F461545

General Info

Members Datasets Scaffolds Average Seq Length
542 271 1084 181

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0031254|Ga0501040_0031254_155_751
Length 198
Sequence MPRTNLAVARRGARIASVPEARLEDSGSGLTPVSQGWFVVNVRDAEWMFAESRGARCAFENEYGYPPVEFDRLGINVTVLGPAQTTLYHAEANQEAFLVLSGECALVVENEERRLRAWDFFHCPPWTEHAFVGAGEGPCVILMVGARSGPGVNYPVSETAARHGASVAEETSDWRQAYATVEWFRRERPPSWARLPWA

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.58
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0031254 3300049576 Bacteria 3597
2 ARcpr5yngRDRAFT_c002300 3300000043 Bacteria 1995
3 ARSoilOldRDRAFT_c001831 3300000044 Bacteria 1953
4 ARCol0yngRDRAFT_1001512 3300000652 Bacteria 1887
5 JGI24737J22298_10058893 3300001990 Bacteria 1158
6 JGI24743J22301_10002651 3300001991 Bacteria 2735
7 JGI24738J21930_10001627 3300002075 Bacteria 6179
8 Ga0070658_10039663 3300005327 Bacteria 3799
9 Ga0070683_100004938 3300005329 Bacteria 11060
10 Ga0070683_100042821 3300005329 Bacteria 4171
11 Ga0070683_100086673 3300005329 Bacteria 2936
12 Ga0070683_100104306 3300005329 Bacteria 2672
13 Ga0070683_100211709 3300005329 Unclassified 1841
14 Ga0070683_100299976 3300005329 Unclassified 1528
15 Ga0070683_100325833 3300005329 Bacteria 1462
16 Ga0070683_100338334 3300005329 Bacteria 1433
17 Ga0070690_100207039 3300005330 Archaea 1368
18 Ga0068869_100044142 3300005334 Bacteria 3205
19 Ga0070680_100021608 3300005336 Bacteria 5117
20 Ga0070680_100028939 3300005336 Bacteria 4447
21 Ga0070680_100030694 3300005336 Bacteria 4318
22 Ga0070682_100052808 3300005337 Bacteria 2545
23 Ga0070682_100231326 3300005337 Bacteria 1321
24 Ga0070682_100333691 3300005337 Bacteria 1125
25 Ga0068868_100049860 3300005338 Bacteria 3286
26 Ga0070660_100061609 3300005339 Bacteria 2913
27 Ga0070660_100118347 3300005339 Unclassified 2113
28 Ga0070689_100152129 3300005340 Bacteria 1866
29 Ga0070687_100043802 3300005343 Unclassified 2277
30 Ga0070661_100063788 3300005344 Bacteria 2706
31 Ga0070661_100342546 3300005344 Bacteria 1171
32 Ga0070661_100456967 3300005344 Bacteria 1017
33 Ga0070692_10028498 3300005345 Bacteria 2775
34 Ga0070692_10234496 3300005345 Unclassified 1091
35 Ga0070668_100266047 3300005347 Archaea 1427
36 Ga0070669_100823052 3300005353 Bacteria 790
37 Ga0070675_100123721 3300005354 Unclassified 2199
38 Ga0070674_100067470 3300005356 Bacteria 2516
39 Ga0070673_100065218 3300005364 Bacteria 2904
40 Ga0070673_100116096 3300005364 Unclassified 2226
41 Ga0070673_100903787 3300005364 Bacteria 819
42 Ga0070659_100044210 3300005366 Bacteria 3486
43 Ga0070659_100054487 3300005366 Bacteria 3150
44 Ga0070659_100128416 3300005366 Bacteria 2057
45 Ga0070659_100143030 3300005366 Unclassified 1948
46 Ga0070703_10022188 3300005406 Unclassified 1862
47 Ga0070709_10002472 3300005434 Bacteria 10012
48 Ga0070713_100013585 3300005436 Bacteria 6019
49 Ga0070713_100072072 3300005436 Bacteria 2921
50 Ga0070713_100109662 3300005436 Bacteria 2405
51 Ga0070713_100304685 3300005436 Bacteria 1467
52 Ga0070713_100356023 3300005436 Bacteria 1359
53 Ga0070710_10037173 3300005437 Bacteria 2666
54 Ga0070710_10277021 3300005437 Unclassified 1087
55 Ga0070701_10102427 3300005438 Bacteria 1588
56 Ga0070711_100047836 3300005439 Bacteria 2922
57 Ga0070711_100122600 3300005439 Bacteria 1925
58 Ga0070711_100148503 3300005439 Bacteria 1765
59 Ga0070711_100555912 3300005439 Bacteria 953
60 Ga0070705_100010640 3300005440 Bacteria 4612
61 Ga0070705_100036190 3300005440 Bacteria 2773
62 Ga0070700_100104047 3300005441 Unclassified 1875
63 Ga0070694_100662116 3300005444 Bacteria 846
64 Ga0070663_100017093 3300005455 Bacteria 4726
65 Ga0070678_100738587 3300005456 Bacteria 889
66 Ga0070678_100805549 3300005456 Bacteria 853
67 Ga0070662_100024875 3300005457 Bacteria 4130
68 Ga0070662_100026564 3300005457 Bacteria 4011
69 Ga0070662_100091032 3300005457 Unclassified 2290
70 Ga0070662_100121187 3300005457 Bacteria 2005
71 Ga0070662_100426597 3300005457 Unclassified 1098
72 Ga0070681_10006166 3300005458 Bacteria 11644
73 Ga0070681_10193882 3300005458 Bacteria 1951
74 Ga0070681_10500719 3300005458 Bacteria 1128
75 Ga0068867_100879146 3300005459 Bacteria 805
76 Ga0070685_10074532 3300005466 Unclassified 2019
77 Ga0070699_100597861 3300005518 Bacteria 1006
78 Ga0070679_100019985 3300005530 Bacteria 6524
79 Ga0070679_100279960 3300005530 Bacteria 1621
80 Ga0070679_100371068 3300005530 Bacteria 1378
81 Ga0070679_100437505 3300005530 Bacteria 1253
82 Ga0070679_100945339 3300005530 Bacteria 806
83 Ga0070684_100065327 3300005535 Bacteria 3193
84 Ga0070684_100097301 3300005535 Bacteria 2624
85 Ga0070684_100123722 3300005535 Bacteria 2328
86 Ga0070684_100730453 3300005535 Bacteria 924
87 Ga0068853_100104594 3300005539 Unclassified 2506
88 Ga0068853_100712311 3300005539 Unclassified 958
89 Ga0070672_100027448 3300005543 Bacteria 4246
90 Ga0070686_100083587 3300005544 Unclassified 2119
91 Ga0070695_100333129 3300005545 Bacteria 1132
92 Ga0070695_100401026 3300005545 Unclassified 1040
93 Ga0070695_100670402 3300005545 Bacteria 821
94 Ga0070696_100676992 3300005546 Bacteria 839
95 Ga0070693_100108468 3300005547 Unclassified 1703
