 | 3300026121 | Bacteria | 798 |
| 399 | Ga0207698_10002678 | 3300026142 | Bacteria | 10595 |
| 400 | Ga0207698_10053589 | 3300026142 | Bacteria | 3098 |
| 401 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 402 | Ga0268266_10116506 | 3300028379 | Bacteria | 2373 |
| 403 | Ga0268265_10152465 | 3300028380 | Bacteria | 1951 |
| 404 | Ga0268265_11522866 | 3300028380 | Bacteria | 673 |
| 405 | Ga0268264_10483350 | 3300028381 | Bacteria | 1205 |
| 406 | Ga0265338_10278542 | 3300028800 | Bacteria | 1223 |
| 407 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 408 | Ga0316176_1035937 | 3300030732 | Bacteria | 797 |
| 409 | Ga0316182_1248774 | 3300030745 | Bacteria | 1736 |
| 410 | Ga0307408_101438578 | 3300031548 | Bacteria | 650 |
| 411 | Ga0307516_10017807 | 3300031730 | Bacteria | 7399 |
| 412 | Ga0307412_10064358 | 3300031911 | Bacteria | 2477 |
| 413 | Ga0307414_10180206 | 3300032004 | Bacteria | 1698 |
| 414 | Ga0395899_0037966 | 3300037312 | Bacteria | 3610 |
| 415 | Ga0395899_0242383 | 3300037312 | Bacteria | 1240 |
| 416 | Ga0395900_0001732 | 3300037418 | Bacteria | 25181 |
| 417 | Ga0395900_0008996 | 3300037418 | Bacteria | 10239 |
| 418 | Ga0395900_0429103 | 3300037418 | Bacteria | 1281 |
| 419 | Ga0395900_1808556 | 3300037418 | Bacteria | 521 |
| 420 | Ga0395898_0006906 | 3300037466 | Bacteria | 12072 |
| 421 | Ga0395898_0012279 | 3300037466 | Bacteria | 8858 |
| 422 | Ga0395898_0117282 | 3300037466 | Bacteria | 2550 |
| 423 | Ga0395898_0126878 | 3300037466 | Bacteria | 2444 |
| 424 | Ga0395905_0142212 | 3300037471 | Bacteria | 2257 |
| 425 | Ga0395901_0004132 | 3300038443 | Bacteria | 14636 |
| 426 | Ga0395901_0030016 | 3300038443 | Bacteria | 5600 |
| 427 | Ga0395901_0082423 | 3300038443 | Bacteria | 3360 |
| 428 | Ga0395901_0096589 | 3300038443 | Bacteria | 3096 |
| 429 | Ga0395901_0287657 | 3300038443 | Bacteria | 1706 |
| 430 | Ga0395901_1111393 | 3300038443 | Bacteria | 760 |
| 431 | Ga0436365_0650332 | 3300039437 | Bacteria | 1996 |
| 432 | Ga0439436_0000014 | 3300041404 | Bacteria | 90241 |
| 433 | Ga0439465_0000563 | 3300041413 | Bacteria | 11173 |
| 434 | Ga0439465_0012786 | 3300041413 | Bacteria | 2624 |
| 435 | Ga0451789_0513220 | 3300041443 | Bacteria | 768 |
| 436 | Ga0451797_1092716 | 3300041453 | Bacteria | 2294 |
| 437 | Ga0451802_0321649 | 3300041460 | Bacteria | 1182 |
| 438 | Ga0451804_0639808 | 3300041463 | Bacteria | 1200 |
| 439 | Ga0451807_0181925 | 3300041486 | Bacteria | 863 |
| 440 | Ga0451833_0573159 | 3300041491 | Bacteria | 760 |
| 441 | Ga0451837_0118483 | 3300041494 | Bacteria | 1980 |
| 442 | Ga0439445_0006306 | 3300042004 | Bacteria | 2725 |
| 443 | Ga0439449_0000206 | 3300042007 | Bacteria | 20728 |
| 444 | Ga0439455_0101125 | 3300042012 | Bacteria | 797 |
| 445 | Ga0439463_009567 | 3300042016 | Bacteria | 2385 |
| 446 | Ga0466963_0428553 | 3300044694 | Bacteria | 933 |
| 447 | Ga0466963_1247153 | 3300044694 | Bacteria | 522 |
| 448 | Ga0466958_0386443 | 3300045836 | Bacteria | 903 |
| 449 | Ga0466967_0078188 | 3300045976 | Bacteria | 2980 |
| 450 | Ga0495617_000411 | 3300046452 | Bacteria | 23420 |
| 451 | Ga0495651_0790196 | 3300046462 | Bacteria | 586 |
| 452 | Ga0495610_0009510 | 3300046512 | Bacteria | 6135 |
| 453 | Ga0495620_0019985 | 3300046515 | Bacteria | 3279 |
| 454 | Ga0495640_0154904 | 3300046533 | Bacteria | 1471 |
| 455 | Ga0495649_0044419 | 3300046694 | Bacteria | 2426 |
| 456 | Ga0496103_0433442 | 3300048906 | Bacteria | 843 |
| 457 | Ga0496104_0000020 | 3300048907 | Bacteria | 247296 |
| 458 | Ga0496105_0000015 | 3300048908 | Bacteria | 218758 |
| 459 | Ga0496115_0000176 | 3300048918 | Bacteria | 59595 |
| 460 | Ga0496116_0108490 | 3300048919 | Bacteria | 1639 |
| 461 | Ga0496116_0146827 | 3300048919 | Bacteria | 1317 |
| 462 | Ga0496118_0042257 | 3300048921 | Bacteria | 3598 |
| 463 | Ga0496118_0073288 | 3300048921 | Bacteria | 2454 |
| 464 | Ga0496119_0019183 | 3300048922 | Bacteria | 5051 |
| 465 | Ga0496120_0302563 | 3300048923 | Bacteria | 732 |
| 466 | Ga0496123_0007006 | 3300048926 | Bacteria | 10750 |
| 467 | Ga0496126_0000969 | 3300048929 | Bacteria | 49256 |
| 468 | Ga0501031_0077685 | 3300049568 | Bacteria | 2162 |
| 469 | Ga0501032_0082483 | 3300049569 | Bacteria | 2139 |
| 470 | Ga0501032_0255666 | 3300049569 | Bacteria | 1136 |
| 471 | Ga0501033_0013080 | 3300049570 | Bacteria | 6325 |
| 472 | Ga0501033_0075751 | 3300049570 | Bacteria | 2469 |
| 473 | Ga0501034_0057695 | 3300049571 | Bacteria | 3903 |
| 474 | Ga0501034_0062796 | 3300049571 | Bacteria | 3729 |
| 475 | Ga0501034_0339109 | 3300049571 | Bacteria | 1433 |
| 476 | Ga0501034_0929458 | 3300049571 | Bacteria | 756 |
| 477 | Ga0501034_1129674 | 3300049571 | Bacteria | 664 |
| 478 | Ga0501036_0073177 | 3300049572 | Bacteria | 2897 |
| 479 | Ga0501036_0123730 | 3300049572 | Bacteria | 2184 |
| 480 | Ga0501036_0761035 | 3300049572 | Bacteria | 799 |
| 481 | Ga0501037_0024412 | 3300049573 | Bacteria | 4471 |
| 482 | Ga0501037_0051695 | 3300049573 | Bacteria | 3005 |
| 483 | Ga0501037_0280491 | 3300049573 | Bacteria | 1161 |
| 484 | Ga0501038_0069493 | 3300049574 | Bacteria | 2991 |
| 485 | Ga0501038_0073014 | 3300049574 | Bacteria | 2906 |
| 486 | Ga0501038_0110405 | 3300049574 | Bacteria | 2279 |
| 487 | Ga0501039_0035229 | 3300049575 | Bacteria | 3862 |
| 488 | Ga0501039_0295659 | 3300049575 | Bacteria | 1273 |
| 489 | Ga0501040_1358567 | 3300049576 | Bacteria | 516 |
| 490 | Ga0501042_0240640 | 3300049578 | Bacteria | 1306 |
| 491 | Ga0501043_0046571 | 3300049579 | Bacteria | 3410 |
| 492 | Ga0501043_0064230 | 3300049579 | Bacteria | 2882 |
| 493 | Ga0501043_0080958 | 3300049579 | Bacteria | 2551 |
| 494 | Ga0501043_0120480 | 3300049579 | Bacteria | 2057 |
| 495 | Ga0501043_0848273 | 3300049579 | Bacteria | 658 |
| 496 | Ga0501046_0084661 | 3300049580 | Bacteria | 2445 |
| 497 | Ga0501046_0091518 | 3300049580 | Bacteria | 2339 |
| 498 | Ga0501046_0340864 | 3300049580 | Bacteria | 1089 |
| 499 | Ga0501047_0114067 | 3300049581 | Bacteria | 2584 |
| 500 | Ga0501047_0154140 | 3300049581 | Bacteria | 2172 |
| 501 | Ga0501047_0236063 | 3300049581 | Bacteria | 1680 |
