F461547

General Info

Members Datasets Scaffolds Average Seq Length
542 257 541 132

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0062457|Ga0501070_0062457_2060_2542
Length 160
Sequence MLRATACVVARGRFGLGRQLQRFHFRIAAMADTRRPLSPHLQIYKWQVQMVTSILHRATGIALAVGTLLVVWGLLSLAAGEAAFDQFKICIGSVPGMILLAGWSWALFYHLCNGIRHLLQDTGAGYAIPQFVRSSWLSVVVSLVLVAIVWACVLTSGGAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
106 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
180 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.32
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.74
Nodule 0
Rhizoplane 1.66
Rhizosphere 71.22
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1453 2162886007 Bacteria 3318
2 JGI24739J22299_10000042 3300001989 Bacteria 34840
3 JGI24739J22299_10000091 3300001989 Bacteria 26347
4 JGI24737J22298_10002031 3300001990 Bacteria 7238
5 JGI24737J22298_10030880 3300001990 Bacteria 1675
6 JGI24735J21928_10006310 3300002067 Bacteria 3912
7 JGI25162J39368_1000529 3300002737 Bacteria 28464
8 JGI25157J39369_1000446 3300002741 Bacteria 26463
9 JGI25157J39369_1000950 3300002741 Bacteria 13652
10 JGI25157J39369_1001638 3300002741 Bacteria 7690
11 JGI25157J39369_1002462 3300002741 Bacteria 4576
12 JGI25157J39369_1003251 3300002741 Bacteria 3412
13 JGI25163J39215_1000279 3300002771 Bacteria 18007
14 JGI25163J39215_1000580 3300002771 Bacteria 10307
15 JGI25164J39214_1000102 3300002772 Bacteria 83707
16 JGI25164J39214_1000142 3300002772 Bacteria 68956
17 JGI25164J39214_1000561 3300002772 Bacteria 16869
18 JGI25164J39214_1000564 3300002772 Bacteria 16819
19 JGI25165J46597_1000058 3300003214 Bacteria 212833
20 JGI25165J46597_1000090 3300003214 Bacteria 168833
21 JGI25165J46597_1001122 3300003214 Bacteria 16865
22 JGI25165J46597_1001290 3300003214 Bacteria 14538
23 rootH1_10127202 3300003316 Bacteria 1374
24 rootH2_10011619 3300003320 Bacteria 16641
25 rootH2_10069172 3300003320 Bacteria 2806
26 rootH1_10142898 3300003323 Bacteria 1151
27 Ga0006558J51389_1026097 3300003558 Bacteria 1260
28 Ga0006560J51390_1026969 3300003565 Bacteria 1220
29 Ga0006554J51385_1023919 3300003567 Bacteria 1464
30 Ga0006562J51391_1022432 3300003578 Bacteria 5470
31 Ga0006562J51391_1022433 3300003578 Bacteria 3793
32 Ga0055538_1000714 3300003751 Bacteria 9924
33 Ga0055539_1000821 3300003752 Bacteria 7316
34 Ga0055527_1000105 3300003760 Bacteria 60329
35 Ga0055527_1000253 3300003760 Bacteria 32992
36 Ga0055535_1000034 3300003761 Bacteria 181954
37 Ga0055535_1000150 3300003761 Bacteria 74086
38 Ga0055535_1000488 3300003761 Bacteria 35722
39 Ga0055535_1000765 3300003761 Bacteria 23814
40 Ga0055535_1000789 3300003761 Bacteria 23078
41 Ga0055535_1008250 3300003761 Bacteria 1898
42 Ga0055542_1000198 3300003762 Bacteria 74085
43 Ga0055542_1000685 3300003762 Bacteria 26937
44 Ga0055542_1001221 3300003762 Bacteria 14371
45 Ga0055542_1002647 3300003762 Bacteria 5596
46 Ga0055542_1010441 3300003762 Bacteria 1696
47 Ga0055529_1000083 3300003763 Bacteria 146729
48 Ga0055529_1000305 3300003763 Bacteria 56629
49 Ga0055529_1000343 3300003763 Bacteria 51957
50 Ga0055529_1000443 3300003763 Bacteria 41149
51 Ga0055529_1000667 3300003763 Bacteria 24036
52 Ga0055534_1012094 3300003784 Bacteria 1724
53 Ga0055528_1026599 3300003790 Bacteria 1655
54 Ga0055531_10011520 3300003794 Bacteria 4251
55 Ga0065165_1003017 3300005262 Bacteria 12699
56 Ga0070658_10084617 3300005327 Bacteria 2608
57 Ga0070676_10073029 3300005328 Bacteria 2063
58 Ga0070683_100510265 3300005329 Bacteria 1149
59 Ga0070670_100457303 3300005331 Bacteria 1132
60 Ga0068869_100029649 3300005334 Bacteria 3836
61 Ga0070666_10000005 3300005335 Bacteria 343092
62 Ga0070666_10158341 3300005335 Bacteria 1582
63 Ga0070680_100171468 3300005336 Bacteria 1826
64 Ga0070682_100222268 3300005337 Bacteria 1345
65 Ga0068868_100127646 3300005338 Bacteria 2079
66 Ga0070660_100014647 3300005339 Bacteria 5656
67 Ga0070660_100060185 3300005339 Bacteria 2947
68 Ga0070660_100263617 3300005339 Bacteria 1407
69 Ga0070660_101233886 3300005339 Bacteria 634
70 Ga0070691_10927065 3300005341 Bacteria 539
71 Ga0070661_100037225 3300005344 Bacteria 3539
72 Ga0070661_100101390 3300005344 Bacteria 2141
73 Ga0070661_100412929 3300005344 Bacteria 1069
74 Ga0070692_10003905 3300005345 Bacteria 6145
75 Ga0070692_10638255 3300005345 Bacteria 709
76 Ga0070668_100047703 3300005347 Bacteria 3293
77 Ga0070669_100084069 3300005353 Bacteria 2374
78 Ga0070671_100398732 3300005355 Bacteria 1177
79 Ga0070688_100379867 3300005365 Bacteria 1041
80 Ga0070659_100002615 3300005366 Bacteria 12808
81 Ga0070659_100010942 3300005366 Bacteria 6696
82 Ga0070659_100429987 3300005366 Bacteria 1117
83 Ga0070659_100535392 3300005366 Bacteria 1001
84 Ga0070659_100828250 3300005366 Bacteria 806
85 Ga0070667_100268654 3300005367 Bacteria 1529
86 Ga0070667_101052342 3300005367 Bacteria 760
87 Ga0070714_100000034 3300005435 Bacteria 130742
88 Ga0070714_101766067 3300005435 Bacteria 604
89 Ga0070710_10241069 3300005437 Bacteria 1158
90 Ga0070711_100053534 3300005439 Bacteria 2782
91 Ga0070711_100788002 3300005439 Bacteria 805
92 Ga0070694_100133139 3300005444 Bacteria 1798
93 Ga0070678_100002303 3300005456 Bacteria 10412
94 Ga0070662_100039345 3300005457 Bacteria 3362
95 Ga0070662_100273719 3300005457 Bacteria 1364
96 Ga0070662_100867638 3300005457 Bacteria 769
97 Ga0070681_10001208 3300005458 Bacteria 22475
98 Ga0070681_10011042 3300005458 Bacteria 8930
99 Ga0070681_10012125 3300005458 Bacteria 8550
100 Ga0068867_100868889 3300005459 Bacteria 809
101 Ga0068867_101820985 3300005459 Bacteria 573
102 Ga0070679_100002407 3300005530 Bacteria 16967
103 Ga0070679_100025171 3300005530 Bacteria 5838
104 Ga0070679_100137234 3300005530 Bacteria 2427
105 Ga0070679_100914185 3300005530 Bacteria 821
106 Ga0070684_101913831 3300005535 Bacteria 560
107 Ga0068853_100003663 3300005539 Bacteria 11785
108 Ga0068853_100076470 3300005539 Bacteria 2923
109 Ga0068853_100147205 3300005539 Bacteria 2117
110 Ga0070696_100001218 3300005546 Bacteria 16719
111 Ga0070696_100011587 3300005546 Bacteria 5908
112 Ga0070696_100027352 3300005546 Bacteria 3885
113 Ga0070693_100023546 3300005547 Bacteria 3293
114 Ga0070693_100045860 3300005547 Bacteria 2480
115 Ga0070693_100310412 3300005547 Bacteria 1066
116 Ga0070665_100018710 3300005548 Bacteria 6945
117 Ga0070665_100101467 3300005548 Bacteria 2881
118 Ga0068855_100015915 3300005563 Bacteria 9048
119 Ga0068855_100102918 3300005563 Bacteria 3286
120 Ga0068855_100281616 3300005563 Bacteria 1846
121 Ga0070664_100943826 3300005564 Bacteria 810
122 Ga0068857_100011171 3300005577 Bacteria 7809
123 Ga0068857_100014459 3300005577 Bacteria 6886
124 Ga0068857_100136395 3300005577 Bacteria 2215
125 Ga0068857_100213911 3300005577 Bacteria 1759
126 Ga0068854_100013946 3300005578 Bacteria 5287
127 Ga0068854_100015759 3300005578 Bacteria 5019
128 Ga0068854_100115542 3300005578 Bacteria 2030
129 Ga0068854_100819998 3300005578 Bacteria 812
130 Ga0068856_100011722 3300005614 Bacteria 8502
131 Ga0068856_100014629 3300005614 Bacteria 7581
132 Ga0068856_100036247 3300005614 Bacteria 4836
133 Ga0068856_100544617 3300005614 Bacteria 1182
134 Ga0068856_100564780 3300005614 Bacteria 1159
135 Ga0068852_100161254 3300005616 Bacteria 2094
136 Ga0068859_100291417 3300005617 Bacteria 1725
137 Ga0068859_101109272 3300005617 Bacteria 870
138 Ga0068859_101992271 3300005617 Bacteria 641
139 Ga0068866_10388608 3300005718 Bacteria 897
140 Ga0068851_10437507 3300005834 Bacteria 775
141 Ga0068870_10007797 3300005840 Bacteria 4789
142 Ga0068858_100080401 3300005842 Bacteria 3028