96 Ga0070693_100468480 3300005547 Bacteria 888
97 Ga0070704_100042447 3300005549 Unclassified 3146
98 Ga0068855_100743112 3300005563 Bacteria 1047
99 Ga0070664_100136738 3300005564 Bacteria 2155
100 Ga0070664_100158262 3300005564 Bacteria 2003
101 Ga0068854_100004694 3300005578 Bacteria 8611
102 Ga0068854_100063524 3300005578 Bacteria 2680
103 Ga0068854_100742810 3300005578 Bacteria 851
104 Ga0068854_101185545 3300005578 Unclassified 684
105 Ga0068856_100060112 3300005614 Bacteria 3754
106 Ga0068856_100086202 3300005614 Bacteria 3120
107 Ga0068856_100089384 3300005614 Bacteria 3063
108 Ga0068856_100126452 3300005614 Bacteria 2559
109 Ga0068856_100158202 3300005614 Bacteria 2276
110 Ga0068856_100166786 3300005614 Bacteria 2213
111 Ga0068856_100269622 3300005614 Bacteria 1718
112 Ga0068856_100813923 3300005614 Bacteria 954
113 Ga0068856_101043397 3300005614 Unclassified 835
114 Ga0070702_100036638 3300005615 Bacteria 2719
115 Ga0070702_100200559 3300005615 Archaea 1320
116 Ga0068852_100022570 3300005616 Bacteria 5049
117 Ga0068852_100030546 3300005616 Bacteria 4437
118 Ga0068852_100464199 3300005616 Bacteria 1256
119 Ga0068859_100186423 3300005617 Bacteria 2158
120 Ga0068864_100030169 3300005618 Bacteria 4595
121 Ga0068864_101173287 3300005618 Unclassified 766
122 Ga0068866_10136873 3300005718 Bacteria 1401
123 Ga0068861_100232367 3300005719 Bacteria 1565
124 Ga0068851_10025206 3300005834 Bacteria 2916
125 Ga0068851_10298576 3300005834 Bacteria 926
126 Ga0068863_100384505 3300005841 Bacteria 1371
127 Ga0068860_100030001 3300005843 Bacteria 5229
128 Ga0081539_10001681 3300005985 Bacteria 35743
129 Ga0070717_10026349 3300006028 Bacteria 4636
130 Ga0070717_10336184 3300006028 Bacteria 1348
131 Ga0075432_10004867 3300006058 Bacteria 4571
132 Ga0070715_10014331 3300006163 Bacteria 2934
133 Ga0070716_100008669 3300006173 Bacteria 5051
134 Ga0070712_100028724 3300006175 Bacteria 3722
135 Ga0097621_100123410 3300006237 Bacteria 2199
136 Ga0097621_100254850 3300006237 Bacteria 1538
137 Ga0068871_100221987 3300006358 Bacteria 1637
138 Ga0075428_100003243 3300006844 Bacteria 17811
139 Ga0075433_10176747 3300006852 Unclassified 1900
140 Ga0075433_10317316 3300006852 Bacteria 1379
141 Ga0075429_100057040 3300006880 Bacteria 3400
142 Ga0068865_100042959 3300006881 Bacteria 3085
143 Ga0068865_100462747 3300006881 Bacteria 1051
144 Ga0097620_100186434 3300006931 Bacteria 2158
145 Ga0075435_100007144 3300007076 Bacteria 7937
146 Ga0105244_10149887 3300009036 Bacteria 1118
147 Ga0105250_10047705 3300009092 Bacteria 1717
148 Ga0105240_11629789 3300009093 Unclassified 675
149 Ga0111539_10055418 3300009094 Bacteria 4712
150 Ga0111539_10061767 3300009094 Bacteria 4438
151 Ga0105245_10000574 3300009098 Bacteria 33386
152 Ga0105245_10025028 3300009098 Bacteria 5247
153 Ga0105245_10330587 3300009098 Bacteria 1504
154 Ga0105245_10364331 3300009098 Bacteria 1435
155 Ga0105247_10272662 3300009101 Bacteria 1164
156 Ga0114129_10010088 3300009147 Bacteria 13467
157 Ga0114129_10319231 3300009147 Bacteria 2065
158 Ga0105243_10042469 3300009148 Bacteria 3559
159 Ga0105243_10059377 3300009148 Bacteria 3052
160 Ga0105243_11453779 3300009148 Bacteria 708
161 Ga0105242_10039245 3300009176 Bacteria 3809
162 Ga0105248_10744947 3300009177 Bacteria 1105
163 Ga0105238_10056777 3300009551 Bacteria 3927
164 Ga0105238_10070997 3300009551 Bacteria 3480
165 Ga0105238_11597940 3300009551 Bacteria 682
166 Ga0105238_11956886 3300009551 Unclassified 619
167 Ga0105249_10107303 3300009553 Bacteria 2635
168 Ga0105239_10016859 3300010375 Bacteria 8074
169 Ga0105239_10117857 3300010375 Bacteria 2947
170 Ga0105239_10117947 3300010375 Bacteria 2946
171 Ga0105239_10168069 3300010375 Bacteria 2452
172 Ga0105246_11275409 3300011119 Unclassified 680
173 Ga0157339_1018224 3300012505 Bacteria 720
174 Ga0157373_10619736 3300013100 Archaea 788
175 Ga0157371_10120675 3300013102 Bacteria 1864
176 Ga0157371_10535939 3300013102 Bacteria 867
177 Ga0157369_10092828 3300013105 Bacteria 3222
178 Ga0157369_10154374 3300013105 Bacteria 2426
179 Ga0157369_10335463 3300013105 Bacteria 1571
180 Ga0157374_10033117 3300013296 Bacteria 4713
181 Ga0157374_10377268 3300013296 Bacteria 1412
182 Ga0157374_10453964 3300013296 Bacteria 1283
183 Ga0157374_10746911 3300013296 Bacteria 993
184 Ga0157374_11175430 3300013296 Unclassified 788
185 Ga0163162_10025461 3300013306 Bacteria 5847
186 Ga0163162_10071337 3300013306 Bacteria 3526
187 Ga0163162_10338190 3300013306 Unclassified 1638
188 Ga0157372_10030297 3300013307 Bacteria 5919
189 Ga0157372_10129506 3300013307 Bacteria 2902
190 Ga0157372_10202835 3300013307 Bacteria 2298
191 Ga0157372_11468565 3300013307 Bacteria 786
192 Ga0157372_11787224 3300013307 Bacteria 707
193 Ga0157375_10015265 3300013308 Bacteria 6873
194 Ga0157375_10115664 3300013308 Bacteria 2785
195 Ga0157375_10169306 3300013308 Bacteria 2331
196 Ga0157375_10233488 3300013308 Unclassified 1998
197 Ga0157375_10402608 3300013308 Unclassified 1535
198 Ga0163163_10040429 3300014325 Bacteria 4553
199 Ga0163163_10114535 3300014325 Unclassified 2727