| 502 | Ga0501047_0273324 | 3300049581 | Bacteria | 1536 |
| 503 | Ga0501047_0473030 | 3300049581 | Bacteria | 1081 |
| 504 | Ga0501047_0760651 | 3300049581 | Bacteria | 784 |
| 505 | Ga0501047_1236463 | 3300049581 | Unclassified | 561 |
| 506 | Ga0501048_0417828 | 3300049582 | Bacteria | 959 |
| 507 | Ga0501048_0455544 | 3300049582 | Bacteria | 916 |
| 508 | Ga0501069_0159245 | 3300049585 | Bacteria | 1300 |
| 509 | Ga0501070_0062457 | 3300049586 | Bacteria | 3086 |
| 510 | Ga0501070_0139587 | 3300049586 | Bacteria | 2001 |
| 511 | Ga0501070_0284660 | 3300049586 | Bacteria | 1348 |
| 512 | Ga0501073_0141293 | 3300049589 | Bacteria | 1668 |
| 513 | Ga0501073_0191870 | 3300049589 | Bacteria | 1414 |
| 514 | Ga0501074_0158923 | 3300049590 | Bacteria | 1614 |
| 515 | Ga0501225_0012331 | 3300049705 | Bacteria | 2400 |
| 516 | Ga0501079_0461062 | 3300049741 | Bacteria | 998 |
| 517 | Ga0501080_0029389 | 3300049742 | Bacteria | 5116 |
| 518 | Ga0501080_0324732 | 3300049742 | Bacteria | 1393 |
| 519 | Ga0501080_0709886 | 3300049742 | Bacteria | 886 |
| 520 | Ga0501080_0965323 | 3300049742 | Bacteria | 740 |
| 521 | Ga0501035_0007993 | 3300049822 | Bacteria | 9859 |
| 522 | Ga0501035_0035525 | 3300049822 | Bacteria | 4522 |
| 523 | Ga0501035_0081470 | 3300049822 | Bacteria | 2856 |
| 524 | Ga0501035_0455421 | 3300049822 | Bacteria | 1058 |
| 525 | Ga0501035_0661601 | 3300049822 | Bacteria | 846 |
| 526 | Ga0501044_0071730 | 3300049823 | Bacteria | 3521 |
| 527 | Ga0501044_0110801 | 3300049823 | Bacteria | 2753 |
| 528 | Ga0501044_0150356 | 3300049823 | Bacteria | 2311 |
| 529 | Ga0501044_0171681 | 3300049823 | Bacteria | 2139 |
| 530 | Ga0501044_0945359 | 3300049823 | Bacteria | 735 |
| 531 | Ga0501045_0449433 | 3300049824 | Bacteria | 958 |
| 532 | nmdc:mga0sz30_102027_c1 | 3300050516 | Bacteria | 1254 |
| 533 | Ga0587073_0070380 | 3300059492 | Bacteria | 844 |
| 534 | Ga0587080_054436 | 3300059503 | Bacteria | 764 |
| 535 | Ga0587082_034968 | 3300059504 | Bacteria | 895 |
| 536 | Ga0587088_057309 | 3300059508 | Bacteria | 780 |
| 537 | Ga0587067_054114 | 3300059640 | Bacteria | 822 |
| 538 | Ga0587068_087097 | 3300059641 | Bacteria | 639 |
| 539 | Ga0587072_064238 | 3300059643 | Bacteria | 762 |
| 540 | Ga0587078_037262 | 3300059646 | Bacteria | 676 |
| 541 | Ga0587120_010691 | 3300059659 | Bacteria | 780 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8003014200 | 8003016065 | 100 |
| 2 | 3300049580 | Ga0501046_0091518 | Ga0501046_0091518_549_935 | 101 |
| 3 | 3300049581 | Ga0501047_0236063 | Ga0501047_0236063_866_1252 | 101 |
| 4 | 3300005617 | Ga0068859_101109272 | Ga0068859_1011092722 | 102 |
| 5 | 3300005843 | Ga0068860_100549344 | Ga0068860_1005493443 | 102 |
| 6 | 3300006931 | Ga0097620_101109262 | Ga0097620_1011092622 | 102 |
| 7 | 3300028381 | Ga0268264_10483350 | Ga0268264_104833501 | 102 |
| 8 | 3300001989 | JGI24739J22299_10000042 | JGI24739J22299_1000004215 | 103 |
| 9 | 3300001989 | JGI24739J22299_10000091 | JGI24739J22299_1000009117 | 103 |
| 10 | 3300001990 | JGI24737J22298_10002031 | JGI24737J22298_100020318 | 103 |
| 11 | 3300003320 | rootH2_10069172 | rootH2_100691725 | 103 |
| 12 | 3300003578 | Ga0006562J51391_1022432 | Ga0006562J51391_10224323 | 103 |
| 13 | 3300003578 | Ga0006562J51391_1022433 | Ga0006562J51391_10224333 | 103 |
| 14 | 3300003784 | Ga0055534_1012094 | Ga0055534_10120942 | 103 |
| 15 | 3300003790 | Ga0055528_1026599 | Ga0055528_10265993 | 103 |
| 16 | 3300003794 | Ga0055531_10011520 | Ga0055531_100115204 | 103 |
| 17 | 3300005262 | Ga0065165_1003017 | Ga0065165_100301711 | 103 |
| 18 | 3300005336 | Ga0070680_100171468 | Ga0070680_1001714682 | 103 |
| 19 | 3300005339 | Ga0070660_101233886 | Ga0070660_1012338862 | 103 |
| 20 | 3300005344 | Ga0070661_100412929 | Ga0070661_1004129292 | 103 |
| 21 | 3300005366 | Ga0070659_100828250 | Ga0070659_1008282501 | 103 |
| 22 | 3300005457 | Ga0070662_100039345 | Ga0070662_1000393453 | 103 |
| 23 | 3300005457 | Ga0070662_100273719 | Ga0070662_1002737192 | 103 |
| 24 | 3300005458 | Ga0070681_10001208 | Ga0070681_100012085 | 103 |
| 25 | 3300005530 | Ga0070679_100002407 | Ga0070679_10000240713 | 103 |
| 26 | 3300005563 | Ga0068855_100102918 | Ga0068855_1001029183 | 103 |
| 27 | 3300005563 | Ga0068855_100281616 | Ga0068855_1002816162 | 103 |
| 28 | 3300005577 | Ga0068857_100011171 | Ga0068857_1000111719 | 103 |
| 29 | 3300005578 | Ga0068854_100015759 | Ga0068854_1000157594 | 103 |
| 30 | 3300005578 | Ga0068854_100115542 | Ga0068854_1001155423 | 103 |
| 31 | 3300005614 | Ga0068856_100544617 | Ga0068856_1005446171 | 103 |
| 32 | 3300005617 | Ga0068859_101992271 | Ga0068859_1019922712 | 103 |
| 33 | 3300005834 | Ga0068851_10437507 | Ga0068851_104375072 | 103 |
| 34 | 3300005842 | Ga0068858_100080401 | Ga0068858_1000804013 | 103 |
| 35 | 3300006358 | Ga0068871_100154215 | Ga0068871_1001542153 | 103 |
| 36 | 3300006931 | Ga0097620_101992159 | Ga0097620_1019921591 | 103 |
| 37 | 3300009093 | Ga0105240_10128165 | Ga0105240_101281653 | 103 |
| 38 | 3300013104 | Ga0157370_10001569 | Ga0157370_1000156911 | 103 |
| 39 | 3300013297 | Ga0157378_10530126 | Ga0157378_105301263 | 103 |
| 40 | 3300013306 | Ga0163162_10007449 | Ga0163162_1000744911 | 103 |
| 41 | 3300013306 | Ga0163162_10561032 | Ga0163162_105610323 | 103 |
| 42 | 3300013307 | Ga0157372_10089260 | Ga0157372_100892604 | 103 |
| 43 | 3300014969 | Ga0157376_10007093 | Ga0157376_100070931 | 103 |
| 44 | 3300022467 | Ga0224712_10211084 | Ga0224712_102110842 | 103 |
| 45 | 3300025258 | Ga0209129_1005552 | Ga0209129_10055526 | 103 |
| 46 | 3300025273 | Ga0209673_1006698 | Ga0209673_10066985 | 103 |
| 47 | 3300025284 | Ga0209130_1007294 | Ga0209130_10072944 | 103 |
| 48 | 3300025292 | Ga0209676_1004522 | Ga0209676_10045227 | 103 |
| 49 | 3300025292 | Ga0209676_1100738 | Ga0209676_11007381 | 103 |
| 50 | 3300025294 | Ga0209025_1014734 | Ga0209025_10147341 | 103 |
| 51 | 3300025294 | Ga0209025_1088587 | Ga0209025_10885872 | 103 |
| 52 | 3300025297 | Ga0209758_1000683 | Ga0209758_100068352 | 103 |
| 53 | 3300025297 | Ga0209758_1069191 | Ga0209758_10691913 | 103 |