143 Ga0068858_101326167 3300005842 Bacteria 708
144 Ga0068860_100158982 3300005843 Bacteria 2178
145 Ga0068860_100549344 3300005843 Bacteria 1157
146 Ga0068862_101094638 3300005844 Bacteria 792
147 Ga0068862_101456606 3300005844 Bacteria 689
148 Ga0075369_10071843 3300006186 Bacteria 1524
149 Ga0068871_100154215 3300006358 Bacteria 1960
150 Ga0068865_100005258 3300006881 Bacteria 7826
151 Ga0068865_100089935 3300006881 Bacteria 2225
152 Ga0097620_100291415 3300006931 Bacteria 1725
153 Ga0097620_101109262 3300006931 Bacteria 870
154 Ga0097620_101992159 3300006931 Bacteria 641
155 Ga0105240_10128165 3300009093 Bacteria 3047
156 Ga0105240_12100020 3300009093 Bacteria 586
157 Ga0105245_11449815 3300009098 Bacteria 737
158 Ga0105241_10196666 3300009174 Bacteria 1681
159 Ga0105241_11198595 3300009174 Bacteria 719
160 Ga0105242_10329868 3300009176 Bacteria 1403
161 Ga0105237_10066156 3300009545 Bacteria 3610
162 Ga0105237_10136351 3300009545 Bacteria 2448
163 Ga0105237_11818842 3300009545 Bacteria 617
164 Ga0105238_10000060 3300009551 Bacteria 129934
165 Ga0105238_10001388 3300009551 Bacteria 24287
166 Ga0105238_10012789 3300009551 Bacteria 8470
167 Ga0105238_10069871 3300009551 Bacteria 3512
168 Ga0105238_10130701 3300009551 Bacteria 2489
169 Ga0105147_101220 3300009982 Bacteria 2067
170 Ga0105239_10045014 3300010375 Bacteria 4837
171 Ga0105239_10176072 3300010375 Bacteria 2393
172 Ga0157373_10002017 3300013100 Bacteria 15391
173 Ga0157373_10029000 3300013100 Bacteria 3989
174 Ga0157373_10362225 3300013100 Bacteria 1035
175 Ga0157371_10005539 3300013102 Bacteria 10625
176 Ga0157370_10001227 3300013104 Bacteria 32113
177 Ga0157370_10001569 3300013104 Bacteria 28272
178 Ga0157370_10011574 3300013104 Bacteria 9209
179 Ga0157370_10011968 3300013104 Bacteria 9044
180 Ga0157369_10008129 3300013105 Bacteria 12028
181 Ga0157374_10027757 3300013296 Bacteria 5111
182 Ga0157378_10530126 3300013297 Bacteria 1180
183 Ga0163162_10000294 3300013306 Bacteria 45823
184 Ga0163162_10007449 3300013306 Bacteria 10644
185 Ga0163162_10052559 3300013306 Bacteria 4092
186 Ga0163162_10561032 3300013306 Bacteria 1269
187 Ga0157372_10008772 3300013307 Bacteria 10737
188 Ga0157372_10089260 3300013307 Bacteria 3502
189 Ga0157372_10426742 3300013307 Bacteria 1545
190 Ga0157372_10594097 3300013307 Bacteria 1290
191 Ga0157372_10876806 3300013307 Bacteria 1042
192 Ga0157375_12525027 3300013308 Bacteria 614
193 Ga0182008_10004760 3300014497 Bacteria 7858
194 Ga0182008_10007657 3300014497 Bacteria 5952
195 Ga0182008_10228507 3300014497 Bacteria 954
196 Ga0182008_10462063 3300014497 Bacteria 692
197 Ga0157379_11703261 3300014968 Bacteria 618
198 Ga0157376_10007093 3300014969 Bacteria 7956
199 Ga0157376_10058476 3300014969 Bacteria 3229
200 Ga0182006_1006458 3300015261 Bacteria 5447
201 Ga0182006_1019261 3300015261 Bacteria 2874
202 Ga0182006_1019850 3300015261 Bacteria 2823
203 Ga0182007_10049487 3300015262 Bacteria 1388
204 Ga0182007_10091395 3300015262 Bacteria 1002
205 Ga0182007_10112168 3300015262 Bacteria 908
206 Ga0182005_1002081 3300015265 Bacteria 7458
207 Ga0183368_1003 3300015687 Bacteria 1276390
208 Ga0206356_10558970 3300020070 Bacteria 3412
209 Ga0206351_10475332 3300020077 Bacteria 807
210 Ga0213876_10098043 3300021384 Bacteria 1553
211 Ga0224712_10091259 3300022467 Bacteria 1276
212 Ga0224712_10211084 3300022467 Bacteria 885
213 Ga0209435_102859 3300025206 Bacteria 1996
214 Ga0209435_112230 3300025206 Bacteria 920
215 Ga0209435_112906 3300025206 Bacteria 890
216 Ga0209760_100373 3300025207 Bacteria 11781
217 Ga0209784_100016 3300025224 Bacteria 481036
218 Ga0209566_101739 3300025225 Bacteria 5233
219 Ga0209674_100012 3300025226 Bacteria 950162
220 Ga0209674_100244 3300025226 Bacteria 45968
221 Ga0209674_100318 3300025226 Bacteria 31053
222 Ga0209674_100489 3300025226 Bacteria 16826
223 Ga0209672_100007 3300025228 Bacteria 959482
224 Ga0209672_100078 3300025228 Bacteria 156926
225 Ga0209672_100265 3300025228 Bacteria 38562
226 Ga0209672_100885 3300025228 Bacteria 13666
227 Ga0209672_101218 3300025228 Bacteria 10392
228 Ga0209563_100079 3300025230 Bacteria 203017
229 Ga0207427_100019 3300025231 Bacteria 513977
230 Ga0207427_100033 3300025231 Bacteria 338459
231 Ga0207427_100050 3300025231 Bacteria 227233
232 Ga0207427_100123 3300025231 Bacteria 98859
233 Ga0207427_106794 3300025231 Bacteria 1407
234 Ga0209437_100012 3300025233 Bacteria 792625
235 Ga0209437_100105 3300025233 Bacteria 220034
236 Ga0209437_100120 3300025233 Bacteria 205054
237 Ga0209437_100192 3300025233 Bacteria 122888
238 Ga0209437_100227 3300025233 Bacteria 98939
239 Ga0209258_100012 3300025242 Bacteria 825544
240 Ga0209258_100039 3300025242 Bacteria 386366
241 Ga0209258_100046 3300025242 Bacteria 369794
242 Ga0209258_100095 3300025242 Bacteria 223270
243 Ga0209258_100238 3300025242 Bacteria 102043
244 Ga0209258_100308 3300025242 Bacteria 77195
245 Ga0209646_1000582 3300025246 Bacteria 15094
246 Ga0209646_1000774 3300025246 Bacteria 11002
247 Ga0209646_1000800 3300025246 Bacteria 10718
248 Ga0209026_1000012 3300025250 Bacteria 480426
249 Ga0209026_1000140 3300025250 Bacteria 115081
250 Ga0209026_1000158 3300025250 Bacteria 106333
251 Ga0209026_1000249 3300025250 Bacteria 68455
252 Ga0209026_1000623 3300025250 Bacteria 22318
253 Ga0209026_1001417 3300025250 Bacteria 10663
254 Ga0209677_102724 3300025253 Bacteria 6342
255 Ga0209148_1000001 3300025254 Bacteria 2545271
256 Ga0209148_1000005 3300025254 Bacteria 1806504
257 Ga0209148_1000014 3300025254 Bacteria 925277
258 Ga0209148_1000039 3300025254 Bacteria 482479
259 Ga0209148_1000087 3300025254 Bacteria 260905
260 Ga0209148_1000098 3300025254 Bacteria 233172
261 Ga0209148_1000800 3300025254 Bacteria 23023
262 Ga0209759_1000750 3300025256 Bacteria 28083
263 Ga0209759_1002324 3300025256 Bacteria 8531
264 Ga0209759_1003101 3300025256 Bacteria 6824
265 Ga0209759_1005416 3300025256 Bacteria 4477
266 Ga0209129_1005552 3300025258 Bacteria 4407
267 Ga0209233_1000002 3300025261 Bacteria 2501366
268 Ga0209233_1000080 3300025261 Bacteria 338459
269 Ga0209233_1000174 3300025261 Bacteria 144639
270 Ga0209233_1000184 3300025261 Bacteria 134246
271 Ga0209233_1000283 3300025261 Bacteria 70137
272 Ga0209455_1000010 3300025272 Bacteria 959482
273 Ga0209455_1000034 3300025272 Bacteria 483129
274 Ga0209455_1000039 3300025272 Bacteria 437734
275 Ga0209455_1000126 3300025272 Bacteria 165771
276 Ga0209455_1000225 3300025272 Bacteria 76514
277 Ga0209455_1002762 3300025272 Bacteria 6578
278 Ga0209455_1017613 3300025272 Bacteria 1492
279 Ga0209455_1025444 3300025272 Bacteria 1076
280 Ga0209673_1006698 3300025273 Bacteria 5497
281 Ga0209130_1007294 3300025284 Bacteria 3433
282 Ga0209676_1004522 3300025292 Bacteria 7706
283 Ga0209676_1100738 3300025292 Bacteria 615
284 Ga0209025_1014734 3300025294 Bacteria 4780
285 Ga0209025_1088587 3300025294 Bacteria 1020
286 Ga0209758_1000683 3300025297 Bacteria 50557
287 Ga0209758_1036407 3300025297 Bacteria 1921
288 Ga0209758_1069191 3300025297 Bacteria 1120
289 Ga0209050_1002075 3300025298 Bacteria 18403
290 Ga0209050_1085080 3300025298 Bacteria 662
291 Ga0209256_1004463 3300025299 Bacteria 8757
292 Ga0209256_1005209 3300025299 Bacteria 7637
293 Ga0209256_1005400 3300025299 Bacteria 7387
294 Ga0209051_1038870 3300025303 Bacteria 1726
295 Ga0209257_1000080 3300025304 Bacteria 312038
296 Ga0209257_1001547 3300025304 Bacteria 26709
297 Ga0209257_1008506 3300025304 Bacteria 5806
298 Ga0209257_1029183 3300025304 Bacteria 1801
299 Ga0207656_10299258 3300025321 Bacteria 796