200 Ga0163163_10339122 3300014325 Bacteria 1558
201 Ga0157380_10037107 3300014326 Bacteria 3775
202 Ga0157377_10027463 3300014745 Bacteria 3056
203 Ga0157377_10046390 3300014745 Bacteria 2430
204 Ga0157379_10627385 3300014968 Bacteria 1005
205 Ga0157376_10031335 3300014969 Bacteria 4256
206 Ga0157376_10434944 3300014969 Bacteria 1276
207 Ga0163161_10101907 3300017792 Unclassified 2138
208 Ga0206356_10410738 3300020070 Bacteria 1183
209 Ga0206353_10077814 3300020082 Bacteria 930
210 Ga0207656_10059080 3300025321 Archaea 1677
211 Ga0207692_10323050 3300025898 Unclassified 945
212 Ga0207688_10006445 3300025901 Bacteria 6391
213 Ga0207688_10036423 3300025901 Bacteria 2726
214 Ga0207688_10173368 3300025901 Bacteria 1283
215 Ga0207688_10243930 3300025901 Bacteria 1087
216 Ga0207685_10012201 3300025905 Bacteria 2614
217 Ga0207699_10039822 3300025906 Bacteria 2703
218 Ga0207645_10058675 3300025907 Unclassified 2457
219 Ga0207645_10466191 3300025907 Bacteria 853
220 Ga0207705_10579574 3300025909 Unclassified 872
221 Ga0207684_10173717 3300025910 Bacteria 1857
222 Ga0207654_10797534 3300025911 Unclassified 682
223 Ga0207707_10024366 3300025912 Bacteria 5295
224 Ga0207693_10000964 3300025915 Bacteria 25831
225 Ga0207693_10057004 3300025915 Bacteria 3063
226 Ga0207663_10042931 3300025916 Bacteria 2765
227 Ga0207663_10076773 3300025916 Bacteria 2172
228 Ga0207663_10098061 3300025916 Bacteria 1961
229 Ga0207660_10842592 3300025917 Bacteria 748
230 Ga0207662_10010056 3300025918 Bacteria 5215
231 Ga0207657_10001130 3300025919 Bacteria 28334
232 Ga0207657_10062370 3300025919 Bacteria 3192
233 Ga0207657_10171186 3300025919 Bacteria 1759
234 Ga0207657_10264172 3300025919 Unclassified 1369
235 Ga0207649_10600712 3300025920 Unclassified 846
236 Ga0207652_10135943 3300025921 Bacteria 2195
237 Ga0207652_10290214 3300025921 Bacteria 1476
238 Ga0207694_10031633 3300025924 Bacteria 4044
239 Ga0207694_10140120 3300025924 Bacteria 1944
240 Ga0207694_10233079 3300025924 Bacteria 1504
241 Ga0207650_10913520 3300025925 Bacteria 746
242 Ga0207659_10163221 3300025926 Unclassified 1751
243 Ga0207687_10165531 3300025927 Unclassified 1701
244 Ga0207687_10178043 3300025927 Bacteria 1645
245 Ga0207687_10411625 3300025927 Bacteria 1114
246 Ga0207700_10000006 3300025928 Bacteria 348187
247 Ga0207700_10144732 3300025928 Bacteria 1957
248 Ga0207700_10210579 3300025928 Bacteria 1643
249 Ga0207700_10621047 3300025928 Unclassified 962
250 Ga0207664_10076874 3300025929 Bacteria 2703
251 Ga0207664_10121924 3300025929 Unclassified 2183
252 Ga0207664_10156148 3300025929 Bacteria 1943
253 Ga0207644_10585193 3300025931 Bacteria 926
254 Ga0207644_10954434 3300025931 Bacteria 719
255 Ga0207690_10089151 3300025932 Bacteria 2174
256 Ga0207690_10162845 3300025932 Bacteria 1664
257 Ga0207690_10167523 3300025932 Bacteria 1643
258 Ga0207690_10937455 3300025932 Bacteria 719
259 Ga0207706_10014207 3300025933 Bacteria 7217
260 Ga0207706_10073419 3300025933 Unclassified 3008
261 Ga0207706_10079966 3300025933 Bacteria 2874
262 Ga0207686_10111664 3300025934 Bacteria 1845
263 Ga0207686_10519754 3300025934 Bacteria 926
264 Ga0207709_10015847 3300025935 Bacteria 4184
265 Ga0207709_10162135 3300025935 Bacteria 1560
266 Ga0207670_10400323 3300025936 Bacteria 1097
267 Ga0207704_10139688 3300025938 Bacteria 1692
268 Ga0207704_10435215 3300025938 Bacteria 1043
269 Ga0207665_10012145 3300025939 Bacteria 5654
270 Ga0207691_10014395 3300025940 Bacteria 7542
271 Ga0207691_10155712 3300025940 Bacteria 2007
272 Ga0207711_10083367 3300025941 Unclassified 2796
273 Ga0207711_10164207 3300025941 Unclassified 2012
274 Ga0207689_10035816 3300025942 Bacteria 4121
275 Ga0207689_10095637 3300025942 Bacteria 2440
276 Ga0207661_10020732 3300025944 Bacteria 4917
277 Ga0207661_10135635 3300025944 Bacteria 2113
278 Ga0207661_10143433 3300025944 Bacteria 2057
279 Ga0207661_10143529 3300025944 Bacteria 2057
280 Ga0207661_10215913 3300025944 Bacteria 1693
281 Ga0207661_10247939 3300025944 Bacteria 1582
282 Ga0207661_11040175 3300025944 Bacteria 754
283 Ga0207679_10155124 3300025945 Bacteria 1869
284 Ga0207679_10415913 3300025945 Unclassified 1186
285 Ga0207679_10645329 3300025945 Bacteria 957
286 Ga0207651_10090095 3300025960 Unclassified 2241
287 Ga0207651_10685330 3300025960 Bacteria 902
288 Ga0207712_10051046 3300025961 Unclassified 2891
289 Ga0207640_10280587 3300025981 Unclassified 1308
290 Ga0207640_10686912 3300025981 Bacteria 876
291 Ga0207677_10792984 3300026023 Unclassified 847
292 Ga0207703_10098112 3300026035 Bacteria 2477
293 Ga0207639_10114215 3300026041 Bacteria 2207
294 Ga0207708_10258712 3300026075 Bacteria 1404
295 Ga0207702_10008265 3300026078 Bacteria 8793
296 Ga0207702_10057911 3300026078 Bacteria 3295
297 Ga0207702_10163885 3300026078 Bacteria 2032
298 Ga0207702_10413424 3300026078 Bacteria 1303
299 Ga0207702_10419967 3300026078 Bacteria 1293
300 Ga0207648_10005667 3300026089 Bacteria 12536
301 Ga0207648_10162906 3300026089 Bacteria 1970
302 Ga0207648_11669754 3300026089 Bacteria 598
303 Ga0207676_10273955 3300026095 Archaea 1529
304 Ga0207674_11343292 3300026116 Unclassified 684