| 54 | 3300025298 | Ga0209050_1002075 | Ga0209050_100207520 | 103 |
| 55 | 3300025298 | Ga0209050_1085080 | Ga0209050_10850802 | 103 |
| 56 | 3300025299 | Ga0209256_1004463 | Ga0209256_10044638 | 103 |
| 57 | 3300025299 | Ga0209256_1005209 | Ga0209256_10052092 | 103 |
| 58 | 3300025299 | Ga0209256_1005400 | Ga0209256_10054002 | 103 |
| 59 | 3300025303 | Ga0209051_1038870 | Ga0209051_10388703 | 103 |
| 60 | 3300025304 | Ga0209257_1000080 | Ga0209257_1000080145 | 103 |
| 61 | 3300025304 | Ga0209257_1001547 | Ga0209257_100154711 | 103 |
| 62 | 3300025304 | Ga0209257_1008506 | Ga0209257_10085062 | 103 |
| 63 | 3300025321 | Ga0207656_10299258 | Ga0207656_102992582 | 103 |
| 64 | 3300025904 | Ga0207647_10008693 | Ga0207647_1000869310 | 103 |
| 65 | 3300025912 | Ga0207707_10040851 | Ga0207707_100408511 | 103 |
| 66 | 3300025913 | Ga0207695_10002599 | Ga0207695_1000259934 | 103 |
| 67 | 3300025913 | Ga0207695_10080851 | Ga0207695_100808513 | 103 |
| 68 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020244 | 103 |
| 69 | 3300025914 | Ga0207671_10000033 | Ga0207671_1000003312 | 103 |
| 70 | 3300025917 | Ga0207660_10148084 | Ga0207660_101480843 | 103 |
| 71 | 3300025919 | Ga0207657_10906164 | Ga0207657_109061641 | 103 |
| 72 | 3300025920 | Ga0207649_10316864 | Ga0207649_103168642 | 103 |
| 73 | 3300025921 | Ga0207652_10001336 | Ga0207652_1000133612 | 103 |
| 74 | 3300025924 | Ga0207694_10784292 | Ga0207694_107842922 | 103 |
| 75 | 3300025932 | Ga0207690_11375325 | Ga0207690_113753251 | 103 |
| 76 | 3300025933 | Ga0207706_10062092 | Ga0207706_100620924 | 103 |
| 77 | 3300025945 | Ga0207679_11224884 | Ga0207679_112248842 | 103 |
| 78 | 3300025949 | Ga0207667_10000626 | Ga0207667_100006263 | 103 |
| 79 | 3300025949 | Ga0207667_10003601 | Ga0207667_1000360112 | 103 |
| 80 | 3300025981 | Ga0207640_10011142 | Ga0207640_100111424 | 103 |
| 81 | 3300025981 | Ga0207640_10032424 | Ga0207640_100324243 | 103 |
| 82 | 3300026035 | Ga0207703_10029726 | Ga0207703_100297264 | 103 |
| 83 | 3300026078 | Ga0207702_10454544 | Ga0207702_104545442 | 103 |
| 84 | 3300026116 | Ga0207674_10000218 | Ga0207674_1000021856 | 103 |
| 85 | 3300026142 | Ga0207698_10002678 | Ga0207698_100026789 | 103 |
| 86 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016180 | 103 |
| 87 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015390 | 103 |
| 88 | 3300031548 | Ga0307408_101438578 | Ga0307408_1014385782 | 103 |
| 89 | 3300041443 | Ga0451789_0513220 | Ga0451789_0513220_350_742 | 103 |
| 90 | 3300041453 | Ga0451797_1092716 | Ga0451797_1092716_745_1137 | 103 |
| 91 | 3300041460 | Ga0451802_0321649 | Ga0451802_0321649_117_512 | 103 |
| 92 | 3300044694 | Ga0466963_1247153 | Ga0466963_1247153_94_483 | 103 |
| 93 | 3300045836 | Ga0466958_0386443 | Ga0466958_0386443_154_543 | 103 |
| 94 | 3300049579 | Ga0501043_0120480 | Ga0501043_0120480_860_1267 | 103 |
| 95 | 3300049581 | Ga0501047_0473030 | Ga0501047_0473030_503_895 | 103 |
| 96 | 3300049581 | Ga0501047_1236463 | Ga0501047_1236463_19_408 | 103 |
| 97 | 3300049585 | Ga0501069_0159245 | Ga0501069_0159245_261_650 | 103 |
| 98 | 3300049589 | Ga0501073_0191870 | Ga0501073_0191870_680_1069 | 103 |
| 99 | 3300049590 | Ga0501074_0158923 | Ga0501074_0158923_1140_1529 | 103 |
| 100 | 3300049742 | Ga0501080_0324732 | Ga0501080_0324732_798_1190 | 103 |
| 101 | 3300049742 | Ga0501080_0965323 | Ga0501080_0965323_168_557 | 103 |
| 102 | 3300049822 | Ga0501035_0081470 | Ga0501035_0081470_1775_2167 | 103 |
| 103 | 3300049823 | Ga0501044_0110801 | Ga0501044_0110801_1906_2298 | 103 |
| 104 | 3300059492 | Ga0587073_0070380 | Ga0587073_0070380_86_478 | 103 |
| 105 | 3300059503 | Ga0587080_054436 | Ga0587080_054436_263_655 | 103 |
| 106 | 3300059504 | Ga0587082_034968 | Ga0587082_034968_265_657 | 103 |
| 107 | 3300059508 | Ga0587088_057309 | Ga0587088_057309_124_516 | 103 |
| 108 | 3300059640 | Ga0587067_054114 | Ga0587067_054114_166_558 | 103 |
| 109 | 3300059641 | Ga0587068_087097 | Ga0587068_087097_233_625 | 103 |
| 110 | 3300059643 | Ga0587072_064238 | Ga0587072_064238_261_653 | 103 |
| 111 | 3300059646 | Ga0587078_037262 | Ga0587078_037262_265_657 | 103 |
| 112 | 3300059659 | Ga0587120_010691 | Ga0587120_010691_124_516 | 103 |
| 113 | 3300001990 | JGI24737J22298_10030880 | JGI24737J22298_100308803 | 104 |
| 114 | 3300002067 | JGI24735J21928_10006310 | JGI24735J21928_100063104 | 104 |
| 115 | 3300002737 | JGI25162J39368_1000529 | JGI25162J39368_100052920 | 104 |
| 116 | 3300002741 | JGI25157J39369_1000446 | JGI25157J39369_100044617 | 104 |
| 117 | 3300002741 | JGI25157J39369_1000950 | JGI25157J39369_100095015 | 104 |
| 118 | 3300002741 | JGI25157J39369_1001638 | JGI25157J39369_10016389 | 104 |
| 119 | 3300002741 | JGI25157J39369_1002462 | JGI25157J39369_10024624 | 104 |
| 120 | 3300002741 | JGI25157J39369_1003251 | JGI25157J39369_10032513 | 104 |
| 121 | 3300002771 | JGI25163J39215_1000279 | JGI25163J39215_100027913 | 104 |
| 122 | 3300002771 | JGI25163J39215_1000580 | JGI25163J39215_10005803 | 104 |
| 123 | 3300002772 | JGI25164J39214_1000102 | JGI25164J39214_10001023 | 104 |
| 124 | 3300002772 | JGI25164J39214_1000142 | JGI25164J39214_100014240 | 104 |
| 125 | 3300002772 | JGI25164J39214_1000561 | JGI25164J39214_10005614 | 104 |
| 126 | 3300002772 | JGI25164J39214_1000564 | JGI25164J39214_10005644 | 104 |
| 127 | 3300003214 | JGI25165J46597_1000058 | JGI25165J46597_1000058157 | 104 |
| 128 | 3300003214 | JGI25165J46597_1000090 | JGI25165J46597_100009046 | 104 |
| 129 | 3300003214 | JGI25165J46597_1001122 | JGI25165J46597_100112215 | 104 |
| 130 | 3300003214 | JGI25165J46597_1001290 | JGI25165J46597_100129013 | 104 |
| 131 | 3300003316 | rootH1_10127202 | rootH1_101272022 | 104 |
| 132 | 3300003320 | rootH2_10011619 | rootH2_1001161920 | 104 |
| 133 | 3300003323 | rootH1_10142898 | rootH1_101428983 | 104 |
| 134 | 3300003558 | Ga0006558J51389_1026097 | Ga0006558J51389_10260972 | 104 |
| 135 | 3300003565 | Ga0006560J51390_1026969 | Ga0006560J51390_10269692 | 104 |
| 136 | 3300003567 | Ga0006554J51385_1023919 | Ga0006554J51385_10239192 | 104 |
| 137 | 3300003751 | Ga0055538_1000714 | Ga0055538_10007147 | 104 |