300 Ga0207692_10213131 3300025898 Bacteria 1141
301 Ga0207642_10548362 3300025899 Bacteria 714
302 Ga0207647_10001002 3300025904 Bacteria 21914
303 Ga0207647_10004453 3300025904 Bacteria 10383
304 Ga0207647_10008693 3300025904 Bacteria 7255
305 Ga0207647_10083343 3300025904 Bacteria 1915
306 Ga0207645_10082788 3300025907 Bacteria 2057
307 Ga0207645_10308190 3300025907 Bacteria 1055
308 Ga0207643_10229213 3300025908 Bacteria 1139
309 Ga0207705_10067253 3300025909 Bacteria 2593
310 Ga0207705_10284209 3300025909 Bacteria 1267
311 Ga0207654_10360826 3300025911 Bacteria 1002
312 Ga0207707_10006292 3300025912 Bacteria 10367
313 Ga0207707_10009177 3300025912 Bacteria 8588
314 Ga0207707_10023879 3300025912 Bacteria 5347
315 Ga0207707_10038212 3300025912 Bacteria 4195
316 Ga0207707_10040851 3300025912 Bacteria 4050
317 Ga0207695_10002599 3300025913 Bacteria 26471
318 Ga0207695_10080851 3300025913 Bacteria 3290
319 Ga0207671_10000020 3300025914 Bacteria 309636
320 Ga0207671_10000033 3300025914 Bacteria 245869
321 Ga0207671_10496407 3300025914 Bacteria 973
322 Ga0207663_10027658 3300025916 Bacteria 3309
323 Ga0207663_10680632 3300025916 Bacteria 813
324 Ga0207660_10045374 3300025917 Bacteria 3096
325 Ga0207660_10148084 3300025917 Bacteria 1801
326 Ga0207660_10816721 3300025917 Bacteria 761
327 Ga0207657_10024017 3300025919 Bacteria 5660
328 Ga0207657_10045229 3300025919 Bacteria 3865
329 Ga0207657_10050843 3300025919 Bacteria 3604
330 Ga0207657_10131673 3300025919 Bacteria 2049
331 Ga0207657_10346073 3300025919 Bacteria 1173
332 Ga0207657_10906164 3300025919 Bacteria 679
333 Ga0207649_10048455 3300025920 Bacteria 2621
334 Ga0207649_10316864 3300025920 Bacteria 1145
335 Ga0207649_11178135 3300025920 Bacteria 605
336 Ga0207652_10001336 3300025921 Bacteria 21912
337 Ga0207652_10020621 3300025921 Bacteria 5431
338 Ga0207652_10064579 3300025921 Bacteria 3167
339 Ga0207652_10072216 3300025921 Bacteria 3001
340 Ga0207681_10073632 3300025923 Bacteria 2390
341 Ga0207694_10007514 3300025924 Bacteria 8262
342 Ga0207694_10131346 3300025924 Bacteria 2007
343 Ga0207694_10161066 3300025924 Bacteria 1812
344 Ga0207694_10433922 3300025924 Bacteria 1095
345 Ga0207694_10784292 3300025924 Bacteria 805
346 Ga0207694_10971648 3300025924 Bacteria 718
347 Ga0207659_10490179 3300025926 Bacteria 1039
348 Ga0207700_10068954 3300025928 Bacteria 2712
349 Ga0207700_10304051 3300025928 Bacteria 1378
350 Ga0207700_10711552 3300025928 Bacteria 897
351 Ga0207664_10000021 3300025929 Bacteria 216875
352 Ga0207664_10006216 3300025929 Bacteria 8201
353 Ga0207690_10002181 3300025932 Bacteria 11936
354 Ga0207690_10011077 3300025932 Bacteria 5378
355 Ga0207690_10012273 3300025932 Bacteria 5127
356 Ga0207690_10033257 3300025932 Bacteria 3314
357 Ga0207690_10053311 3300025932 Bacteria 2713
358 Ga0207690_10082830 3300025932 Bacteria 2244
359 Ga0207690_11375325 3300025932 Bacteria 590
360 Ga0207706_10058024 3300025933 Bacteria 3410
361 Ga0207706_10062092 3300025933 Bacteria 3291
362 Ga0207706_10354799 3300025933 Bacteria 1275
363 Ga0207686_10203020 3300025934 Bacteria 1421
364 Ga0207704_10009145 3300025938 Bacteria 4767
365 Ga0207689_10007944 3300025942 Bacteria 9266
366 Ga0207661_10310746 3300025944 Bacteria 1415
367 Ga0207679_11224884 3300025945 Bacteria 689
368 Ga0207667_10000626 3300025949 Bacteria 45737
369 Ga0207667_10003601 3300025949 Bacteria 19116
370 Ga0207667_10013920 3300025949 Bacteria 9190
371 Ga0207667_10032128 3300025949 Bacteria 5658
372 Ga0207667_10457012 3300025949 Bacteria 1297
373 Ga0207668_10012033 3300025972 Bacteria 5281
374 Ga0207640_10011142 3300025981 Bacteria 5084
375 Ga0207640_10032424 3300025981 Bacteria 3239
376 Ga0207640_11318594 3300025981 Bacteria 645
377 Ga0207658_11062045 3300025986 Bacteria 739
378 Ga0207703_10029726 3300026035 Bacteria 4313
379 Ga0207639_10011219 3300026041 Bacteria 6216
380 Ga0207639_10059429 3300026041 Bacteria 2944
381 Ga0207639_10082743 3300026041 Bacteria 2545
382 Ga0207678_10417116 3300026067 Bacteria 1164
383 Ga0207678_10577913 3300026067 Bacteria 984
384 Ga0207702_10000290 3300026078 Bacteria 58330
385 Ga0207702_10002845 3300026078 Bacteria 16179
386 Ga0207702_10010831 3300026078 Bacteria 7606
387 Ga0207702_10132875 3300026078 Bacteria 2241
388 Ga0207702_10454544 3300026078 Bacteria 1243
389 Ga0207641_12001016 3300026088 Bacteria 581
390 Ga0207648_10938767 3300026089 Bacteria 809
391 Ga0207648_11509520 3300026089 Bacteria 632
392 Ga0207674_10000218 3300026116 Bacteria 71563
393 Ga0207674_10022041 3300026116 Bacteria 6849
394 Ga0207674_10030751 3300026116 Bacteria 5643
395 Ga0207674_10173995 3300026116 Bacteria 2105
396 Ga0207674_10853495 3300026116 Bacteria 878
397 Ga0207683_10017401 3300026121 Bacteria 6127
398 Ga0207683_10949973 3300026121 Bacteria 798
399 Ga0207698_10002678 3300026142 Bacteria 10595
400 Ga0207698_10053589 3300026142 Bacteria 3098
401 Ga0209371_1000016 3300027312 Bacteria 646301
402 Ga0268266_10116506 3300028379 Bacteria 2373
403 Ga0268265_10152465 3300028380 Bacteria 1951
404 Ga0268265_11522866 3300028380 Bacteria 673
405 Ga0268264_10483350 3300028381 Bacteria 1205
406 Ga0265338_10278542 3300028800 Bacteria 1223
407 Ga0268256_1000015 3300030500 Bacteria 646300
408 Ga0316176_1035937 3300030732 Bacteria 797
409 Ga0316182_1248774 3300030745 Bacteria 1736
410 Ga0307408_101438578 3300031548 Bacteria 650
411 Ga0307516_10017807 3300031730 Bacteria 7399
412 Ga0307412_10064358 3300031911 Bacteria 2477
413 Ga0307414_10180206 3300032004 Bacteria 1698
414 Ga0395899_0037966 3300037312 Bacteria 3610
415 Ga0395899_0242383 3300037312 Bacteria 1240
416 Ga0395900_0001732 3300037418 Bacteria 25181
417 Ga0395900_0008996 3300037418 Bacteria 10239
418 Ga0395900_0429103 3300037418 Bacteria 1281
419 Ga0395900_1808556 3300037418 Bacteria 521
420 Ga0395898_0006906 3300037466 Bacteria 12072
421 Ga0395898_0012279 3300037466 Bacteria 8858
422 Ga0395898_0117282 3300037466 Bacteria 2550
423 Ga0395898_0126878 3300037466 Bacteria 2444
424 Ga0395905_0142212 3300037471 Bacteria 2257
425 Ga0395901_0004132 3300038443 Bacteria 14636
426 Ga0395901_0030016 3300038443 Bacteria 5600
427 Ga0395901_0082423 3300038443 Bacteria 3360
428 Ga0395901_0096589 3300038443 Bacteria 3096
429 Ga0395901_0287657 3300038443 Bacteria 1706
430 Ga0395901_1111393 3300038443 Bacteria 760
431 Ga0436365_0650332 3300039437 Bacteria 1996
432 Ga0439436_0000014 3300041404 Bacteria 90241
433 Ga0439465_0000563 3300041413 Bacteria 11173
434 Ga0439465_0012786 3300041413 Bacteria 2624
435 Ga0451789_0513220 3300041443 Bacteria 768
436 Ga0451797_1092716 3300041453 Bacteria 2294
437 Ga0451802_0321649 3300041460 Bacteria 1182
438 Ga0451804_0639808 3300041463 Bacteria 1200
439 Ga0451807_0181925 3300041486 Bacteria 863
440 Ga0451833_0573159 3300041491 Bacteria 760
441 Ga0451837_0118483 3300041494 Bacteria 1980
442 Ga0439445_0006306 3300042004 Bacteria 2725
443 Ga0439449_0000206 3300042007 Bacteria 20728
444 Ga0439455_0101125 3300042012 Bacteria 797
445 Ga0439463_009567 3300042016 Bacteria 2385
446 Ga0466963_0428553 3300044694 Bacteria 933
447 Ga0466963_1247153 3300044694 Bacteria 522
448 Ga0466958_0386443 3300045836 Bacteria 903
449 Ga0466967_0078188 3300045976 Bacteria 2980
450 Ga0495617_000411 3300046452 Bacteria 23420
451 Ga0495651_0790196 3300046462 Bacteria 586
452 Ga0495610_0009510 3300046512 Bacteria 6135
453 Ga0495620_0019985 3300046515 Bacteria 3279
454 Ga0495640_0154904 3300046533 Bacteria 1471
455 Ga0495649_0044419 3300046694 Bacteria 2426
456 Ga0496103_0433442 3300048906 Bacteria 843
457 Ga0496104_0000020 3300048907 Bacteria 247296