305 Ga0207675_100002599 3300026118 Bacteria 17874
306 Ga0207698_10244015 3300026142 Unclassified 1639
307 Ga0207428_10002698 3300027907 Bacteria 17692
308 Ga0307408_100052444 3300031548 Bacteria 2942
309 Ga0307408_100236257 3300031548 Unclassified 1500
310 Ga0307405_10082656 3300031731 Bacteria 2103
311 Ga0307405_10366018 3300031731 Bacteria 1117
312 Ga0307409_100919080 3300031995 Bacteria 889
313 Ga0307416_102411040 3300032002 Bacteria 625
314 Ga0307411_10026212 3300032005 Bacteria 3507
315 Ga0373940_0118310 3300035088 Bacteria 820
316 Ga0373944_0082948 3300035089 Bacteria 1061
317 Ga0373952_0030880 3300035092 Bacteria 1189
318 Ga0373952_0061634 3300035092 Unclassified 919
319 Ga0373945_0041767 3300035116 Bacteria 1659
320 Ga0373943_0016211 3300035170 Bacteria 3395
321 Ga0373961_0109015 3300035241 Bacteria 905
322 Ga0373961_0115983 3300035241 Bacteria 882
323 Ga0373962_0030364 3300035242 Bacteria 1478
324 Ga0373931_0036536 3300035691 Bacteria 2561
325 Ga0373931_0051386 3300035691 Bacteria 2195
326 Ga0373935_0122031 3300035692 Bacteria 1742
327 Ga0373935_0147803 3300035692 Bacteria 1592
328 Ga0373947_0023559 3300035725 Bacteria 3583
329 Ga0373947_0046859 3300035725 Bacteria 2589
330 Ga0373925_0074918 3300037068 Bacteria 2564
331 Ga0373925_0098001 3300037068 Bacteria 2249
332 Ga0395899_0060483 3300037312 Unclassified 2791
333 Ga0395899_0104844 3300037312 Bacteria 2037
334 Ga0395899_0206720 3300037312 Archaea 1366
335 Ga0395900_0014427 3300037418 Bacteria 8064
336 Ga0395900_0021195 3300037418 Bacteria 6643
337 Ga0395900_0026221 3300037418 Bacteria 5968
338 Ga0395900_0071670 3300037418 Bacteria 3562
339 Ga0395900_0089339 3300037418 Bacteria 3167
340 Ga0395900_0663475 3300037418 Archaea 979
341 Ga0395898_0035606 3300037466 Bacteria 4948
342 Ga0395898_0140991 3300037466 Bacteria 2307
343 Ga0395898_0155203 3300037466 Bacteria 2189
344 Ga0395898_0258260 3300037466 Unclassified 1661
345 Ga0395905_0034815 3300037471 Bacteria 4729
346 Ga0395905_0083456 3300037471 Unclassified 2993
347 Ga0395901_0005928 3300038443 Bacteria 12376
348 Ga0395901_0032898 3300038443 Bacteria 5349
349 Ga0395901_0092285 3300038443 Unclassified 3169
350 Ga0451789_1229131 3300041443 Unclassified 961
351 Ga0451793_1658203 3300041452 Archaea 666
352 Ga0451807_2105970 3300041486 Bacteria 1484
353 Ga0439441_045011 3300042001 Bacteria 895
354 Ga0439450_025024 3300042008 Bacteria 1306
355 Ga0450914_019628 3300042118 Bacteria 743
356 Ga0439446_0064633 3300042156 Unclassified 1111
357 Ga0466963_0007040 3300044694 Bacteria 6696
358 Ga0466963_0018797 3300044694 Bacteria 4326
359 Ga0466963_0165085 3300044694 Bacteria 1542
360 Ga0466964_0005657 3300044706 Bacteria 4647
361 Ga0466957_0174625 3300044842 Bacteria 1401
362 Ga0466957_0752911 3300044842 Unclassified 690
363 Ga0466967_0026777 3300045976 Bacteria 4783
364 Ga0466967_0033790 3300045976 Bacteria 4334
365 Ga0466967_0037132 3300045976 Bacteria 4165
366 Ga0466967_0046791 3300045976 Bacteria 3768
367 Ga0466967_0048402 3300045976 Bacteria 3711
368 Ga0466967_0090309 3300045976 Bacteria 2782
369 Ga0466967_0602764 3300045976 Bacteria 1084
370 Ga0495603_0000394 3300046455 Bacteria 23982
371 Ga0495603_0016556 3300046455 Bacteria 4461
372 Ga0495629_0199073 3300046459 Bacteria 1385
373 Ga0495629_0428421 3300046459 Unclassified 897
374 Ga0495641_0005687 3300046461 Bacteria 8308
375 Ga0495580_0040056 3300046472 Bacteria 3350
376 Ga0495582_0007425 3300046473 Bacteria 6070
377 Ga0495582_0033702 3300046473 Bacteria 2816
378 Ga0495594_0000597 3300046499 Bacteria 18592
379 Ga0495596_0228114 3300046500 Bacteria 723
380 Ga0495607_0132437 3300046501 Bacteria 1296
381 Ga0495630_0112490 3300046517 Bacteria 2062
382 Ga0495630_0591231 3300046517 Unclassified 851
383 Ga0495644_0263335 3300046523 Bacteria 671
384 Ga0495666_0259116 3300046526 Bacteria 791
385 Ga0495652_0115170 3300046529 Bacteria 2155
386 Ga0495652_0505976 3300046529 Bacteria 837
387 Ga0495654_0102016 3300046530 Bacteria 1320
388 Ga0495665_0052348 3300046531 Bacteria 2161
389 Ga0495640_0275283 3300046533 Bacteria 1049
390 Ga0495621_0355635 3300046539 Bacteria 615
391 Ga0495667_0358122 3300046559 Bacteria 921
392 Ga0495668_0213340 3300046616 Unclassified 1057
393 Ga0495634_0051796 3300046642 Bacteria 2754
394 Ga0495588_0000483 3300046674 Bacteria 19736
395 Ga0495588_0206382 3300046674 Bacteria 1038
396 Ga0495599_0182797 3300046678 Bacteria 1292
397 Ga0495599_0254219 3300046678 Bacteria 1069
398 Ga0495647_0054050 3300046681 Bacteria 1568
399 Ga0495647_0214761 3300046681 Bacteria 847
400 Ga0495624_0080821 3300046690 Bacteria 2014
401 Ga0495624_0405088 3300046690 Bacteria 819
402 Ga0495589_0266046 3300046794 Bacteria 799
403 Ga0495600_0266743 3300046809 Bacteria 1087
404 Ga0495581_0122824 3300047315 Bacteria 1511
405 Ga0495674_0013017 3300047319 Bacteria 7830
406 Ga0495674_0084975 3300047319 Bacteria 2711
407 Ga0495674_0500700 3300047319 Unclassified 972
408 Ga0495676_0008869 3300047321 Bacteria 9186
409 Ga0495676_0010528 3300047321 Bacteria 8381
410 Ga0495680_0150516 3300047322 Bacteria 1697
411 Ga0495680_0166820 3300047322 Bacteria 1596
412 Ga0495680_0415116 3300047322 Bacteria 927