| 138 | 3300003752 | Ga0055539_1000821 | Ga0055539_10008214 | 104 |
| 139 | 3300003760 | Ga0055527_1000105 | Ga0055527_100010520 | 104 |
| 140 | 3300003760 | Ga0055527_1000253 | Ga0055527_100025321 | 104 |
| 141 | 3300003761 | Ga0055535_1000034 | Ga0055535_100003459 | 104 |
| 142 | 3300003761 | Ga0055535_1000150 | Ga0055535_100015050 | 104 |
| 143 | 3300003761 | Ga0055535_1000488 | Ga0055535_100048838 | 104 |
| 144 | 3300003761 | Ga0055535_1000765 | Ga0055535_100076527 | 104 |
| 145 | 3300003761 | Ga0055535_1000789 | Ga0055535_100078922 | 104 |
| 146 | 3300003761 | Ga0055535_1008250 | Ga0055535_10082503 | 104 |
| 147 | 3300003762 | Ga0055542_1000198 | Ga0055542_100019820 | 104 |
| 148 | 3300003762 | Ga0055542_1000685 | Ga0055542_10006857 | 104 |
| 149 | 3300003762 | Ga0055542_1001221 | Ga0055542_100122111 | 104 |
| 150 | 3300003762 | Ga0055542_1002647 | Ga0055542_10026472 | 104 |
| 151 | 3300003762 | Ga0055542_1010441 | Ga0055542_10104411 | 104 |
| 152 | 3300003763 | Ga0055529_1000083 | Ga0055529_1000083158 | 104 |
| 153 | 3300003763 | Ga0055529_1000305 | Ga0055529_100030539 | 104 |
| 154 | 3300003763 | Ga0055529_1000343 | Ga0055529_100034336 | 104 |
| 155 | 3300003763 | Ga0055529_1000443 | Ga0055529_100044346 | 104 |
| 156 | 3300003763 | Ga0055529_1000667 | Ga0055529_100066714 | 104 |
| 157 | 3300005327 | Ga0070658_10084617 | Ga0070658_100846173 | 104 |
| 158 | 3300005328 | Ga0070676_10073029 | Ga0070676_100730293 | 104 |
| 159 | 3300005329 | Ga0070683_100510265 | Ga0070683_1005102653 | 104 |
| 160 | 3300005331 | Ga0070670_100457303 | Ga0070670_1004573032 | 104 |
| 161 | 3300005334 | Ga0068869_100029649 | Ga0068869_1000296491 | 104 |
| 162 | 3300005335 | Ga0070666_10000005 | Ga0070666_10000005214 | 104 |
| 163 | 3300005335 | Ga0070666_10158341 | Ga0070666_101583412 | 104 |
| 164 | 3300005337 | Ga0070682_100222268 | Ga0070682_1002222683 | 104 |
| 165 | 3300005338 | Ga0068868_100127646 | Ga0068868_1001276463 | 104 |
| 166 | 3300005339 | Ga0070660_100014647 | Ga0070660_1000146474 | 104 |
| 167 | 3300005339 | Ga0070660_100060185 | Ga0070660_1000601852 | 104 |
| 168 | 3300005339 | Ga0070660_100263617 | Ga0070660_1002636173 | 104 |
| 169 | 3300005341 | Ga0070691_10927065 | Ga0070691_109270651 | 104 |
| 170 | 3300005344 | Ga0070661_100037225 | Ga0070661_1000372253 | 104 |
| 171 | 3300005344 | Ga0070661_100101390 | Ga0070661_1001013903 | 104 |
| 172 | 3300005345 | Ga0070692_10003905 | Ga0070692_100039053 | 104 |
| 173 | 3300005345 | Ga0070692_10638255 | Ga0070692_106382552 | 104 |
| 174 | 3300005347 | Ga0070668_100047703 | Ga0070668_1000477033 | 104 |
| 175 | 3300005353 | Ga0070669_100084069 | Ga0070669_1000840693 | 104 |
| 176 | 3300005355 | Ga0070671_100398732 | Ga0070671_1003987323 | 104 |
| 177 | 3300005365 | Ga0070688_100379867 | Ga0070688_1003798672 | 104 |
| 178 | 3300005366 | Ga0070659_100002615 | Ga0070659_1000026154 | 104 |
| 179 | 3300005366 | Ga0070659_100010942 | Ga0070659_1000109427 | 104 |
| 180 | 3300005366 | Ga0070659_100429987 | Ga0070659_1004299872 | 104 |
| 181 | 3300005366 | Ga0070659_100535392 | Ga0070659_1005353921 | 104 |
| 182 | 3300005367 | Ga0070667_100268654 | Ga0070667_1002686542 | 104 |
| 183 | 3300005367 | Ga0070667_101052342 | Ga0070667_1010523422 | 104 |
| 184 | 3300005435 | Ga0070714_100000034 | Ga0070714_10000003411 | 104 |
| 185 | 3300005435 | Ga0070714_101766067 | Ga0070714_1017660671 | 104 |
| 186 | 3300005437 | Ga0070710_10241069 | Ga0070710_102410692 | 104 |
| 187 | 3300005439 | Ga0070711_100053534 | Ga0070711_1000535344 | 104 |
| 188 | 3300005439 | Ga0070711_100788002 | Ga0070711_1007880022 | 104 |
| 189 | 3300005444 | Ga0070694_100133139 | Ga0070694_1001331393 | 104 |
| 190 | 3300005456 | Ga0070678_100002303 | Ga0070678_1000023039 | 104 |
| 191 | 3300005457 | Ga0070662_100867638 | Ga0070662_1008676382 | 104 |
| 192 | 3300005458 | Ga0070681_10011042 | Ga0070681_100110426 | 104 |
| 193 | 3300005458 | Ga0070681_10012125 | Ga0070681_100121259 | 104 |
| 194 | 3300005459 | Ga0068867_100868889 | Ga0068867_1008688892 | 104 |
| 195 | 3300005459 | Ga0068867_101820985 | Ga0068867_1018209852 | 104 |
| 196 | 3300005530 | Ga0070679_100025171 | Ga0070679_1000251717 | 104 |
| 197 | 3300005530 | Ga0070679_100137234 | Ga0070679_1001372343 | 104 |
| 198 | 3300005530 | Ga0070679_100914185 | Ga0070679_1009141852 | 104 |
| 199 | 3300005535 | Ga0070684_101913831 | Ga0070684_1019138311 | 104 |
| 200 | 3300005539 | Ga0068853_100003663 | Ga0068853_10000366311 | 104 |
| 201 | 3300005539 | Ga0068853_100076470 | Ga0068853_1000764703 | 104 |
| 202 | 3300005539 | Ga0068853_100147205 | Ga0068853_1001472053 | 104 |
| 203 | 3300005546 | Ga0070696_100001218 | Ga0070696_1000012183 | 104 |
| 204 | 3300005546 | Ga0070696_100011587 | Ga0070696_1000115875 | 104 |
| 205 | 3300005546 | Ga0070696_100027352 | Ga0070696_1000273523 | 104 |
| 206 | 3300005547 | Ga0070693_100023546 | Ga0070693_1000235463 | 104 |
| 207 | 3300005547 | Ga0070693_100045860 | Ga0070693_1000458603 | 104 |
| 208 | 3300005547 | Ga0070693_100310412 | Ga0070693_1003104122 | 104 |
| 209 | 3300005548 | Ga0070665_100018710 | Ga0070665_1000187107 | 104 |
| 210 | 3300005548 | Ga0070665_100101467 | Ga0070665_1001014673 | 104 |
| 211 | 3300005563 | Ga0068855_100015915 | Ga0068855_1000159157 | 104 |
| 212 | 3300005564 | Ga0070664_100943826 | Ga0070664_1009438262 | 104 |
| 213 | 3300005577 | Ga0068857_100014459 | Ga0068857_1000144598 | 104 |
| 214 | 3300005577 | Ga0068857_100136395 | Ga0068857_1001363953 | 104 |
| 215 | 3300005577 | Ga0068857_100213911 | Ga0068857_1002139112 | 104 |
| 216 | 3300005578 | Ga0068854_100013946 | Ga0068854_1000139464 | 104 |
| 217 | 3300005578 | Ga0068854_100819998 | Ga0068854_1008199982 | 104 |
| 218 | 3300005614 | Ga0068856_100011722 | Ga0068856_1000117225 | 104 |
| 219 | 3300005614 | Ga0068856_100014629 | Ga0068856_1000146297 | 104 |
| 220 | 3300005614 | Ga0068856_100564780 | Ga0068856_1005647803 | 104 |
| 221 | 3300005616 | Ga0068852_100161254 | Ga0068852_1001612543 | 104 |
| 222 | 3300005617 | Ga0068859_100291417 | Ga0068859_1002914171 | 104 |
| 223 | 3300005718 | Ga0068866_10388608 | Ga0068866_103886082 | 104 |