458 Ga0496105_0000015 3300048908 Bacteria 218758
459 Ga0496115_0000176 3300048918 Bacteria 59595
460 Ga0496116_0108490 3300048919 Bacteria 1639
461 Ga0496116_0146827 3300048919 Bacteria 1317
462 Ga0496118_0042257 3300048921 Bacteria 3598
463 Ga0496118_0073288 3300048921 Bacteria 2454
464 Ga0496119_0019183 3300048922 Bacteria 5051
465 Ga0496120_0302563 3300048923 Bacteria 732
466 Ga0496123_0007006 3300048926 Bacteria 10750
467 Ga0496126_0000969 3300048929 Bacteria 49256
468 Ga0501031_0077685 3300049568 Bacteria 2162
469 Ga0501032_0082483 3300049569 Bacteria 2139
470 Ga0501032_0255666 3300049569 Bacteria 1136
471 Ga0501033_0013080 3300049570 Bacteria 6325
472 Ga0501033_0075751 3300049570 Bacteria 2469
473 Ga0501034_0057695 3300049571 Bacteria 3903
474 Ga0501034_0062796 3300049571 Bacteria 3729
475 Ga0501034_0339109 3300049571 Bacteria 1433
476 Ga0501034_0929458 3300049571 Bacteria 756
477 Ga0501034_1129674 3300049571 Bacteria 664
478 Ga0501036_0073177 3300049572 Bacteria 2897
479 Ga0501036_0123730 3300049572 Bacteria 2184
480 Ga0501036_0761035 3300049572 Bacteria 799
481 Ga0501037_0024412 3300049573 Bacteria 4471
482 Ga0501037_0051695 3300049573 Bacteria 3005
483 Ga0501037_0280491 3300049573 Bacteria 1161
484 Ga0501038_0069493 3300049574 Bacteria 2991
485 Ga0501038_0073014 3300049574 Bacteria 2906
486 Ga0501038_0110405 3300049574 Bacteria 2279
487 Ga0501039_0035229 3300049575 Bacteria 3862
488 Ga0501039_0295659 3300049575 Bacteria 1273
489 Ga0501040_1358567 3300049576 Bacteria 516
490 Ga0501042_0240640 3300049578 Bacteria 1306
491 Ga0501043_0046571 3300049579 Bacteria 3410
492 Ga0501043_0064230 3300049579 Bacteria 2882
493 Ga0501043_0080958 3300049579 Bacteria 2551
494 Ga0501043_0120480 3300049579 Bacteria 2057
495 Ga0501043_0848273 3300049579 Bacteria 658
496 Ga0501046_0084661 3300049580 Bacteria 2445
497 Ga0501046_0091518 3300049580 Bacteria 2339
498 Ga0501046_0340864 3300049580 Bacteria 1089
499 Ga0501047_0114067 3300049581 Bacteria 2584
500 Ga0501047_0154140 3300049581 Bacteria 2172
501 Ga0501047_0236063 3300049581 Bacteria 1680
502 Ga0501047_0273324 3300049581 Bacteria 1536
503 Ga0501047_0473030 3300049581 Bacteria 1081
504 Ga0501047_0760651 3300049581 Bacteria 784
505 Ga0501047_1236463 3300049581 Unclassified 561
506 Ga0501048_0417828 3300049582 Bacteria 959
507 Ga0501048_0455544 3300049582 Bacteria 916
508 Ga0501069_0159245 3300049585 Bacteria 1300
509 Ga0501070_0062457 3300049586 Bacteria 3086
510 Ga0501070_0139587 3300049586 Bacteria 2001
511 Ga0501070_0284660 3300049586 Bacteria 1348
512 Ga0501073_0141293 3300049589 Bacteria 1668
513 Ga0501073_0191870 3300049589 Bacteria 1414
514 Ga0501074_0158923 3300049590 Bacteria 1614
515 Ga0501225_0012331 3300049705 Bacteria 2400
516 Ga0501079_0461062 3300049741 Bacteria 998
517 Ga0501080_0029389 3300049742 Bacteria 5116
518 Ga0501080_0324732 3300049742 Bacteria 1393
519 Ga0501080_0709886 3300049742 Bacteria 886
520 Ga0501080_0965323 3300049742 Bacteria 740
521 Ga0501035_0007993 3300049822 Bacteria 9859
522 Ga0501035_0035525 3300049822 Bacteria 4522
523 Ga0501035_0081470 3300049822 Bacteria 2856
524 Ga0501035_0455421 3300049822 Bacteria 1058
525 Ga0501035_0661601 3300049822 Bacteria 846
526 Ga0501044_0071730 3300049823 Bacteria 3521
527 Ga0501044_0110801 3300049823 Bacteria 2753
528 Ga0501044_0150356 3300049823 Bacteria 2311
529 Ga0501044_0171681 3300049823 Bacteria 2139
530 Ga0501044_0945359 3300049823 Bacteria 735
531 Ga0501045_0449433 3300049824 Bacteria 958
532 nmdc:mga0sz30_102027_c1 3300050516 Bacteria 1254
533 Ga0587073_0070380 3300059492 Bacteria 844
534 Ga0587080_054436 3300059503 Bacteria 764
535 Ga0587082_034968 3300059504 Bacteria 895
536 Ga0587088_057309 3300059508 Bacteria 780
537 Ga0587067_054114 3300059640 Bacteria 822
538 Ga0587068_087097 3300059641 Bacteria 639
539 Ga0587072_064238 3300059643 Bacteria 762
540 Ga0587078_037262 3300059646 Bacteria 676
541 Ga0587120_010691 3300059659 Bacteria 780

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8003014200 8003016065 100
2 3300049580 Ga0501046_0091518 Ga0501046_0091518_549_935 101
3 3300049581 Ga0501047_0236063 Ga0501047_0236063_866_1252 101
4 3300005617 Ga0068859_101109272 Ga0068859_1011092722 102
5 3300005843 Ga0068860_100549344 Ga0068860_1005493443 102
6 3300006931 Ga0097620_101109262 Ga0097620_1011092622 102
7 3300028381 Ga0268264_10483350 Ga0268264_104833501 102
8 3300001989 JGI24739J22299_10000042 JGI24739J22299_1000004215 103
9 3300001989 JGI24739J22299_10000091 JGI24739J22299_1000009117 103
10 3300001990 JGI24737J22298_10002031 JGI24737J22298_100020318 103
11 3300003320 rootH2_10069172 rootH2_100691725 103
12 3300003578 Ga0006562J51391_1022432 Ga0006562J51391_10224323 103
13 3300003578 Ga0006562J51391_1022433 Ga0006562J51391_10224333 103
14 3300003784 Ga0055534_1012094 Ga0055534_10120942 103
15 3300003790 Ga0055528_1026599 Ga0055528_10265993 103
16 3300003794 Ga0055531_10011520 Ga0055531_100115204 103
17 3300005262 Ga0065165_1003017 Ga0065165_100301711 103
18 3300005336 Ga0070680_100171468 Ga0070680_1001714682 103
19 3300005339 Ga0070660_101233886 Ga0070660_1012338862 103
20 3300005344 Ga0070661_100412929 Ga0070661_1004129292 103
21 3300005366 Ga0070659_100828250 Ga0070659_1008282501 103
22 3300005457 Ga0070662_100039345 Ga0070662_1000393453 103
23 3300005457 Ga0070662_100273719 Ga0070662_1002737192 103
24 3300005458 Ga0070681_10001208 Ga0070681_100012085 103
25 3300005530 Ga0070679_100002407 Ga0070679_10000240713 103
26 3300005563 Ga0068855_100102918 Ga0068855_1001029183 103
27 3300005563 Ga0068855_100281616 Ga0068855_1002816162 103
28 3300005577 Ga0068857_100011171 Ga0068857_1000111719 103
29 3300005578 Ga0068854_100015759 Ga0068854_1000157594 103
30 3300005578 Ga0068854_100115542 Ga0068854_1001155423 103
31 3300005614 Ga0068856_100544617 Ga0068856_1005446171 103
32 3300005617 Ga0068859_101992271 Ga0068859_1019922712 103
33 3300005834 Ga0068851_10437507 Ga0068851_104375072 103
34 3300005842 Ga0068858_100080401 Ga0068858_1000804013 103
35 3300006358 Ga0068871_100154215 Ga0068871_1001542153 103
36 3300006931 Ga0097620_101992159 Ga0097620_1019921591 103
37 3300009093 Ga0105240_10128165 Ga0105240_101281653 103
38 3300013104 Ga0157370_10001569 Ga0157370_1000156911 103
39 3300013297 Ga0157378_10530126 Ga0157378_105301263 103
40 3300013306 Ga0163162_10007449 Ga0163162_1000744911 103
41 3300013306 Ga0163162_10561032 Ga0163162_105610323 103
42 3300013307 Ga0157372_10089260 Ga0157372_100892604 103
43 3300014969 Ga0157376_10007093 Ga0157376_100070931 103
44 3300022467 Ga0224712_10211084 Ga0224712_102110842 103
45 3300025258 Ga0209129_1005552 Ga0209129_10055526 103
46 3300025273 Ga0209673_1006698 Ga0209673_10066985 103
47 3300025284 Ga0209130_1007294 Ga0209130_10072944 103
48 3300025292 Ga0209676_1004522 Ga0209676_10045227 103
49 3300025292 Ga0209676_1100738 Ga0209676_11007381 103
50 3300025294 Ga0209025_1014734 Ga0209025_10147341 103
51 3300025294 Ga0209025_1088587 Ga0209025_10885872 103
52 3300025297 Ga0209758_1000683 Ga0209758_100068352 103
53 3300025297 Ga0209758_1069191 Ga0209758_10691913 103
54 3300025298 Ga0209050_1002075 Ga0209050_100207520 103
55 3300025298 Ga0209050_1085080 Ga0209050_10850802 103
56 3300025299 Ga0209256_1004463 Ga0209256_10044638 103
57 3300025299 Ga0209256_1005209 Ga0209256_10052092 103
58 3300025299 Ga0209256_1005400 Ga0209256_10054002 103
59 3300025303 Ga0209051_1038870 Ga0209051_10388703 103
60 3300025304 Ga0209257_1000080 Ga0209257_1000080145 103
61 3300025304 Ga0209257_1001547 Ga0209257_100154711 103
62 3300025304 Ga0209257_1008506 Ga0209257_10085062 103