413 Ga0496100_0019627 3300048903 Bacteria 4036
414 Ga0496100_0062470 3300048903 Bacteria 2458
415 Ga0496100_0076162 3300048903 Unclassified 2252
416 Ga0496100_0505448 3300048903 Bacteria 931
417 Ga0496101_0010225 3300048904 Bacteria 6193
418 Ga0496101_0039516 3300048904 Bacteria 3356
419 Ga0496101_0055075 3300048904 Bacteria 2872
420 Ga0496102_0084225 3300048905 Bacteria 2934
421 Ga0496102_0114528 3300048905 Bacteria 2516
422 Ga0496103_0029560 3300048906 Bacteria 3331
423 Ga0496103_0084566 3300048906 Bacteria 1999
424 Ga0496104_0000967 3300048907 Bacteria 24709
425 Ga0496104_0160069 3300048907 Bacteria 2160
426 Ga0496104_0344349 3300048907 Bacteria 1403
427 Ga0496104_1026769 3300048907 Bacteria 728
428 Ga0496104_1189340 3300048907 Unclassified 666
429 Ga0496104_1204864 3300048907 Unclassified 660
430 Ga0496105_0010997 3300048908 Bacteria 7132
431 Ga0496105_0081648 3300048908 Bacteria 2670
432 Ga0496105_0286637 3300048908 Bacteria 1326
433 Ga0496106_0020346 3300048909 Bacteria 4924
434 Ga0496106_0020471 3300048909 Bacteria 4909
435 Ga0496106_0049038 3300048909 Bacteria 3180
436 Ga0496107_0005929 3300048910 Bacteria 8374
437 Ga0496107_0031792 3300048910 Unclassified 3769
438 Ga0496107_0148289 3300048910 Bacteria 1735
439 Ga0496107_0322748 3300048910 Bacteria 1149
440 Ga0496107_0536195 3300048910 Bacteria 867
441 Ga0496108_0002223 3300048911 Bacteria 15540
442 Ga0496108_0003763 3300048911 Bacteria 12148
443 Ga0496108_0066544 3300048911 Bacteria 3038
444 Ga0496108_0114007 3300048911 Bacteria 2314
445 Ga0496108_0247587 3300048911 Bacteria 1550
446 Ga0496108_0267358 3300048911 Bacteria 1488
447 Ga0496108_0275920 3300048911 Bacteria 1464
448 Ga0496108_0319756 3300048911 Bacteria 1353
449 Ga0496108_0544697 3300048911 Archaea 1012
450 Ga0496109_0031675 3300048912 Bacteria 4748
451 Ga0496109_0035962 3300048912 Bacteria 4470
452 Ga0496109_0040152 3300048912 Bacteria 4237
453 Ga0496109_0049096 3300048912 Bacteria 3841
454 Ga0496109_0097069 3300048912 Unclassified 2731
455 Ga0496109_0109278 3300048912 Bacteria 2570
456 Ga0496109_0143670 3300048912 Bacteria 2232
457 Ga0496109_0150033 3300048912 Bacteria 2182
458 Ga0496109_0507887 3300048912 Bacteria 1138
459 Ga0496109_0904073 3300048912 Bacteria 821
460 Ga0496110_0008374 3300048913 Bacteria 8319
461 Ga0496110_0015005 3300048913 Bacteria 6442
462 Ga0496110_0015375 3300048913 Bacteria 6368
463 Ga0496110_0030829 3300048913 Bacteria 4624
464 Ga0496110_0145831 3300048913 Bacteria 2141
465 Ga0496110_0187867 3300048913 Bacteria 1876
466 Ga0496110_0225424 3300048913 Bacteria 1704
467 Ga0496110_0369750 3300048913 Bacteria 1306
468 Ga0496110_0379784 3300048913 Bacteria 1288
469 Ga0496110_0442548 3300048913 Bacteria 1184
470 Ga0496110_0663135 3300048913 Bacteria 943
471 Ga0496111_0000489 3300048914 Bacteria 20380
472 Ga0496111_0002288 3300048914 Bacteria 11507
473 Ga0496111_0012439 3300048914 Bacteria 5762
474 Ga0496111_0056303 3300048914 Bacteria 2845
475 Ga0496111_0080670 3300048914 Bacteria 2374
476 Ga0496112_0011226 3300048915 Bacteria 8171
477 Ga0496112_0125051 3300048915 Bacteria 2542
478 Ga0496112_0151302 3300048915 Bacteria 2288
479 Ga0496112_0458526 3300048915 Bacteria 1212
480 Ga0496113_0000591 3300048916 Bacteria 18099
481 Ga0496113_0005817 3300048916 Bacteria 7738
482 Ga0496113_0024886 3300048916 Bacteria 4262
483 Ga0496113_0143616 3300048916 Bacteria 1879
484 Ga0496113_0325428 3300048916 Bacteria 1232
485 Ga0496114_0015998 3300048917 Bacteria 6037
486 Ga0496114_0033729 3300048917 Bacteria 4220
487 Ga0496114_0373437 3300048917 Bacteria 1262
488 Ga0496115_0041685 3300048918 Bacteria 3654
489 Ga0501031_0126837 3300049568 Bacteria 1667
490 Ga0501034_0348026 3300049571 Bacteria 1411
491 Ga0501036_0042913 3300049572 Bacteria 3829
492 Ga0501037_0149930 3300049573 Bacteria 1667
493 Ga0501038_0227123 3300049574 Bacteria 1487
494 Ga0501039_0148482 3300049575 Bacteria 1842
495 Ga0501040_0145498 3300049576 Bacteria 1670
496 Ga0501041_0026055 3300049577 Bacteria 3515
497 Ga0501042_0015337 3300049578 Bacteria 5246
498 Ga0501042_0257323 3300049578 Unclassified 1260
499 Ga0501046_0100346 3300049580 Bacteria 2221
500 Ga0501048_0096042 3300049582 Bacteria 2090
501 Ga0501048_0245694 3300049582 Bacteria 1270
502 Ga0501067_0002478 3300049583 Bacteria 10191
503 Ga0501068_0075817 3300049584 Bacteria 2058
504 Ga0501069_0006235 3300049585 Bacteria 6232
505 Ga0501070_0792512 3300049586 Bacteria 745
506 Ga0501071_0149547 3300049587 Bacteria 1741
507 Ga0501072_0040815 3300049588 Bacteria 3644
508 Ga0501075_0079746 3300049591 Bacteria 2477
509 Ga0501076_0037355 3300049592 Bacteria 3808
510 Ga0501077_0005586 3300049593 Bacteria 7658
511 Ga0501077_0053734 3300049593 Bacteria 2557
512 Ga0501079_0043092 3300049741 Bacteria 3483
513 Ga0501080_0103009 3300049742 Bacteria 2647
514 Ga0501081_0018370 3300049743 Bacteria 4643
515 Ga0501081_0061916 3300049743 Bacteria 2594
516 Ga0501083_0024630 3300049744 Bacteria 4168
517 Ga0501083_0169862 3300049744 Unclassified 1426
518 Ga0501045_0015263 3300049824 Bacteria 5452
519 nmdc:mga05p37_38070_c1 3300050507 Bacteria 5899
520 nmdc:mga09592_26356_c1 3300050508 Bacteria 4815