| 224 | 3300005840 | Ga0068870_10007797 | Ga0068870_100077974 | 104 |
| 225 | 3300005842 | Ga0068858_101326167 | Ga0068858_1013261672 | 104 |
| 226 | 3300005843 | Ga0068860_100158982 | Ga0068860_1001589821 | 104 |
| 227 | 3300005844 | Ga0068862_101094638 | Ga0068862_1010946382 | 104 |
| 228 | 3300005844 | Ga0068862_101456606 | Ga0068862_1014566062 | 104 |
| 229 | 3300006186 | Ga0075369_10071843 | Ga0075369_100718433 | 104 |
| 230 | 3300006881 | Ga0068865_100005258 | Ga0068865_1000052589 | 104 |
| 231 | 3300006881 | Ga0068865_100089935 | Ga0068865_1000899353 | 104 |
| 232 | 3300006931 | Ga0097620_100291415 | Ga0097620_1002914154 | 104 |
| 233 | 3300009093 | Ga0105240_12100020 | Ga0105240_121000201 | 104 |
| 234 | 3300009174 | Ga0105241_10196666 | Ga0105241_101966662 | 104 |
| 235 | 3300009174 | Ga0105241_11198595 | Ga0105241_111985952 | 104 |
| 236 | 3300009176 | Ga0105242_10329868 | Ga0105242_103298683 | 104 |
| 237 | 3300009545 | Ga0105237_10066156 | Ga0105237_100661562 | 104 |
| 238 | 3300009545 | Ga0105237_10136351 | Ga0105237_101363513 | 104 |
| 239 | 3300009551 | Ga0105238_10000060 | Ga0105238_10000060125 | 104 |
| 240 | 3300009551 | Ga0105238_10001388 | Ga0105238_1000138810 | 104 |
| 241 | 3300009551 | Ga0105238_10012789 | Ga0105238_100127895 | 104 |
| 242 | 3300009551 | Ga0105238_10069871 | Ga0105238_100698713 | 104 |
| 243 | 3300009551 | Ga0105238_10130701 | Ga0105238_101307014 | 104 |
| 244 | 3300009982 | Ga0105147_101220 | Ga0105147_1012201 | 104 |
| 245 | 3300010375 | Ga0105239_10176072 | Ga0105239_101760724 | 104 |
| 246 | 3300013100 | Ga0157373_10002017 | Ga0157373_100020179 | 104 |
| 247 | 3300013100 | Ga0157373_10362225 | Ga0157373_103622252 | 104 |
| 248 | 3300013102 | Ga0157371_10005539 | Ga0157371_100055397 | 104 |
| 249 | 3300013104 | Ga0157370_10001227 | Ga0157370_1000122730 | 104 |
| 250 | 3300013104 | Ga0157370_10011574 | Ga0157370_1001157410 | 104 |
| 251 | 3300013104 | Ga0157370_10011968 | Ga0157370_1001196811 | 104 |
| 252 | 3300013105 | Ga0157369_10008129 | Ga0157369_100081293 | 104 |
| 253 | 3300013306 | Ga0163162_10000294 | Ga0163162_1000029432 | 104 |
| 254 | 3300013306 | Ga0163162_10052559 | Ga0163162_100525595 | 104 |
| 255 | 3300013307 | Ga0157372_10008772 | Ga0157372_100087724 | 104 |
| 256 | 3300013307 | Ga0157372_10594097 | Ga0157372_105940972 | 104 |
| 257 | 3300013307 | Ga0157372_10876806 | Ga0157372_108768062 | 104 |
| 258 | 3300013308 | Ga0157375_12525027 | Ga0157375_125250272 | 104 |
| 259 | 3300014497 | Ga0182008_10004760 | Ga0182008_100047604 | 104 |
| 260 | 3300014497 | Ga0182008_10007657 | Ga0182008_100076579 | 104 |
| 261 | 3300014497 | Ga0182008_10228507 | Ga0182008_102285072 | 104 |
| 262 | 3300014497 | Ga0182008_10462063 | Ga0182008_104620632 | 104 |
| 263 | 3300014968 | Ga0157379_11703261 | Ga0157379_117032612 | 104 |
| 264 | 3300015261 | Ga0182006_1006458 | Ga0182006_10064583 | 104 |
| 265 | 3300015261 | Ga0182006_1019261 | Ga0182006_10192613 | 104 |
| 266 | 3300015261 | Ga0182006_1019850 | Ga0182006_10198503 | 104 |
| 267 | 3300015262 | Ga0182007_10049487 | Ga0182007_100494873 | 104 |
| 268 | 3300015262 | Ga0182007_10091395 | Ga0182007_100913951 | 104 |
| 269 | 3300015262 | Ga0182007_10112168 | Ga0182007_101121682 | 104 |
| 270 | 3300015265 | Ga0182005_1002081 | Ga0182005_10020819 | 104 |
| 271 | 3300015687 | Ga0183368_1003 | Ga0183368_10031003 | 104 |
| 272 | 3300020070 | Ga0206356_10558970 | Ga0206356_105589704 | 104 |
| 273 | 3300020077 | Ga0206351_10475332 | Ga0206351_104753322 | 104 |
| 274 | 3300022467 | Ga0224712_10091259 | Ga0224712_100912593 | 104 |
| 275 | 3300025206 | Ga0209435_102859 | Ga0209435_1028593 | 104 |
| 276 | 3300025206 | Ga0209435_112230 | Ga0209435_1122302 | 104 |
| 277 | 3300025206 | Ga0209435_112906 | Ga0209435_1129061 | 104 |
| 278 | 3300025207 | Ga0209760_100373 | Ga0209760_10037311 | 104 |
| 279 | 3300025224 | Ga0209784_100016 | Ga0209784_100016394 | 104 |
| 280 | 3300025225 | Ga0209566_101739 | Ga0209566_1017393 | 104 |
| 281 | 3300025226 | Ga0209674_100012 | Ga0209674_100012749 | 104 |
| 282 | 3300025226 | Ga0209674_100244 | Ga0209674_10024429 | 104 |
| 283 | 3300025226 | Ga0209674_100318 | Ga0209674_10031828 | 104 |
| 284 | 3300025226 | Ga0209674_100489 | Ga0209674_1004893 | 104 |
| 285 | 3300025228 | Ga0209672_100007 | Ga0209672_100007146 | 104 |
| 286 | 3300025228 | Ga0209672_100078 | Ga0209672_100078105 | 104 |
| 287 | 3300025228 | Ga0209672_100265 | Ga0209672_1002658 | 104 |
| 288 | 3300025228 | Ga0209672_100885 | Ga0209672_10088510 | 104 |
| 289 | 3300025228 | Ga0209672_101218 | Ga0209672_1012184 | 104 |
| 290 | 3300025230 | Ga0209563_100079 | Ga0209563_10007912 | 104 |
| 291 | 3300025231 | Ga0207427_100019 | Ga0207427_10001920 | 104 |
| 292 | 3300025231 | Ga0207427_100033 | Ga0207427_100033193 | 104 |
| 293 | 3300025231 | Ga0207427_100050 | Ga0207427_100050211 | 104 |
| 294 | 3300025231 | Ga0207427_100123 | Ga0207427_10012357 | 104 |
| 295 | 3300025231 | Ga0207427_106794 | Ga0207427_1067943 | 104 |
| 296 | 3300025233 | Ga0209437_100012 | Ga0209437_100012223 | 104 |
| 297 | 3300025233 | Ga0209437_100105 | Ga0209437_10010592 | 104 |
| 298 | 3300025233 | Ga0209437_100120 | Ga0209437_100120131 | 104 |
| 299 | 3300025233 | Ga0209437_100192 | Ga0209437_10019292 | 104 |
| 300 | 3300025233 | Ga0209437_100227 | Ga0209437_10022739 | 104 |
| 301 | 3300025242 | Ga0209258_100012 | Ga0209258_100012597 | 104 |
| 302 | 3300025242 | Ga0209258_100039 | Ga0209258_100039400 | 104 |
| 303 | 3300025242 | Ga0209258_100046 | Ga0209258_100046191 | 104 |
| 304 | 3300025242 | Ga0209258_100095 | Ga0209258_100095140 | 104 |
| 305 | 3300025242 | Ga0209258_100238 | Ga0209258_10023811 | 104 |
| 306 | 3300025242 | Ga0209258_100308 | Ga0209258_10030828 | 104 |
| 307 | 3300025246 | Ga0209646_1000582 | Ga0209646_100058210 | 104 |
| 308 | 3300025246 | Ga0209646_1000774 | Ga0209646_10007749 | 104 |
| 309 | 3300025246 | Ga0209646_1000800 | Ga0209646_100080010 | 104 |
| 310 | 3300025250 | Ga0209026_1000012 | Ga0209026_100001292 | 104 |
| 311 | 3300025250 | Ga0209026_1000140 | Ga0209026_100014088 | 104 |
| 312 | 3300025250 | Ga0209026_1000158 | Ga0209026_100015830 | 104 |