63 3300025321 Ga0207656_10299258 Ga0207656_102992582 103
64 3300025904 Ga0207647_10008693 Ga0207647_1000869310 103
65 3300025912 Ga0207707_10040851 Ga0207707_100408511 103
66 3300025913 Ga0207695_10002599 Ga0207695_1000259934 103
67 3300025913 Ga0207695_10080851 Ga0207695_100808513 103
68 3300025914 Ga0207671_10000020 Ga0207671_10000020244 103
69 3300025914 Ga0207671_10000033 Ga0207671_1000003312 103
70 3300025917 Ga0207660_10148084 Ga0207660_101480843 103
71 3300025919 Ga0207657_10906164 Ga0207657_109061641 103
72 3300025920 Ga0207649_10316864 Ga0207649_103168642 103
73 3300025921 Ga0207652_10001336 Ga0207652_1000133612 103
74 3300025924 Ga0207694_10784292 Ga0207694_107842922 103
75 3300025932 Ga0207690_11375325 Ga0207690_113753251 103
76 3300025933 Ga0207706_10062092 Ga0207706_100620924 103
77 3300025945 Ga0207679_11224884 Ga0207679_112248842 103
78 3300025949 Ga0207667_10000626 Ga0207667_100006263 103
79 3300025949 Ga0207667_10003601 Ga0207667_1000360112 103
80 3300025981 Ga0207640_10011142 Ga0207640_100111424 103
81 3300025981 Ga0207640_10032424 Ga0207640_100324243 103
82 3300026035 Ga0207703_10029726 Ga0207703_100297264 103
83 3300026078 Ga0207702_10454544 Ga0207702_104545442 103
84 3300026116 Ga0207674_10000218 Ga0207674_1000021856 103
85 3300026142 Ga0207698_10002678 Ga0207698_100026789 103
86 3300027312 Ga0209371_1000016 Ga0209371_1000016180 103
87 3300030500 Ga0268256_1000015 Ga0268256_1000015390 103
88 3300031548 Ga0307408_101438578 Ga0307408_1014385782 103
89 3300041443 Ga0451789_0513220 Ga0451789_0513220_350_742 103
90 3300041453 Ga0451797_1092716 Ga0451797_1092716_745_1137 103
91 3300041460 Ga0451802_0321649 Ga0451802_0321649_117_512 103
92 3300044694 Ga0466963_1247153 Ga0466963_1247153_94_483 103
93 3300045836 Ga0466958_0386443 Ga0466958_0386443_154_543 103
94 3300049579 Ga0501043_0120480 Ga0501043_0120480_860_1267 103
95 3300049581 Ga0501047_0473030 Ga0501047_0473030_503_895 103
96 3300049581 Ga0501047_1236463 Ga0501047_1236463_19_408 103
97 3300049585 Ga0501069_0159245 Ga0501069_0159245_261_650 103
98 3300049589 Ga0501073_0191870 Ga0501073_0191870_680_1069 103
99 3300049590 Ga0501074_0158923 Ga0501074_0158923_1140_1529 103
100 3300049742 Ga0501080_0324732 Ga0501080_0324732_798_1190 103
101 3300049742 Ga0501080_0965323 Ga0501080_0965323_168_557 103
102 3300049822 Ga0501035_0081470 Ga0501035_0081470_1775_2167 103
103 3300049823 Ga0501044_0110801 Ga0501044_0110801_1906_2298 103
104 3300059492 Ga0587073_0070380 Ga0587073_0070380_86_478 103
105 3300059503 Ga0587080_054436 Ga0587080_054436_263_655 103
106 3300059504 Ga0587082_034968 Ga0587082_034968_265_657 103
107 3300059508 Ga0587088_057309 Ga0587088_057309_124_516 103
108 3300059640 Ga0587067_054114 Ga0587067_054114_166_558 103
109 3300059641 Ga0587068_087097 Ga0587068_087097_233_625 103
110 3300059643 Ga0587072_064238 Ga0587072_064238_261_653 103
111 3300059646 Ga0587078_037262 Ga0587078_037262_265_657 103
112 3300059659 Ga0587120_010691 Ga0587120_010691_124_516 103
113 3300001990 JGI24737J22298_10030880 JGI24737J22298_100308803 104
114 3300002067 JGI24735J21928_10006310 JGI24735J21928_100063104 104
115 3300002737 JGI25162J39368_1000529 JGI25162J39368_100052920 104
116 3300002741 JGI25157J39369_1000446 JGI25157J39369_100044617 104
117 3300002741 JGI25157J39369_1000950 JGI25157J39369_100095015 104
118 3300002741 JGI25157J39369_1001638 JGI25157J39369_10016389 104
119 3300002741 JGI25157J39369_1002462 JGI25157J39369_10024624 104
120 3300002741 JGI25157J39369_1003251 JGI25157J39369_10032513 104
121 3300002771 JGI25163J39215_1000279 JGI25163J39215_100027913 104
122 3300002771 JGI25163J39215_1000580 JGI25163J39215_10005803 104
123 3300002772 JGI25164J39214_1000102 JGI25164J39214_10001023 104
124 3300002772 JGI25164J39214_1000142 JGI25164J39214_100014240 104
125 3300002772 JGI25164J39214_1000561 JGI25164J39214_10005614 104
126 3300002772 JGI25164J39214_1000564 JGI25164J39214_10005644 104
127 3300003214 JGI25165J46597_1000058 JGI25165J46597_1000058157 104
128 3300003214 JGI25165J46597_1000090 JGI25165J46597_100009046 104
129 3300003214 JGI25165J46597_1001122 JGI25165J46597_100112215 104
130 3300003214 JGI25165J46597_1001290 JGI25165J46597_100129013 104
131 3300003316 rootH1_10127202 rootH1_101272022 104
132 3300003320 rootH2_10011619 rootH2_1001161920 104
133 3300003323 rootH1_10142898 rootH1_101428983 104
134 3300003558 Ga0006558J51389_1026097 Ga0006558J51389_10260972 104
135 3300003565 Ga0006560J51390_1026969 Ga0006560J51390_10269692 104
136 3300003567 Ga0006554J51385_1023919 Ga0006554J51385_10239192 104
137 3300003751 Ga0055538_1000714 Ga0055538_10007147 104
138 3300003752 Ga0055539_1000821 Ga0055539_10008214 104
139 3300003760 Ga0055527_1000105 Ga0055527_100010520 104
140 3300003760 Ga0055527_1000253 Ga0055527_100025321 104
141 3300003761 Ga0055535_1000034 Ga0055535_100003459 104
142 3300003761 Ga0055535_1000150 Ga0055535_100015050 104
143 3300003761 Ga0055535_1000488 Ga0055535_100048838 104
144 3300003761 Ga0055535_1000765 Ga0055535_100076527 104
145 3300003761 Ga0055535_1000789 Ga0055535_100078922 104
146 3300003761 Ga0055535_1008250 Ga0055535_10082503 104
147 3300003762 Ga0055542_1000198 Ga0055542_100019820 104
148 3300003762 Ga0055542_1000685 Ga0055542_10006857 104
149 3300003762 Ga0055542_1001221 Ga0055542_100122111 104
150 3300003762 Ga0055542_1002647 Ga0055542_10026472 104
151 3300003762 Ga0055542_1010441 Ga0055542_10104411 104
152 3300003763 Ga0055529_1000083 Ga0055529_1000083158 104
153 3300003763 Ga0055529_1000305 Ga0055529_100030539 104
154 3300003763 Ga0055529_1000343 Ga0055529_100034336 104
155 3300003763 Ga0055529_1000443 Ga0055529_100044346 104
156 3300003763 Ga0055529_1000667 Ga0055529_100066714 104
157 3300005327 Ga0070658_10084617 Ga0070658_100846173 104
158 3300005328 Ga0070676_10073029 Ga0070676_100730293 104
159 3300005329 Ga0070683_100510265 Ga0070683_1005102653 104
160 3300005331 Ga0070670_100457303 Ga0070670_1004573032 104
161 3300005334 Ga0068869_100029649 Ga0068869_1000296491 104
162 3300005335 Ga0070666_10000005 Ga0070666_10000005214 104
163 3300005335 Ga0070666_10158341 Ga0070666_101583412 104
164 3300005337 Ga0070682_100222268 Ga0070682_1002222683 104
165 3300005338 Ga0068868_100127646 Ga0068868_1001276463 104
166 3300005339 Ga0070660_100014647 Ga0070660_1000146474 104
167 3300005339 Ga0070660_100060185 Ga0070660_1000601852 104
168 3300005339 Ga0070660_100263617 Ga0070660_1002636173 104
169 3300005341 Ga0070691_10927065 Ga0070691_109270651 104
170 3300005344 Ga0070661_100037225 Ga0070661_1000372253 104
171 3300005344 Ga0070661_100101390 Ga0070661_1001013903 104
172 3300005345 Ga0070692_10003905 Ga0070692_100039053 104
173 3300005345 Ga0070692_10638255 Ga0070692_106382552 104
174 3300005347 Ga0070668_100047703 Ga0070668_1000477033 104
175 3300005353 Ga0070669_100084069 Ga0070669_1000840693 104
176 3300005355 Ga0070671_100398732 Ga0070671_1003987323 104
177 3300005365 Ga0070688_100379867 Ga0070688_1003798672 104
178 3300005366 Ga0070659_100002615 Ga0070659_1000026154 104
179 3300005366 Ga0070659_100010942 Ga0070659_1000109427 104
180 3300005366 Ga0070659_100429987 Ga0070659_1004299872 104
181 3300005366 Ga0070659_100535392 Ga0070659_1005353921 104
182 3300005367 Ga0070667_100268654 Ga0070667_1002686542 104
183 3300005367 Ga0070667_101052342 Ga0070667_1010523422 104
184 3300005435 Ga0070714_100000034 Ga0070714_10000003411 104
185 3300005435 Ga0070714_101766067 Ga0070714_1017660671 104
186 3300005437 Ga0070710_10241069 Ga0070710_102410692 104
187 3300005439 Ga0070711_100053534 Ga0070711_1000535344 104