521 nmdc:mga08y16_11969_c1 3300050511 Bacteria 9111
522 nmdc:mga08y16_93907_c1 3300050511 Bacteria 3125
523 nmdc:mga0n895_1291322_c1 3300050512 Unclassified 701
524 nmdc:mga0n895_322562_c1 3300050512 Bacteria 1565
525 nmdc:mga0n895_39111_c1 3300050512 Bacteria 4600
526 nmdc:mga0n895_556082_c1 3300050512 Bacteria 1153
527 nmdc:mga08x19_5520_c1 3300050514 Bacteria 7480
528 nmdc:mga0a205_9182_c2 3300050515 Bacteria 5100
529 Ga0495601_0008895 3300053077 Bacteria 5925
530 Ga0495601_0018513 3300053077 Bacteria 4241
531 Ga0495601_0130827 3300053077 Bacteria 1634
532 Ga0495612_0017042 3300053078 Bacteria 2910
533 Ga0495612_0023856 3300053078 Bacteria 2456
534 Ga0495595_0008886 3300053084 Bacteria 4139
535 Ga0495619_0010828 3300053085 Bacteria 5740
536 Ga0495619_0402225 3300053085 Bacteria 945
537 Ga0501084_0024254 3300054114 Bacteria 5058
538 Ga0501084_0039877 3300054114 Bacteria 3927
539 Ga0501082_0063062 3300060353 Bacteria 3191
540 Ga0501082_0241927 3300060353 Bacteria 1570
541 Ga0530510_0375207 3300061734 Bacteria 1070
542 Ga0530510_0404268 3300061734 Bacteria 1029
543 Ga0501040_0031254
544 ARcpr5yngRDRAFT_c002300
545 ARSoilOldRDRAFT_c001831
546 ARCol0yngRDRAFT_1001512
547 JGI24737J22298_10058893
548 JGI24743J22301_10002651
549 JGI24738J21930_10001627
550 Ga0070658_10039663
551 Ga0070683_100004938
552 Ga0070683_100042821
553 Ga0070683_100086673
554 Ga0070683_100104306
555 Ga0070683_100211709
556 Ga0070683_100299976
557 Ga0070683_100325833
558 Ga0070683_100338334
559 Ga0070690_100207039
560 Ga0068869_100044142
561 Ga0070680_100021608
562 Ga0070680_100028939
563 Ga0070680_100030694
564 Ga0070682_100052808
565 Ga0070682_100231326
566 Ga0070682_100333691
567 Ga0068868_100049860
568 Ga0070660_100061609
569 Ga0070660_100118347
570 Ga0070689_100152129
571 Ga0070687_100043802
572 Ga0070661_100063788
573 Ga0070661_100342546
574 Ga0070661_100456967
575 Ga0070692_10028498
576 Ga0070692_10234496
577 Ga0070668_100266047
578 Ga0070669_100823052
579 Ga0070675_100123721
580 Ga0070674_100067470
581 Ga0070673_100065218
582 Ga0070673_100116096
583 Ga0070673_100903787
584 Ga0070659_100044210
585 Ga0070659_100054487
586 Ga0070659_100128416
587 Ga0070659_100143030
588 Ga0070703_10022188
589 Ga0070709_10002472
590 Ga0070713_100013585
591 Ga0070713_100072072
592 Ga0070713_100109662
593 Ga0070713_100304685
594 Ga0070713_100356023
595 Ga0070710_10037173
596 Ga0070710_10277021
597 Ga0070701_10102427
598 Ga0070711_100047836
599 Ga0070711_100122600
600 Ga0070711_100148503
601 Ga0070711_100555912
602 Ga0070705_100010640
603 Ga0070705_100036190
604 Ga0070700_100104047
605 Ga0070694_100662116
606 Ga0070663_100017093
607 Ga0070678_100738587
608 Ga0070678_100805549
609 Ga0070662_100024875
610 Ga0070662_100026564
611 Ga0070662_100091032
612 Ga0070662_100121187
613 Ga0070662_100426597
614 Ga0070681_10006166
615 Ga0070681_10193882
616 Ga0070681_10500719
617 Ga0068867_100879146
618 Ga0070685_10074532
619 Ga0070699_100597861
620 Ga0070679_100019985
621 Ga0070679_100279960
622 Ga0070679_100371068
623 Ga0070679_100437505
624 Ga0070679_100945339
625 Ga0070684_100065327
626 Ga0070684_100097301
627 Ga0070684_100123722
628 Ga0070684_100730453
629 Ga0068853_100104594
630 Ga0068853_100712311
631 Ga0070672_100027448
632 Ga0070686_100083587
633 Ga0070695_100333129
634 Ga0070695_100401026
635 Ga0070695_100670402
636 Ga0070696_100676992
637 Ga0070693_100108468
638 Ga0070693_100468480
639 Ga0070704_100042447
640 Ga0068855_100743112
641 Ga0070664_100136738
642 Ga0070664_100158262
643 Ga0068854_100004694
644 Ga0068854_100063524
645 Ga0068854_100742810
646 Ga0068854_101185545
647 Ga0068856_100060112
648 Ga0068856_100086202
649 Ga0068856_100089384
650 Ga0068856_100126452
651 Ga0068856_100158202
652 Ga0068856_100166786
653 Ga0068856_100269622
654 Ga0068856_100813923
655 Ga0068856_101043397
656 Ga0070702_100036638
657 Ga0070702_100200559
658 Ga0068852_100022570
659 Ga0068852_100030546
660 Ga0068852_100464199
661 Ga0068859_100186423
662 Ga0068864_100030169
663 Ga0068864_101173287
664 Ga0068866_10136873
665 Ga0068861_100232367
666 Ga0068851_10025206
667 Ga0068851_10298576
668 Ga0068863_100384505
669 Ga0068860_100030001
670 Ga0081539_10001681
671 Ga0070717_10026349
672 Ga0070717_10336184
673 Ga0075432_10004867
674 Ga0070715_10014331
675 Ga0070716_100008669
676 Ga0070712_100028724
677 Ga0097621_100123410
678 Ga0097621_100254850
679 Ga0068871_100221987
680 Ga0075428_100003243
681 Ga0075433_10176747
682 Ga0075433_10317316
683 Ga0075429_100057040
684 Ga0068865_100042959
685 Ga0068865_100462747
686 Ga0097620_100186434
687 Ga0075435_100007144
688 Ga0105244_10149887
689 Ga0105250_10047705
690 Ga0105240_11629789
691 Ga0111539_10055418
692 Ga0111539_10061767
693 Ga0105245_10000574
694 Ga0105245_10025028
695 Ga0105245_10330587
696 Ga0105245_10364331
697 Ga0105247_10272662
698 Ga0114129_10010088
699 Ga0114129_10319231
700 Ga0105243_10042469
701 Ga0105243_10059377
702 Ga0105243_11453779
703 Ga0105242_10039245
704 Ga0105248_10744947
705 Ga0105238_10056777
706 Ga0105238_10070997
707 Ga0105238_11597940
708 Ga0105238_11956886
709 Ga0105249_10107303
710 Ga0105239_10016859