| 313 | 3300025250 | Ga0209026_1000249 | Ga0209026_100024925 | 104 |
| 314 | 3300025250 | Ga0209026_1000623 | Ga0209026_10006233 | 104 |
| 315 | 3300025250 | Ga0209026_1001417 | Ga0209026_100141711 | 104 |
| 316 | 3300025253 | Ga0209677_102724 | Ga0209677_1027245 | 104 |
| 317 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011665 | 104 |
| 318 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005695 | 104 |
| 319 | 3300025254 | Ga0209148_1000014 | Ga0209148_100001459 | 104 |
| 320 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039352 | 104 |
| 321 | 3300025254 | Ga0209148_1000087 | Ga0209148_1000087154 | 104 |
| 322 | 3300025254 | Ga0209148_1000098 | Ga0209148_100009862 | 104 |
| 323 | 3300025254 | Ga0209148_1000800 | Ga0209148_10008005 | 104 |
| 324 | 3300025256 | Ga0209759_1000750 | Ga0209759_100075024 | 104 |
| 325 | 3300025256 | Ga0209759_1002324 | Ga0209759_10023248 | 104 |
| 326 | 3300025256 | Ga0209759_1003101 | Ga0209759_10031017 | 104 |
| 327 | 3300025256 | Ga0209759_1005416 | Ga0209759_10054163 | 104 |
| 328 | 3300025261 | Ga0209233_1000002 | Ga0209233_1000002567 | 104 |
| 329 | 3300025261 | Ga0209233_1000080 | Ga0209233_1000080193 | 104 |
| 330 | 3300025261 | Ga0209233_1000174 | Ga0209233_100017440 | 104 |
| 331 | 3300025261 | Ga0209233_1000184 | Ga0209233_100018432 | 104 |
| 332 | 3300025261 | Ga0209233_1000283 | Ga0209233_100028357 | 104 |
| 333 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010146 | 104 |
| 334 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034353 | 104 |
| 335 | 3300025272 | Ga0209455_1000039 | Ga0209455_1000039400 | 104 |
| 336 | 3300025272 | Ga0209455_1000126 | Ga0209455_100012655 | 104 |
| 337 | 3300025272 | Ga0209455_1000225 | Ga0209455_100022511 | 104 |
| 338 | 3300025272 | Ga0209455_1002762 | Ga0209455_10027627 | 104 |
| 339 | 3300025272 | Ga0209455_1017613 | Ga0209455_10176132 | 104 |
| 340 | 3300025272 | Ga0209455_1025444 | Ga0209455_10254441 | 104 |
| 341 | 3300025297 | Ga0209758_1036407 | Ga0209758_10364071 | 104 |
| 342 | 3300025304 | Ga0209257_1029183 | Ga0209257_10291833 | 104 |
| 343 | 3300025898 | Ga0207692_10213131 | Ga0207692_102131313 | 104 |
| 344 | 3300025899 | Ga0207642_10548362 | Ga0207642_105483622 | 104 |
| 345 | 3300025904 | Ga0207647_10001002 | Ga0207647_100010024 | 104 |
| 346 | 3300025904 | Ga0207647_10004453 | Ga0207647_100044533 | 104 |
| 347 | 3300025904 | Ga0207647_10083343 | Ga0207647_100833433 | 104 |
| 348 | 3300025907 | Ga0207645_10082788 | Ga0207645_100827883 | 104 |
| 349 | 3300025907 | Ga0207645_10308190 | Ga0207645_103081902 | 104 |
| 350 | 3300025908 | Ga0207643_10229213 | Ga0207643_102292133 | 104 |
| 351 | 3300025909 | Ga0207705_10067253 | Ga0207705_100672533 | 104 |
| 352 | 3300025909 | Ga0207705_10284209 | Ga0207705_102842093 | 104 |
| 353 | 3300025911 | Ga0207654_10360826 | Ga0207654_103608263 | 104 |
| 354 | 3300025912 | Ga0207707_10006292 | Ga0207707_1000629211 | 104 |
| 355 | 3300025912 | Ga0207707_10009177 | Ga0207707_100091773 | 104 |
| 356 | 3300025912 | Ga0207707_10023879 | Ga0207707_100238798 | 104 |
| 357 | 3300025912 | Ga0207707_10038212 | Ga0207707_100382124 | 104 |
| 358 | 3300025914 | Ga0207671_10496407 | Ga0207671_104964072 | 104 |
| 359 | 3300025916 | Ga0207663_10027658 | Ga0207663_100276584 | 104 |
| 360 | 3300025916 | Ga0207663_10680632 | Ga0207663_106806322 | 104 |
| 361 | 3300025917 | Ga0207660_10045374 | Ga0207660_100453743 | 104 |
| 362 | 3300025917 | Ga0207660_10816721 | Ga0207660_108167212 | 104 |
| 363 | 3300025919 | Ga0207657_10024017 | Ga0207657_100240177 | 104 |
| 364 | 3300025919 | Ga0207657_10045229 | Ga0207657_100452292 | 104 |
| 365 | 3300025919 | Ga0207657_10050843 | Ga0207657_100508433 | 104 |
| 366 | 3300025919 | Ga0207657_10131673 | Ga0207657_101316732 | 104 |
| 367 | 3300025919 | Ga0207657_10346073 | Ga0207657_103460732 | 104 |
| 368 | 3300025920 | Ga0207649_10048455 | Ga0207649_100484553 | 104 |
| 369 | 3300025920 | Ga0207649_11178135 | Ga0207649_111781352 | 104 |
| 370 | 3300025921 | Ga0207652_10020621 | Ga0207652_100206212 | 104 |
| 371 | 3300025921 | Ga0207652_10064579 | Ga0207652_100645792 | 104 |
| 372 | 3300025921 | Ga0207652_10072216 | Ga0207652_100722163 | 104 |
| 373 | 3300025923 | Ga0207681_10073632 | Ga0207681_100736324 | 104 |
| 374 | 3300025924 | Ga0207694_10007514 | Ga0207694_100075147 | 104 |
| 375 | 3300025924 | Ga0207694_10131346 | Ga0207694_101313463 | 104 |
| 376 | 3300025924 | Ga0207694_10161066 | Ga0207694_101610662 | 104 |
| 377 | 3300025924 | Ga0207694_10433922 | Ga0207694_104339222 | 104 |
| 378 | 3300025924 | Ga0207694_10971648 | Ga0207694_109716482 | 104 |
| 379 | 3300025926 | Ga0207659_10490179 | Ga0207659_104901793 | 104 |
| 380 | 3300025928 | Ga0207700_10068954 | Ga0207700_100689543 | 104 |
| 381 | 3300025928 | Ga0207700_10304051 | Ga0207700_103040513 | 104 |
| 382 | 3300025929 | Ga0207664_10000021 | Ga0207664_10000021209 | 104 |
| 383 | 3300025929 | Ga0207664_10006216 | Ga0207664_100062164 | 104 |
| 384 | 3300025932 | Ga0207690_10002181 | Ga0207690_100021817 | 104 |
| 385 | 3300025932 | Ga0207690_10011077 | Ga0207690_100110771 | 104 |
| 386 | 3300025932 | Ga0207690_10012273 | Ga0207690_100122733 | 104 |
| 387 | 3300025932 | Ga0207690_10033257 | Ga0207690_100332573 | 104 |
| 388 | 3300025932 | Ga0207690_10053311 | Ga0207690_100533113 | 104 |
| 389 | 3300025932 | Ga0207690_10082830 | Ga0207690_100828303 | 104 |
| 390 | 3300025933 | Ga0207706_10058024 | Ga0207706_100580241 | 104 |
| 391 | 3300025933 | Ga0207706_10354799 | Ga0207706_103547992 | 104 |
| 392 | 3300025934 | Ga0207686_10203020 | Ga0207686_102030202 | 104 |
| 393 | 3300025938 | Ga0207704_10009145 | Ga0207704_100091457 | 104 |
| 394 | 3300025942 | Ga0207689_10007944 | Ga0207689_100079448 | 104 |
| 395 | 3300025944 | Ga0207661_10310746 | Ga0207661_103107463 | 104 |
| 396 | 3300025949 | Ga0207667_10013920 | Ga0207667_100139207 | 104 |
| 397 | 3300025949 | Ga0207667_10032128 | Ga0207667_100321283 | 104 |
| 398 | 3300025949 | Ga0207667_10457012 | Ga0207667_104570121 | 104 |
| 399 | 3300025972 | Ga0207668_10012033 | Ga0207668_100120335 | 104 |