188 3300005439 Ga0070711_100788002 Ga0070711_1007880022 104
189 3300005444 Ga0070694_100133139 Ga0070694_1001331393 104
190 3300005456 Ga0070678_100002303 Ga0070678_1000023039 104
191 3300005457 Ga0070662_100867638 Ga0070662_1008676382 104
192 3300005458 Ga0070681_10011042 Ga0070681_100110426 104
193 3300005458 Ga0070681_10012125 Ga0070681_100121259 104
194 3300005459 Ga0068867_100868889 Ga0068867_1008688892 104
195 3300005459 Ga0068867_101820985 Ga0068867_1018209852 104
196 3300005530 Ga0070679_100025171 Ga0070679_1000251717 104
197 3300005530 Ga0070679_100137234 Ga0070679_1001372343 104
198 3300005530 Ga0070679_100914185 Ga0070679_1009141852 104
199 3300005535 Ga0070684_101913831 Ga0070684_1019138311 104
200 3300005539 Ga0068853_100003663 Ga0068853_10000366311 104
201 3300005539 Ga0068853_100076470 Ga0068853_1000764703 104
202 3300005539 Ga0068853_100147205 Ga0068853_1001472053 104
203 3300005546 Ga0070696_100001218 Ga0070696_1000012183 104
204 3300005546 Ga0070696_100011587 Ga0070696_1000115875 104
205 3300005546 Ga0070696_100027352 Ga0070696_1000273523 104
206 3300005547 Ga0070693_100023546 Ga0070693_1000235463 104
207 3300005547 Ga0070693_100045860 Ga0070693_1000458603 104
208 3300005547 Ga0070693_100310412 Ga0070693_1003104122 104
209 3300005548 Ga0070665_100018710 Ga0070665_1000187107 104
210 3300005548 Ga0070665_100101467 Ga0070665_1001014673 104
211 3300005563 Ga0068855_100015915 Ga0068855_1000159157 104
212 3300005564 Ga0070664_100943826 Ga0070664_1009438262 104
213 3300005577 Ga0068857_100014459 Ga0068857_1000144598 104
214 3300005577 Ga0068857_100136395 Ga0068857_1001363953 104
215 3300005577 Ga0068857_100213911 Ga0068857_1002139112 104
216 3300005578 Ga0068854_100013946 Ga0068854_1000139464 104
217 3300005578 Ga0068854_100819998 Ga0068854_1008199982 104
218 3300005614 Ga0068856_100011722 Ga0068856_1000117225 104
219 3300005614 Ga0068856_100014629 Ga0068856_1000146297 104
220 3300005614 Ga0068856_100564780 Ga0068856_1005647803 104
221 3300005616 Ga0068852_100161254 Ga0068852_1001612543 104
222 3300005617 Ga0068859_100291417 Ga0068859_1002914171 104
223 3300005718 Ga0068866_10388608 Ga0068866_103886082 104
224 3300005840 Ga0068870_10007797 Ga0068870_100077974 104
225 3300005842 Ga0068858_101326167 Ga0068858_1013261672 104
226 3300005843 Ga0068860_100158982 Ga0068860_1001589821 104
227 3300005844 Ga0068862_101094638 Ga0068862_1010946382 104
228 3300005844 Ga0068862_101456606 Ga0068862_1014566062 104
229 3300006186 Ga0075369_10071843 Ga0075369_100718433 104
230 3300006881 Ga0068865_100005258 Ga0068865_1000052589 104
231 3300006881 Ga0068865_100089935 Ga0068865_1000899353 104
232 3300006931 Ga0097620_100291415 Ga0097620_1002914154 104
233 3300009093 Ga0105240_12100020 Ga0105240_121000201 104
234 3300009174 Ga0105241_10196666 Ga0105241_101966662 104
235 3300009174 Ga0105241_11198595 Ga0105241_111985952 104
236 3300009176 Ga0105242_10329868 Ga0105242_103298683 104
237 3300009545 Ga0105237_10066156 Ga0105237_100661562 104
238 3300009545 Ga0105237_10136351 Ga0105237_101363513 104
239 3300009551 Ga0105238_10000060 Ga0105238_10000060125 104
240 3300009551 Ga0105238_10001388 Ga0105238_1000138810 104
241 3300009551 Ga0105238_10012789 Ga0105238_100127895 104
242 3300009551 Ga0105238_10069871 Ga0105238_100698713 104
243 3300009551 Ga0105238_10130701 Ga0105238_101307014 104
244 3300009982 Ga0105147_101220 Ga0105147_1012201 104
245 3300010375 Ga0105239_10176072 Ga0105239_101760724 104
246 3300013100 Ga0157373_10002017 Ga0157373_100020179 104
247 3300013100 Ga0157373_10362225 Ga0157373_103622252 104
248 3300013102 Ga0157371_10005539 Ga0157371_100055397 104
249 3300013104 Ga0157370_10001227 Ga0157370_1000122730 104
250 3300013104 Ga0157370_10011574 Ga0157370_1001157410 104
251 3300013104 Ga0157370_10011968 Ga0157370_1001196811 104
252 3300013105 Ga0157369_10008129 Ga0157369_100081293 104
253 3300013306 Ga0163162_10000294 Ga0163162_1000029432 104
254 3300013306 Ga0163162_10052559 Ga0163162_100525595 104
255 3300013307 Ga0157372_10008772 Ga0157372_100087724 104
256 3300013307 Ga0157372_10594097 Ga0157372_105940972 104
257 3300013307 Ga0157372_10876806 Ga0157372_108768062 104
258 3300013308 Ga0157375_12525027 Ga0157375_125250272 104
259 3300014497 Ga0182008_10004760 Ga0182008_100047604 104
260 3300014497 Ga0182008_10007657 Ga0182008_100076579 104
261 3300014497 Ga0182008_10228507 Ga0182008_102285072 104
262 3300014497 Ga0182008_10462063 Ga0182008_104620632 104
263 3300014968 Ga0157379_11703261 Ga0157379_117032612 104
264 3300015261 Ga0182006_1006458 Ga0182006_10064583 104
265 3300015261 Ga0182006_1019261 Ga0182006_10192613 104
266 3300015261 Ga0182006_1019850 Ga0182006_10198503 104
267 3300015262 Ga0182007_10049487 Ga0182007_100494873 104
268 3300015262 Ga0182007_10091395 Ga0182007_100913951 104
269 3300015262 Ga0182007_10112168 Ga0182007_101121682 104
270 3300015265 Ga0182005_1002081 Ga0182005_10020819 104
271 3300015687 Ga0183368_1003 Ga0183368_10031003 104
272 3300020070 Ga0206356_10558970 Ga0206356_105589704 104
273 3300020077 Ga0206351_10475332 Ga0206351_104753322 104
274 3300022467 Ga0224712_10091259 Ga0224712_100912593 104
275 3300025206 Ga0209435_102859 Ga0209435_1028593 104
276 3300025206 Ga0209435_112230 Ga0209435_1122302 104
277 3300025206 Ga0209435_112906 Ga0209435_1129061 104
278 3300025207 Ga0209760_100373 Ga0209760_10037311 104
279 3300025224 Ga0209784_100016 Ga0209784_100016394 104
280 3300025225 Ga0209566_101739 Ga0209566_1017393 104
281 3300025226 Ga0209674_100012 Ga0209674_100012749 104
282 3300025226 Ga0209674_100244 Ga0209674_10024429 104
283 3300025226 Ga0209674_100318 Ga0209674_10031828 104
284 3300025226 Ga0209674_100489 Ga0209674_1004893 104
285 3300025228 Ga0209672_100007 Ga0209672_100007146 104
286 3300025228 Ga0209672_100078 Ga0209672_100078105 104
287 3300025228 Ga0209672_100265 Ga0209672_1002658 104
288 3300025228 Ga0209672_100885 Ga0209672_10088510 104
289 3300025228 Ga0209672_101218 Ga0209672_1012184 104
290 3300025230 Ga0209563_100079 Ga0209563_10007912 104
291 3300025231 Ga0207427_100019 Ga0207427_10001920 104
292 3300025231 Ga0207427_100033 Ga0207427_100033193 104
293 3300025231 Ga0207427_100050 Ga0207427_100050211 104
294 3300025231 Ga0207427_100123 Ga0207427_10012357 104
295 3300025231 Ga0207427_106794 Ga0207427_1067943 104
296 3300025233 Ga0209437_100012 Ga0209437_100012223 104
297 3300025233 Ga0209437_100105 Ga0209437_10010592 104
298 3300025233 Ga0209437_100120 Ga0209437_100120131 104
299 3300025233 Ga0209437_100192 Ga0209437_10019292 104
300 3300025233 Ga0209437_100227 Ga0209437_10022739 104
301 3300025242 Ga0209258_100012 Ga0209258_100012597 104
302 3300025242 Ga0209258_100039 Ga0209258_100039400 104
303 3300025242 Ga0209258_100046 Ga0209258_100046191 104
304 3300025242 Ga0209258_100095 Ga0209258_100095140 104
305 3300025242 Ga0209258_100238 Ga0209258_10023811 104
306 3300025242 Ga0209258_100308 Ga0209258_10030828 104
307 3300025246 Ga0209646_1000582 Ga0209646_100058210 104
308 3300025246 Ga0209646_1000774 Ga0209646_10007749 104
309 3300025246 Ga0209646_1000800 Ga0209646_100080010 104
310 3300025250 Ga0209026_1000012 Ga0209026_100001292 104
311 3300025250 Ga0209026_1000140 Ga0209026_100014088 104
312 3300025250 Ga0209026_1000158 Ga0209026_100015830 104
313 3300025250 Ga0209026_1000249 Ga0209026_100024925 104
314 3300025250 Ga0209026_1000623 Ga0209026_10006233 104
315 3300025250 Ga0209026_1001417 Ga0209026_100141711 104
316 3300025253 Ga0209677_102724 Ga0209677_1027245 104
317 3300025254 Ga0209148_1000001 Ga0209148_10000011665 104
318 3300025254 Ga0209148_1000005 Ga0209148_1000005695 104