711 Ga0105239_10117857
712 Ga0105239_10117947
713 Ga0105239_10168069
714 Ga0105246_11275409
715 Ga0157339_1018224
716 Ga0157373_10619736
717 Ga0157371_10120675
718 Ga0157371_10535939
719 Ga0157369_10092828
720 Ga0157369_10154374
721 Ga0157369_10335463
722 Ga0157374_10033117
723 Ga0157374_10377268
724 Ga0157374_10453964
725 Ga0157374_10746911
726 Ga0157374_11175430
727 Ga0163162_10025461
728 Ga0163162_10071337
729 Ga0163162_10338190
730 Ga0157372_10030297
731 Ga0157372_10129506
732 Ga0157372_10202835
733 Ga0157372_11468565
734 Ga0157372_11787224
735 Ga0157375_10015265
736 Ga0157375_10115664
737 Ga0157375_10169306
738 Ga0157375_10233488
739 Ga0157375_10402608
740 Ga0163163_10040429
741 Ga0163163_10114535
742 Ga0163163_10339122
743 Ga0157380_10037107
744 Ga0157377_10027463
745 Ga0157377_10046390
746 Ga0157379_10627385
747 Ga0157376_10031335
748 Ga0157376_10434944
749 Ga0163161_10101907
750 Ga0206356_10410738
751 Ga0206353_10077814
752 Ga0207656_10059080
753 Ga0207692_10323050
754 Ga0207688_10006445
755 Ga0207688_10036423
756 Ga0207688_10173368
757 Ga0207688_10243930
758 Ga0207685_10012201
759 Ga0207699_10039822
760 Ga0207645_10058675
761 Ga0207645_10466191
762 Ga0207705_10579574
763 Ga0207684_10173717
764 Ga0207654_10797534
765 Ga0207707_10024366
766 Ga0207693_10000964
767 Ga0207693_10057004
768 Ga0207663_10042931
769 Ga0207663_10076773
770 Ga0207663_10098061
771 Ga0207660_10842592
772 Ga0207662_10010056
773 Ga0207657_10001130
774 Ga0207657_10062370
775 Ga0207657_10171186
776 Ga0207657_10264172
777 Ga0207649_10600712
778 Ga0207652_10135943
779 Ga0207652_10290214
780 Ga0207694_10031633
781 Ga0207694_10140120
782 Ga0207694_10233079
783 Ga0207650_10913520
784 Ga0207659_10163221
785 Ga0207687_10165531
786 Ga0207687_10178043
787 Ga0207687_10411625
788 Ga0207700_10000006
789 Ga0207700_10144732
790 Ga0207700_10210579
791 Ga0207700_10621047
792 Ga0207664_10076874
793 Ga0207664_10121924
794 Ga0207664_10156148
795 Ga0207644_10585193
796 Ga0207644_10954434
797 Ga0207690_10089151
798 Ga0207690_10162845
799 Ga0207690_10167523
800 Ga0207690_10937455
801 Ga0207706_10014207
802 Ga0207706_10073419
803 Ga0207706_10079966
804 Ga0207686_10111664
805 Ga0207686_10519754
806 Ga0207709_10015847
807 Ga0207709_10162135
808 Ga0207670_10400323
809 Ga0207704_10139688
810 Ga0207704_10435215
811 Ga0207665_10012145
812 Ga0207691_10014395
813 Ga0207691_10155712
814 Ga0207711_10083367
815 Ga0207711_10164207
816 Ga0207689_10035816
817 Ga0207689_10095637
818 Ga0207661_10020732
819 Ga0207661_10135635
820 Ga0207661_10143433
821 Ga0207661_10143529
822 Ga0207661_10215913
823 Ga0207661_10247939
824 Ga0207661_11040175
825 Ga0207679_10155124
826 Ga0207679_10415913
827 Ga0207679_10645329
828 Ga0207651_10090095
829 Ga0207651_10685330
830 Ga0207712_10051046
831 Ga0207640_10280587
832 Ga0207640_10686912
833 Ga0207677_10792984
834 Ga0207703_10098112
835 Ga0207639_10114215
836 Ga0207708_10258712
837 Ga0207702_10008265
838 Ga0207702_10057911
839 Ga0207702_10163885
840 Ga0207702_10413424
841 Ga0207702_10419967
842 Ga0207648_10005667
843 Ga0207648_10162906
844 Ga0207648_11669754
845 Ga0207676_10273955
846 Ga0207674_11343292
847 Ga0207675_100002599
848 Ga0207698_10244015
849 Ga0207428_10002698
850 Ga0307408_100052444
851 Ga0307408_100236257
852 Ga0307405_10082656
853 Ga0307405_10366018
854 Ga0307409_100919080
855 Ga0307416_102411040
856 Ga0307411_10026212
857 Ga0373940_0118310
858 Ga0373944_0082948
859 Ga0373952_0030880
860 Ga0373952_0061634
861 Ga0373945_0041767
862 Ga0373943_0016211
863 Ga0373961_0109015
864 Ga0373961_0115983
865 Ga0373962_0030364
866 Ga0373931_0036536
867 Ga0373931_0051386
868 Ga0373935_0122031
869 Ga0373935_0147803
870 Ga0373947_0023559
871 Ga0373947_0046859
872 Ga0373925_0074918
873 Ga0373925_0098001
874 Ga0395899_0060483
875 Ga0395899_0104844
876 Ga0395899_0206720
877 Ga0395900_0014427
878 Ga0395900_0021195
879 Ga0395900_0026221
880 Ga0395900_0071670
881 Ga0395900_0089339
882 Ga0395900_0663475
883 Ga0395898_0035606
884 Ga0395898_0140991
885 Ga0395898_0155203
886 Ga0395898_0258260
887 Ga0395905_0034815
888 Ga0395905_0083456
889 Ga0395901_0005928
890 Ga0395901_0032898
891 Ga0395901_0092285
892 Ga0451789_1229131
893 Ga0451793_1658203
894 Ga0451807_2105970
895 Ga0439441_045011
896 Ga0439450_025024
897 Ga0450914_019628
898 Ga0439446_0064633
899 Ga0466963_0007040
900 Ga0466963_0018797
901 Ga0466963_0165085
902 Ga0466964_0005657
903 Ga0466957_0174625
904 Ga0466957_0752911
905 Ga0466967_0026777
906 Ga0466967_0033790
907 Ga0466967_0037132
908 Ga0466967_0046791
909 Ga0466967_0048402
910 Ga0466967_0090309
911 Ga0466967_0602764
912 Ga0495603_0000394
913 Ga0495603_0016556
914 Ga0495629_0199073
915 Ga0495629_0428421
916 Ga0495641_0005687
917 Ga0495580_0040056
918 Ga0495582_0007425
919 Ga0495582_0033702
920 Ga0495594_0000597
921 Ga0495596_0228114
922 Ga0495607_0132437
923 Ga0495630_0112490
924 Ga0495630_0591231
925 Ga0495644_0263335
926 Ga0495666_0259116
927 Ga0495652_0115170
928 Ga0495652_0505976
929 Ga0495654_0102016
930 Ga0495665_0052348
931 Ga0495640_0275283
932 Ga0495621_0355635
933 Ga0495667_0358122
934 Ga0495668_0213340
935 Ga0495634_0051796