| 400 | 3300025981 | Ga0207640_11318594 | Ga0207640_113185942 | 104 |
| 401 | 3300025986 | Ga0207658_11062045 | Ga0207658_110620452 | 104 |
| 402 | 3300026041 | Ga0207639_10011219 | Ga0207639_100112192 | 104 |
| 403 | 3300026041 | Ga0207639_10059429 | Ga0207639_100594293 | 104 |
| 404 | 3300026041 | Ga0207639_10082743 | Ga0207639_100827433 | 104 |
| 405 | 3300026067 | Ga0207678_10417116 | Ga0207678_104171163 | 104 |
| 406 | 3300026067 | Ga0207678_10577913 | Ga0207678_105779133 | 104 |
| 407 | 3300026078 | Ga0207702_10000290 | Ga0207702_1000029021 | 104 |
| 408 | 3300026078 | Ga0207702_10002845 | Ga0207702_100028457 | 104 |
| 409 | 3300026078 | Ga0207702_10010831 | Ga0207702_100108319 | 104 |
| 410 | 3300026088 | Ga0207641_12001016 | Ga0207641_120010162 | 104 |
| 411 | 3300026089 | Ga0207648_10938767 | Ga0207648_109387673 | 104 |
| 412 | 3300026089 | Ga0207648_11509520 | Ga0207648_115095202 | 104 |
| 413 | 3300026116 | Ga0207674_10022041 | Ga0207674_100220418 | 104 |
| 414 | 3300026116 | Ga0207674_10030751 | Ga0207674_100307513 | 104 |
| 415 | 3300026116 | Ga0207674_10853495 | Ga0207674_108534952 | 104 |
| 416 | 3300026121 | Ga0207683_10017401 | Ga0207683_100174014 | 104 |
| 417 | 3300026121 | Ga0207683_10949973 | Ga0207683_109499732 | 104 |
| 418 | 3300026142 | Ga0207698_10053589 | Ga0207698_100535893 | 104 |
| 419 | 3300028379 | Ga0268266_10116506 | Ga0268266_101165061 | 104 |
| 420 | 3300028380 | Ga0268265_10152465 | Ga0268265_101524652 | 104 |
| 421 | 3300028380 | Ga0268265_11522866 | Ga0268265_115228662 | 104 |
| 422 | 3300028800 | Ga0265338_10278542 | Ga0265338_102785421 | 104 |
| 423 | 3300030732 | Ga0316176_1035937 | Ga0316176_10359371 | 104 |
| 424 | 3300030745 | Ga0316182_1248774 | Ga0316182_12487742 | 104 |
| 425 | 3300031730 | Ga0307516_10017807 | Ga0307516_100178075 | 104 |
| 426 | 3300031911 | Ga0307412_10064358 | Ga0307412_100643582 | 104 |
| 427 | 3300032004 | Ga0307414_10180206 | Ga0307414_101802063 | 104 |
| 428 | 3300037312 | Ga0395899_0242383 | Ga0395899_0242383_606_1001 | 104 |
| 429 | 3300037418 | Ga0395900_0001732 | Ga0395900_0001732_3057_3452 | 104 |
| 430 | 3300037418 | Ga0395900_0429103 | Ga0395900_0429103_316_711 | 104 |
| 431 | 3300037418 | Ga0395900_1808556 | Ga0395900_1808556_32_427 | 104 |
| 432 | 3300037466 | Ga0395898_0006906 | Ga0395898_0006906_508_903 | 104 |
| 433 | 3300037466 | Ga0395898_0117282 | Ga0395898_0117282_1983_2378 | 104 |
| 434 | 3300037466 | Ga0395898_0126878 | Ga0395898_0126878_1539_1934 | 104 |
| 435 | 3300037471 | Ga0395905_0142212 | Ga0395905_0142212_594_989 | 104 |
| 436 | 3300038443 | Ga0395901_0004132 | Ga0395901_0004132_4472_4867 | 104 |
| 437 | 3300038443 | Ga0395901_0030016 | Ga0395901_0030016_4710_5105 | 104 |
| 438 | 3300038443 | Ga0395901_0082423 | Ga0395901_0082423_510_905 | 104 |
| 439 | 3300038443 | Ga0395901_0096589 | Ga0395901_0096589_1728_2123 | 104 |
| 440 | 3300038443 | Ga0395901_0287657 | Ga0395901_0287657_620_1015 | 104 |
| 441 | 3300038443 | Ga0395901_1111393 | Ga0395901_1111393_12_407 | 104 |
| 442 | 3300041404 | Ga0439436_0000014 | Ga0439436_0000014_71805_72197 | 104 |
| 443 | 3300041413 | Ga0439465_0000563 | Ga0439465_0000563_9683_10078 | 104 |
| 444 | 3300041413 | Ga0439465_0012786 | Ga0439465_0012786_674_1069 | 104 |
| 445 | 3300041463 | Ga0451804_0639808 | Ga0451804_0639808_517_912 | 104 |
| 446 | 3300041486 | Ga0451807_0181925 | Ga0451807_0181925_405_800 | 104 |
| 447 | 3300041491 | Ga0451833_0573159 | Ga0451833_0573159_309_704 | 104 |
| 448 | 3300041494 | Ga0451837_0118483 | Ga0451837_0118483_959_1354 | 104 |
| 449 | 3300042004 | Ga0439445_0006306 | Ga0439445_0006306_2032_2427 | 104 |
| 450 | 3300042007 | Ga0439449_0000206 | Ga0439449_0000206_12489_12884 | 104 |
| 451 | 3300042012 | Ga0439455_0101125 | Ga0439455_0101125_267_662 | 104 |
| 452 | 3300042016 | Ga0439463_009567 | Ga0439463_009567_44_439 | 104 |
| 453 | 3300044694 | Ga0466963_0428553 | Ga0466963_0428553_34_429 | 104 |
| 454 | 3300045976 | Ga0466967_0078188 | Ga0466967_0078188_759_1154 | 104 |
| 455 | 3300046452 | Ga0495617_000411 | Ga0495617_000411_2939_3331 | 104 |
| 456 | 3300046462 | Ga0495651_0790196 | Ga0495651_0790196_32_427 | 104 |
| 457 | 3300046512 | Ga0495610_0009510 | Ga0495610_0009510_3496_3888 | 104 |
| 458 | 3300046515 | Ga0495620_0019985 | Ga0495620_0019985_1234_1626 | 104 |
| 459 | 3300046533 | Ga0495640_0154904 | Ga0495640_0154904_459_854 | 104 |
| 460 | 3300046694 | Ga0495649_0044419 | Ga0495649_0044419_75_467 | 104 |
| 461 | 3300048907 | Ga0496104_0000020 | Ga0496104_0000020_27298_27693 | 104 |
| 462 | 3300048908 | Ga0496105_0000015 | Ga0496105_0000015_32842_33237 | 104 |
| 463 | 3300048919 | Ga0496116_0108490 | Ga0496116_0108490_1163_1555 | 104 |
| 464 | 3300048919 | Ga0496116_0146827 | Ga0496116_0146827_899_1291 | 104 |
| 465 | 3300048921 | Ga0496118_0073288 | Ga0496118_0073288_1676_2068 | 104 |
| 466 | 3300048922 | Ga0496119_0019183 | Ga0496119_0019183_2527_2919 | 104 |
| 467 | 3300048923 | Ga0496120_0302563 | Ga0496120_0302563_226_618 | 104 |
| 468 | 3300048926 | Ga0496123_0007006 | Ga0496123_0007006_9365_9757 | 104 |
| 469 | 3300049568 | Ga0501031_0077685 | Ga0501031_0077685_1187_1582 | 104 |
| 470 | 3300049569 | Ga0501032_0082483 | Ga0501032_0082483_263_658 | 104 |
| 471 | 3300049569 | Ga0501032_0255666 | Ga0501032_0255666_729_1124 | 104 |
| 472 | 3300049570 | Ga0501033_0013080 | Ga0501033_0013080_3009_3404 | 104 |
| 473 | 3300049570 | Ga0501033_0075751 | Ga0501033_0075751_1845_2240 | 104 |
| 474 | 3300049571 | Ga0501034_0057695 | Ga0501034_0057695_2501_2896 | 104 |
| 475 | 3300049571 | Ga0501034_0062796 | Ga0501034_0062796_1068_1478 | 104 |
| 476 | 3300049571 | Ga0501034_0339109 | Ga0501034_0339109_263_658 | 104 |
| 477 | 3300049571 | Ga0501034_0929458 | Ga0501034_0929458_152_562 | 104 |
| 478 | 3300049571 | Ga0501034_1129674 | Ga0501034_1129674_14_409 | 104 |
| 479 | 3300049572 | Ga0501036_0073177 | Ga0501036_0073177_1868_2263 | 104 |
| 480 | 3300049572 | Ga0501036_0123730 | Ga0501036_0123730_1475_1885 | 104 |
| 481 | 3300049572 | Ga0501036_0761035 | Ga0501036_0761035_201_611 | 104 |
| 482 | 3300049573 | Ga0501037_0024412 | Ga0501037_0024412_1222_1632 | 104 |