319 3300025254 Ga0209148_1000014 Ga0209148_100001459 104
320 3300025254 Ga0209148_1000039 Ga0209148_1000039352 104
321 3300025254 Ga0209148_1000087 Ga0209148_1000087154 104
322 3300025254 Ga0209148_1000098 Ga0209148_100009862 104
323 3300025254 Ga0209148_1000800 Ga0209148_10008005 104
324 3300025256 Ga0209759_1000750 Ga0209759_100075024 104
325 3300025256 Ga0209759_1002324 Ga0209759_10023248 104
326 3300025256 Ga0209759_1003101 Ga0209759_10031017 104
327 3300025256 Ga0209759_1005416 Ga0209759_10054163 104
328 3300025261 Ga0209233_1000002 Ga0209233_1000002567 104
329 3300025261 Ga0209233_1000080 Ga0209233_1000080193 104
330 3300025261 Ga0209233_1000174 Ga0209233_100017440 104
331 3300025261 Ga0209233_1000184 Ga0209233_100018432 104
332 3300025261 Ga0209233_1000283 Ga0209233_100028357 104
333 3300025272 Ga0209455_1000010 Ga0209455_1000010146 104
334 3300025272 Ga0209455_1000034 Ga0209455_1000034353 104
335 3300025272 Ga0209455_1000039 Ga0209455_1000039400 104
336 3300025272 Ga0209455_1000126 Ga0209455_100012655 104
337 3300025272 Ga0209455_1000225 Ga0209455_100022511 104
338 3300025272 Ga0209455_1002762 Ga0209455_10027627 104
339 3300025272 Ga0209455_1017613 Ga0209455_10176132 104
340 3300025272 Ga0209455_1025444 Ga0209455_10254441 104
341 3300025297 Ga0209758_1036407 Ga0209758_10364071 104
342 3300025304 Ga0209257_1029183 Ga0209257_10291833 104
343 3300025898 Ga0207692_10213131 Ga0207692_102131313 104
344 3300025899 Ga0207642_10548362 Ga0207642_105483622 104
345 3300025904 Ga0207647_10001002 Ga0207647_100010024 104
346 3300025904 Ga0207647_10004453 Ga0207647_100044533 104
347 3300025904 Ga0207647_10083343 Ga0207647_100833433 104
348 3300025907 Ga0207645_10082788 Ga0207645_100827883 104
349 3300025907 Ga0207645_10308190 Ga0207645_103081902 104
350 3300025908 Ga0207643_10229213 Ga0207643_102292133 104
351 3300025909 Ga0207705_10067253 Ga0207705_100672533 104
352 3300025909 Ga0207705_10284209 Ga0207705_102842093 104
353 3300025911 Ga0207654_10360826 Ga0207654_103608263 104
354 3300025912 Ga0207707_10006292 Ga0207707_1000629211 104
355 3300025912 Ga0207707_10009177 Ga0207707_100091773 104
356 3300025912 Ga0207707_10023879 Ga0207707_100238798 104
357 3300025912 Ga0207707_10038212 Ga0207707_100382124 104
358 3300025914 Ga0207671_10496407 Ga0207671_104964072 104
359 3300025916 Ga0207663_10027658 Ga0207663_100276584 104
360 3300025916 Ga0207663_10680632 Ga0207663_106806322 104
361 3300025917 Ga0207660_10045374 Ga0207660_100453743 104
362 3300025917 Ga0207660_10816721 Ga0207660_108167212 104
363 3300025919 Ga0207657_10024017 Ga0207657_100240177 104
364 3300025919 Ga0207657_10045229 Ga0207657_100452292 104
365 3300025919 Ga0207657_10050843 Ga0207657_100508433 104
366 3300025919 Ga0207657_10131673 Ga0207657_101316732 104
367 3300025919 Ga0207657_10346073 Ga0207657_103460732 104
368 3300025920 Ga0207649_10048455 Ga0207649_100484553 104
369 3300025920 Ga0207649_11178135 Ga0207649_111781352 104
370 3300025921 Ga0207652_10020621 Ga0207652_100206212 104
371 3300025921 Ga0207652_10064579 Ga0207652_100645792 104
372 3300025921 Ga0207652_10072216 Ga0207652_100722163 104
373 3300025923 Ga0207681_10073632 Ga0207681_100736324 104
374 3300025924 Ga0207694_10007514 Ga0207694_100075147 104
375 3300025924 Ga0207694_10131346 Ga0207694_101313463 104
376 3300025924 Ga0207694_10161066 Ga0207694_101610662 104
377 3300025924 Ga0207694_10433922 Ga0207694_104339222 104
378 3300025924 Ga0207694_10971648 Ga0207694_109716482 104
379 3300025926 Ga0207659_10490179 Ga0207659_104901793 104
380 3300025928 Ga0207700_10068954 Ga0207700_100689543 104
381 3300025928 Ga0207700_10304051 Ga0207700_103040513 104
382 3300025929 Ga0207664_10000021 Ga0207664_10000021209 104
383 3300025929 Ga0207664_10006216 Ga0207664_100062164 104
384 3300025932 Ga0207690_10002181 Ga0207690_100021817 104
385 3300025932 Ga0207690_10011077 Ga0207690_100110771 104
386 3300025932 Ga0207690_10012273 Ga0207690_100122733 104
387 3300025932 Ga0207690_10033257 Ga0207690_100332573 104
388 3300025932 Ga0207690_10053311 Ga0207690_100533113 104
389 3300025932 Ga0207690_10082830 Ga0207690_100828303 104
390 3300025933 Ga0207706_10058024 Ga0207706_100580241 104
391 3300025933 Ga0207706_10354799 Ga0207706_103547992 104
392 3300025934 Ga0207686_10203020 Ga0207686_102030202 104
393 3300025938 Ga0207704_10009145 Ga0207704_100091457 104
394 3300025942 Ga0207689_10007944 Ga0207689_100079448 104
395 3300025944 Ga0207661_10310746 Ga0207661_103107463 104
396 3300025949 Ga0207667_10013920 Ga0207667_100139207 104
397 3300025949 Ga0207667_10032128 Ga0207667_100321283 104
398 3300025949 Ga0207667_10457012 Ga0207667_104570121 104
399 3300025972 Ga0207668_10012033 Ga0207668_100120335 104
400 3300025981 Ga0207640_11318594 Ga0207640_113185942 104
401 3300025986 Ga0207658_11062045 Ga0207658_110620452 104
402 3300026041 Ga0207639_10011219 Ga0207639_100112192 104
403 3300026041 Ga0207639_10059429 Ga0207639_100594293 104
404 3300026041 Ga0207639_10082743 Ga0207639_100827433 104
405 3300026067 Ga0207678_10417116 Ga0207678_104171163 104
406 3300026067 Ga0207678_10577913 Ga0207678_105779133 104
407 3300026078 Ga0207702_10000290 Ga0207702_1000029021 104
408 3300026078 Ga0207702_10002845 Ga0207702_100028457 104
409 3300026078 Ga0207702_10010831 Ga0207702_100108319 104
410 3300026088 Ga0207641_12001016 Ga0207641_120010162 104
411 3300026089 Ga0207648_10938767 Ga0207648_109387673 104
412 3300026089 Ga0207648_11509520 Ga0207648_115095202 104
413 3300026116 Ga0207674_10022041 Ga0207674_100220418 104
414 3300026116 Ga0207674_10030751 Ga0207674_100307513 104
415 3300026116 Ga0207674_10853495 Ga0207674_108534952 104
416 3300026121 Ga0207683_10017401 Ga0207683_100174014 104
417 3300026121 Ga0207683_10949973 Ga0207683_109499732 104
418 3300026142 Ga0207698_10053589 Ga0207698_100535893 104
419 3300028379 Ga0268266_10116506 Ga0268266_101165061 104
420 3300028380 Ga0268265_10152465 Ga0268265_101524652 104
421 3300028380 Ga0268265_11522866 Ga0268265_115228662 104
422 3300028800 Ga0265338_10278542 Ga0265338_102785421 104
423 3300030732 Ga0316176_1035937 Ga0316176_10359371 104
424 3300030745 Ga0316182_1248774 Ga0316182_12487742 104
425 3300031730 Ga0307516_10017807 Ga0307516_100178075 104
426 3300031911 Ga0307412_10064358 Ga0307412_100643582 104
427 3300032004 Ga0307414_10180206 Ga0307414_101802063 104
428 3300037312 Ga0395899_0242383 Ga0395899_0242383_606_1001 104
429 3300037418 Ga0395900_0001732 Ga0395900_0001732_3057_3452 104
430 3300037418 Ga0395900_0429103 Ga0395900_0429103_316_711 104
431 3300037418 Ga0395900_1808556 Ga0395900_1808556_32_427 104
432 3300037466 Ga0395898_0006906 Ga0395898_0006906_508_903 104
433 3300037466 Ga0395898_0117282 Ga0395898_0117282_1983_2378 104
434 3300037466 Ga0395898_0126878 Ga0395898_0126878_1539_1934 104
435 3300037471 Ga0395905_0142212 Ga0395905_0142212_594_989 104
436 3300038443 Ga0395901_0004132 Ga0395901_0004132_4472_4867 104
437 3300038443 Ga0395901_0030016 Ga0395901_0030016_4710_5105 104
438 3300038443 Ga0395901_0082423 Ga0395901_0082423_510_905 104
439 3300038443 Ga0395901_0096589 Ga0395901_0096589_1728_2123 104
440 3300038443 Ga0395901_0287657 Ga0395901_0287657_620_1015 104
441 3300038443 Ga0395901_1111393 Ga0395901_1111393_12_407 104
442 3300041404 Ga0439436_0000014 Ga0439436_0000014_71805_72197 104
443 3300041413 Ga0439465_0000563 Ga0439465_0000563_9683_10078 104
444 3300041413 Ga0439465_0012786 Ga0439465_0012786_674_1069 104
445 3300041463 Ga0451804_0639808 Ga0451804_0639808_517_912 104
446 3300041486 Ga0451807_0181925 Ga0451807_0181925_405_800 104
447 3300041491 Ga0451833_0573159 Ga0451833_0573159_309_704 104
448 3300041494 Ga0451837_0118483 Ga0451837_0118483_959_1354 104
449 3300042004 Ga0439445_0006306 Ga0439445_0006306_2032_2427 104
450 3300042007 Ga0439449_0000206 Ga0439449_0000206_12489_12884 104
451 3300042012 Ga0439455_0101125 Ga0439455_0101125_267_662 104
452 3300042016 Ga0439463_009567 Ga0439463_009567_44_439 104
453 3300044694 Ga0466963_0428553 Ga0466963_0428553_34_429 104
454 3300045976 Ga0466967_0078188 Ga0466967_0078188_759_1154 104
455 3300046452 Ga0495617_000411 Ga0495617_000411_2939_3331 104
456 3300046462 Ga0495651_0790196 Ga0495651_0790196_32_427 104
457 3300046512 Ga0495610_0009510 Ga0495610_0009510_3496_3888 104
458 3300046515 Ga0495620_0019985 Ga0495620_0019985_1234_1626 104
459 3300046533 Ga0495640_0154904 Ga0495640_0154904_459_854 104
460 3300046694 Ga0495649_0044419 Ga0495649_0044419_75_467 104
461 3300048907 Ga0496104_0000020 Ga0496104_0000020_27298_27693 104
462 3300048908 Ga0496105_0000015 Ga0496105_0000015_32842_33237 104
463 3300048919 Ga0496116_0108490 Ga0496116_0108490_1163_1555 104
464 3300048919 Ga0496116_0146827 Ga0496116_0146827_899_1291 104
465 3300048921 Ga0496118_0073288 Ga0496118_0073288_1676_2068 104
466 3300048922 Ga0496119_0019183 Ga0496119_0019183_2527_2919 104
467 3300048923 Ga0496120_0302563 Ga0496120_0302563_226_618 104
468 3300048926 Ga0496123_0007006 Ga0496123_0007006_9365_9757 104
469 3300049568 Ga0501031_0077685 Ga0501031_0077685_1187_1582 104
470 3300049569 Ga0501032_0082483 Ga0501032_0082483_263_658 104
471 3300049569 Ga0501032_0255666 Ga0501032_0255666_729_1124 104
472 3300049570 Ga0501033_0013080 Ga0501033_0013080_3009_3404 104
473 3300049570 Ga0501033_0075751 Ga0501033_0075751_1845_2240 104
474 3300049571 Ga0501034_0057695 Ga0501034_0057695_2501_2896 104
475 3300049571 Ga0501034_0062796 Ga0501034_0062796_1068_1478 104
476 3300049571 Ga0501034_0339109 Ga0501034_0339109_263_658 104
477 3300049571 Ga0501034_0929458 Ga0501034_0929458_152_562 104
478 3300049571 Ga0501034_1129674 Ga0501034_1129674_14_409 104
479 3300049572 Ga0501036_0073177 Ga0501036_0073177_1868_2263 104
480 3300049572 Ga0501036_0123730 Ga0501036_0123730_1475_1885 104
481 3300049572 Ga0501036_0761035 Ga0501036_0761035_201_611 104
482 3300049573 Ga0501037_0024412 Ga0501037_0024412_1222_1632 104
483 3300049573 Ga0501037_0051695 Ga0501037_0051695_1632_2027 104
484 3300049573 Ga0501037_0280491 Ga0501037_0280491_642_1037 104
485 3300049574 Ga0501038_0069493 Ga0501038_0069493_527_922 104
486 3300049574 Ga0501038_0073014 Ga0501038_0073014_1604_2014 104
487 3300049574 Ga0501038_0110405 Ga0501038_0110405_1657_2052 104
488 3300049575 Ga0501039_0035229 Ga0501039_0035229_2633_3043 104
489 3300049575 Ga0501039_0295659 Ga0501039_0295659_463_873 104
490 3300049576 Ga0501040_1358567 Ga0501040_1358567_63_458 104
491 3300049579 Ga0501043_0046571 Ga0501043_0046571_535_930 104
492 3300049579 Ga0501043_0064230 Ga0501043_0064230_2170_2580 104
493 3300049579 Ga0501043_0080958 Ga0501043_0080958_911_1306 104
494 3300049579 Ga0501043_0848273 Ga0501043_0848273_57_452 104
495 3300049580 Ga0501046_0340864 Ga0501046_0340864_11_406 104
496 3300049581 Ga0501047_0114067 Ga0501047_0114067_474_884 104
497 3300049581 Ga0501047_0154140 Ga0501047_0154140_430_825 104
498 3300049581 Ga0501047_0273324 Ga0501047_0273324_312_722 104
499 3300049581 Ga0501047_0760651 Ga0501047_0760651_336_731 104
500 3300049582 Ga0501048_0417828 Ga0501048_0417828_473_883 104
501 3300049582 Ga0501048_0455544 Ga0501048_0455544_498_893 104
502 3300049586 Ga0501070_0284660 Ga0501070_0284660_578_988 104
503 3300049705 Ga0501225_0012331 Ga0501225_0012331_790_1185 104
504 3300049741 Ga0501079_0461062 Ga0501079_0461062_223_633 104
505 3300049742 Ga0501080_0029389 Ga0501080_0029389_3880_4290 104
506 3300049822 Ga0501035_0007993 Ga0501035_0007993_8778_9173 104
507 3300049822 Ga0501035_0035525 Ga0501035_0035525_1098_1508 104
508 3300049822 Ga0501035_0455421 Ga0501035_0455421_436_831 104
509 3300049822 Ga0501035_0661601 Ga0501035_0661601_185_580 104
510 3300049823 Ga0501044_0071730 Ga0501044_0071730_2615_3010 104
511 3300049823 Ga0501044_0171681 Ga0501044_0171681_798_1208 104
512 3300049823 Ga0501044_0945359 Ga0501044_0945359_19_414 104
513 3300049824 Ga0501045_0449433 Ga0501045_0449433_382_792 104
514 3300050516 nmdc:mga0sz30_102027_c1 nmdc:mga0sz30_102027_c1_533_925 104
515 3300013100 Ga0157373_10029000 Ga0157373_100290002 107
516 3300013307 Ga0157372_10426742 Ga0157372_104267422 107
517 3300009098 Ga0105245_11449815 Ga0105245_114498152 111
518 3300010375 Ga0105239_10045014 Ga0105239_100450143 111
519 3300013296 Ga0157374_10027757 Ga0157374_100277575 111
520 3300014969 Ga0157376_10058476 Ga0157376_100584764 111
521 3300021384 Ga0213876_10098043 Ga0213876_100980433 111
522 3300025928 Ga0207700_10711552 Ga0207700_107115522 111
523 3300026116 Ga0207674_10173995 Ga0207674_101739952 111
524 3300039437 Ga0436365_0650332 Ga0436365_0650332_773_1189 111
525 3300048906 Ga0496103_0433442 Ga0496103_0433442_343_759 111
526 3300048918 Ga0496115_0000176 Ga0496115_0000176_54664_55080 111
527 3300048921 Ga0496118_0042257 Ga0496118_0042257_230_646 111
528 3300048929 Ga0496126_0000969 Ga0496126_0000969_3202_3618 111
529 3300049823 Ga0501044_0150356 Ga0501044_0150356_1835_2284 115
530 3300049578 Ga0501042_0240640 Ga0501042_0240640_120_566 121
531 3300049580 Ga0501046_0084661 Ga0501046_0084661_1283_1729 121
532 3300049586 Ga0501070_0139587 Ga0501070_0139587_437_886 122
533 3300049589 Ga0501073_0141293 Ga0501073_0141293_130_579 122
534 3300049742 Ga0501080_0709886 Ga0501080_0709886_258_707 122
535 3300049586 Ga0501070_0062457 Ga0501070_0062457_2060_2542 127
536 3300005614 Ga0068856_100036247 Ga0068856_1000362473 128
537 3300009545 Ga0105237_11818842 Ga0105237_118188422 128
538 3300026078 Ga0207702_10132875 Ga0207702_101328754 128
539 3300037312 Ga0395899_0037966 Ga0395899_0037966_1389_1859 129
540 3300037418 Ga0395900_0008996 Ga0395900_0008996_374_844 129
541 3300037466 Ga0395898_0012279 Ga0395898_0012279_7846_8316 129
542 2162886007 SwRhRL2b_contig_1453 SwRhRL2b_0338.00002860 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

31

149

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.7246 42 124
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.6992 42 124
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.6934 42 129
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.5571 42 129
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.5174 42 124
ID Description Score Start End Superfamily
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7085 42 124 1.20.1300.10
af_Q641Z9_62_169_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6599 42 123 1.20.1300.10
1yq4C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6311 42 125 1.20.1300.10
2wqyC02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.626 42 127 1.20.1300.10
2h89C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5898 42 125 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A520D3K2-F1-model_v4 deleted 0.9692 70 131
AF-F2I3H9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9609 66 128 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A382QPX9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9596 56 128 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A258XIN3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9526 71 131 GO:0016020
GO:0046872
AF-A0A381TYI8-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9358 78 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.78 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map