936 Ga0495588_0000483
937 Ga0495588_0206382
938 Ga0495599_0182797
939 Ga0495599_0254219
940 Ga0495647_0054050
941 Ga0495647_0214761
942 Ga0495624_0080821
943 Ga0495624_0405088
944 Ga0495589_0266046
945 Ga0495600_0266743
946 Ga0495581_0122824
947 Ga0495674_0013017
948 Ga0495674_0084975
949 Ga0495674_0500700
950 Ga0495676_0008869
951 Ga0495676_0010528
952 Ga0495680_0150516
953 Ga0495680_0166820
954 Ga0495680_0415116
955 Ga0496100_0019627
956 Ga0496100_0062470
957 Ga0496100_0076162
958 Ga0496100_0505448
959 Ga0496101_0010225
960 Ga0496101_0039516
961 Ga0496101_0055075
962 Ga0496102_0084225
963 Ga0496102_0114528
964 Ga0496103_0029560
965 Ga0496103_0084566
966 Ga0496104_0000967
967 Ga0496104_0160069
968 Ga0496104_0344349
969 Ga0496104_1026769
970 Ga0496104_1189340
971 Ga0496104_1204864
972 Ga0496105_0010997
973 Ga0496105_0081648
974 Ga0496105_0286637
975 Ga0496106_0020346
976 Ga0496106_0020471
977 Ga0496106_0049038
978 Ga0496107_0005929
979 Ga0496107_0031792
980 Ga0496107_0148289
981 Ga0496107_0322748
982 Ga0496107_0536195
983 Ga0496108_0002223
984 Ga0496108_0003763
985 Ga0496108_0066544
986 Ga0496108_0114007
987 Ga0496108_0247587
988 Ga0496108_0267358
989 Ga0496108_0275920
990 Ga0496108_0319756
991 Ga0496108_0544697
992 Ga0496109_0031675
993 Ga0496109_0035962
994 Ga0496109_0040152
995 Ga0496109_0049096
996 Ga0496109_0097069
997 Ga0496109_0109278
998 Ga0496109_0143670
999 Ga0496109_0150033
1000 Ga0496109_0507887
1001 Ga0496109_0904073
1002 Ga0496110_0008374
1003 Ga0496110_0015005
1004 Ga0496110_0015375
1005 Ga0496110_0030829
1006 Ga0496110_0145831
1007 Ga0496110_0187867
1008 Ga0496110_0225424
1009 Ga0496110_0369750
1010 Ga0496110_0379784
1011 Ga0496110_0442548
1012 Ga0496110_0663135
1013 Ga0496111_0000489
1014 Ga0496111_0002288
1015 Ga0496111_0012439
1016 Ga0496111_0056303
1017 Ga0496111_0080670
1018 Ga0496112_0011226
1019 Ga0496112_0125051
1020 Ga0496112_0151302
1021 Ga0496112_0458526
1022 Ga0496113_0000591
1023 Ga0496113_0005817
1024 Ga0496113_0024886
1025 Ga0496113_0143616
1026 Ga0496113_0325428
1027 Ga0496114_0015998
1028 Ga0496114_0033729
1029 Ga0496114_0373437
1030 Ga0496115_0041685
1031 Ga0501031_0126837
1032 Ga0501034_0348026
1033 Ga0501036_0042913
1034 Ga0501037_0149930
1035 Ga0501038_0227123
1036 Ga0501039_0148482
1037 Ga0501040_0145498
1038 Ga0501041_0026055
1039 Ga0501042_0015337
1040 Ga0501042_0257323
1041 Ga0501046_0100346
1042 Ga0501048_0096042
1043 Ga0501048_0245694
1044 Ga0501067_0002478
1045 Ga0501068_0075817
1046 Ga0501069_0006235
1047 Ga0501070_0792512
1048 Ga0501071_0149547
1049 Ga0501072_0040815
1050 Ga0501075_0079746
1051 Ga0501076_0037355
1052 Ga0501077_0005586
1053 Ga0501077_0053734
1054 Ga0501079_0043092
1055 Ga0501080_0103009
1056 Ga0501081_0018370
1057 Ga0501081_0061916
1058 Ga0501083_0024630
1059 Ga0501083_0169862
1060 Ga0501045_0015263
1061 nmdc:mga05p37_38070_c1
1062 nmdc:mga09592_26356_c1
1063 nmdc:mga08y16_11969_c1
1064 nmdc:mga08y16_93907_c1
1065 nmdc:mga0n895_1291322_c1
1066 nmdc:mga0n895_322562_c1
1067 nmdc:mga0n895_39111_c1
1068 nmdc:mga0n895_556082_c1
1069 nmdc:mga08x19_5520_c1
1070 nmdc:mga0a205_9182_c2
1071 Ga0495601_0008895
1072 Ga0495601_0018513
1073 Ga0495601_0130827
1074 Ga0495612_0017042
1075 Ga0495612_0023856
1076 Ga0495595_0008886
1077 Ga0495619_0010828
1078 Ga0495619_0402225
1079 Ga0501084_0024254
1080 Ga0501084_0039877
1081 Ga0501082_0063062
1082 Ga0501082_0241927
1083 Ga0530510_0375207
1084 Ga0530510_0404268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

76

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qac-assembly1.cif.gz_A structure of amaranth 11s proglobulin seed storage protein from amaranthus hypochondriacus l. 0.9283 56 127
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9085 39 129
4ccj-assembly1.cif.gz_D 60s ribosomal protein l8 histidine hydroxylase (no66) in apo form 0.9083 56 129
4cco-assembly1.cif.gz_B-2 60s ribosomal protein l8 histidine hydroxylase (no66 s373c) in complex with mn(ii), n-oxalylglycine (nog) and 60s ribosomal protein l8 (rpl8 g214c) peptide fragment (complex-3) 0.9053 56 129
4ccm-assembly1.cif.gz_B-2 60s ribosomal protein l8 histidine hydroxylase (no66) in complex with mn(ii), n-oxalylglycine (nog) and 60s ribosomal protein l8 (rpl8 g220c) peptide fragment (complex-1) 0.9052 56 129
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9123 52 129 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9097 37 133 2.60.120.10
af_Q4D641_20_259_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9021 56 130 2.60.120.650
4e4hC01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8993 56 129 2.60.120.650
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8927 56 131 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A395S3S1-F1-model_v4 Gentisate 1,2-dioxygenase 0.949 55 128 GO:0051213
AF-A0A0E9NQA9-F1-model_v4 Cupin type-2 domain-containing protein 0.946 39 129
AF-A0A261Y6C8-F1-model_v4 Cupin type-2 domain-containing protein 0.9387 39 129
AF-A0A110A0C0-F1-model_v4 Cupin type-2 domain-containing protein 0.9384 55 129
AF-A0A285QZE0-F1-model_v4 Mannose-6-phosphate isomerase, cupin superfamily 0.9374 39 129 GO:0016853

Map