| 483 | 3300049573 | Ga0501037_0051695 | Ga0501037_0051695_1632_2027 | 104 |
| 484 | 3300049573 | Ga0501037_0280491 | Ga0501037_0280491_642_1037 | 104 |
| 485 | 3300049574 | Ga0501038_0069493 | Ga0501038_0069493_527_922 | 104 |
| 486 | 3300049574 | Ga0501038_0073014 | Ga0501038_0073014_1604_2014 | 104 |
| 487 | 3300049574 | Ga0501038_0110405 | Ga0501038_0110405_1657_2052 | 104 |
| 488 | 3300049575 | Ga0501039_0035229 | Ga0501039_0035229_2633_3043 | 104 |
| 489 | 3300049575 | Ga0501039_0295659 | Ga0501039_0295659_463_873 | 104 |
| 490 | 3300049576 | Ga0501040_1358567 | Ga0501040_1358567_63_458 | 104 |
| 491 | 3300049579 | Ga0501043_0046571 | Ga0501043_0046571_535_930 | 104 |
| 492 | 3300049579 | Ga0501043_0064230 | Ga0501043_0064230_2170_2580 | 104 |
| 493 | 3300049579 | Ga0501043_0080958 | Ga0501043_0080958_911_1306 | 104 |
| 494 | 3300049579 | Ga0501043_0848273 | Ga0501043_0848273_57_452 | 104 |
| 495 | 3300049580 | Ga0501046_0340864 | Ga0501046_0340864_11_406 | 104 |
| 496 | 3300049581 | Ga0501047_0114067 | Ga0501047_0114067_474_884 | 104 |
| 497 | 3300049581 | Ga0501047_0154140 | Ga0501047_0154140_430_825 | 104 |
| 498 | 3300049581 | Ga0501047_0273324 | Ga0501047_0273324_312_722 | 104 |
| 499 | 3300049581 | Ga0501047_0760651 | Ga0501047_0760651_336_731 | 104 |
| 500 | 3300049582 | Ga0501048_0417828 | Ga0501048_0417828_473_883 | 104 |
| 501 | 3300049582 | Ga0501048_0455544 | Ga0501048_0455544_498_893 | 104 |
| 502 | 3300049586 | Ga0501070_0284660 | Ga0501070_0284660_578_988 | 104 |
| 503 | 3300049705 | Ga0501225_0012331 | Ga0501225_0012331_790_1185 | 104 |
| 504 | 3300049741 | Ga0501079_0461062 | Ga0501079_0461062_223_633 | 104 |
| 505 | 3300049742 | Ga0501080_0029389 | Ga0501080_0029389_3880_4290 | 104 |
| 506 | 3300049822 | Ga0501035_0007993 | Ga0501035_0007993_8778_9173 | 104 |
| 507 | 3300049822 | Ga0501035_0035525 | Ga0501035_0035525_1098_1508 | 104 |
| 508 | 3300049822 | Ga0501035_0455421 | Ga0501035_0455421_436_831 | 104 |
| 509 | 3300049822 | Ga0501035_0661601 | Ga0501035_0661601_185_580 | 104 |
| 510 | 3300049823 | Ga0501044_0071730 | Ga0501044_0071730_2615_3010 | 104 |
| 511 | 3300049823 | Ga0501044_0171681 | Ga0501044_0171681_798_1208 | 104 |
| 512 | 3300049823 | Ga0501044_0945359 | Ga0501044_0945359_19_414 | 104 |
| 513 | 3300049824 | Ga0501045_0449433 | Ga0501045_0449433_382_792 | 104 |
| 514 | 3300050516 | nmdc:mga0sz30_102027_c1 | nmdc:mga0sz30_102027_c1_533_925 | 104 |
| 515 | 3300013100 | Ga0157373_10029000 | Ga0157373_100290002 | 107 |
| 516 | 3300013307 | Ga0157372_10426742 | Ga0157372_104267422 | 107 |
| 517 | 3300009098 | Ga0105245_11449815 | Ga0105245_114498152 | 111 |
| 518 | 3300010375 | Ga0105239_10045014 | Ga0105239_100450143 | 111 |
| 519 | 3300013296 | Ga0157374_10027757 | Ga0157374_100277575 | 111 |
| 520 | 3300014969 | Ga0157376_10058476 | Ga0157376_100584764 | 111 |
| 521 | 3300021384 | Ga0213876_10098043 | Ga0213876_100980433 | 111 |
| 522 | 3300025928 | Ga0207700_10711552 | Ga0207700_107115522 | 111 |
| 523 | 3300026116 | Ga0207674_10173995 | Ga0207674_101739952 | 111 |
| 524 | 3300039437 | Ga0436365_0650332 | Ga0436365_0650332_773_1189 | 111 |
| 525 | 3300048906 | Ga0496103_0433442 | Ga0496103_0433442_343_759 | 111 |
| 526 | 3300048918 | Ga0496115_0000176 | Ga0496115_0000176_54664_55080 | 111 |
| 527 | 3300048921 | Ga0496118_0042257 | Ga0496118_0042257_230_646 | 111 |
| 528 | 3300048929 | Ga0496126_0000969 | Ga0496126_0000969_3202_3618 | 111 |
| 529 | 3300049823 | Ga0501044_0150356 | Ga0501044_0150356_1835_2284 | 115 |
| 530 | 3300049578 | Ga0501042_0240640 | Ga0501042_0240640_120_566 | 121 |
| 531 | 3300049580 | Ga0501046_0084661 | Ga0501046_0084661_1283_1729 | 121 |
| 532 | 3300049586 | Ga0501070_0139587 | Ga0501070_0139587_437_886 | 122 |
| 533 | 3300049589 | Ga0501073_0141293 | Ga0501073_0141293_130_579 | 122 |
| 534 | 3300049742 | Ga0501080_0709886 | Ga0501080_0709886_258_707 | 122 |
| 535 | 3300049586 | Ga0501070_0062457 | Ga0501070_0062457_2060_2542 | 127 |
| 536 | 3300005614 | Ga0068856_100036247 | Ga0068856_1000362473 | 128 |
| 537 | 3300009545 | Ga0105237_11818842 | Ga0105237_118188422 | 128 |
| 538 | 3300026078 | Ga0207702_10132875 | Ga0207702_101328754 | 128 |
| 539 | 3300037312 | Ga0395899_0037966 | Ga0395899_0037966_1389_1859 | 129 |
| 540 | 3300037418 | Ga0395900_0008996 | Ga0395900_0008996_374_844 | 129 |
| 541 | 3300037466 | Ga0395898_0012279 | Ga0395898_0012279_7846_8316 | 129 |
| 542 | 2162886007 | SwRhRL2b_contig_1453 | SwRhRL2b_0338.00002860 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.7246 | 42 | 124 |
| 2wdv-assembly1.cif.gz_C | e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket | 0.6992 | 42 | 124 |
| 6wu6-assembly1.cif.gz_C | succinate-coenzyme q reductase | 0.6934 | 42 | 129 |
| 6wu6-assembly1.cif.gz_C | succinate-coenzyme q reductase | 0.5571 | 42 | 129 |
| 2wu2-assembly3.cif.gz_K | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant | 0.5174 | 42 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wdvK00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7085 | 42 | 124 | 1.20.1300.10 |
| af_Q641Z9_62_169_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6599 | 42 | 123 | 1.20.1300.10 |
| 1yq4C02 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6311 | 42 | 125 | 1.20.1300.10 |
| 2wqyC02 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.626 | 42 | 127 | 1.20.1300.10 |
| 2h89C02 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.5898 | 42 | 125 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520D3K2-F1-model_v4 | deleted | 0.9692 | 70 | 131 |
|
| AF-F2I3H9-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9609 | 66 | 128 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A382QPX9-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9596 | 56 | 128 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
| AF-A0A258XIN3-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9526 | 71 | 131 |
GO:0016020
GO:0046872 |
| AF-A0A381TYI8-F1-model_v4 | Succinate dehydrogenase cytochrome b556 subunit | 0.9358 | 78 | 134 |
GO:0006099
GO:0009055 GO:0016020 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar