F461360

General Info

Members Datasets Scaffolds Average Seq Length
541 224 541 225

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10788957|Ga0105237_107889571
Length 216
Sequence MGEMVQFPFAGGSTGGYLATPKQGNGPGVIVIQEWWGLVDHIKDVCDRFADEGFVALAPDLYHGKTAKSPDEAGKLMMAMRIDEAERDLSAAVQYLSTQDSTTSDKVGVVGFCMGGALSLYCVVFYGGHPKVKPDLPNLHAPVLGLYGEKDKGITPETVHKLERDVKALGKSIEVVIYPGADHAFFNDQRPQVYNAEAAADAWRRTIAFLREHLSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
186 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
191 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
192 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
196 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
200 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
201 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
202 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
203 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
204 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3433698 2162886007 Bacteria 2192
2 MBSR1b_contig_12507348 2162886012 Bacteria 1427
3 MBSR1b_contig_861221 2162886012 Bacteria 1460
4 CNBas_1000895 3300000531 Unclassified 1474
5 CNAas_1000325 3300000532 Unclassified 4584
6 JGI24751J29686_10000329 3300002459 Bacteria 17504
7 JGI25406J46586_10001381 3300003203 Bacteria 11458
8 JGI25406J46586_10002828 3300003203 Bacteria 8170
9 rootH2_10172926 3300003320 Unclassified 1625
10 rootL2_10163588 3300003322 Bacteria 1815
11 Ga0065714_10064452 3300005288 Bacteria 75496
12 Ga0065704_10001026 3300005289 Bacteria 13177
13 Ga0065712_10000126 3300005290 Bacteria 75495
14 Ga0065712_10020674 3300005290 Bacteria 1583
15 Ga0065712_10033281 3300005290 Bacteria 1179
16 Ga0065712_10070138 3300005290 Bacteria 6294
17 Ga0065712_10119890 3300005290 Bacteria 1686
18 Ga0065715_10002697 3300005293 Bacteria 5254
19 Ga0065715_10007206 3300005293 Bacteria 3097
20 Ga0065715_10008548 3300005293 Bacteria 3167
21 Ga0065715_10096483 3300005293 Bacteria 3871
22 Ga0065715_10126569 3300005293 Unclassified 2106
23 Ga0065715_10312783 3300005293 Unclassified 1009
24 Ga0065707_10000828 3300005295 Bacteria 12929
25 Ga0065707_10198880 3300005295 Bacteria 1321
26 Ga0070676_10085425 3300005328 Bacteria 1923
27 Ga0070670_100146176 3300005331 Bacteria 2045
28 Ga0070670_100213142 3300005331 Unclassified 1679
29 Ga0070670_100382508 3300005331 Bacteria 1240
30 Ga0070677_10047661 3300005333 Bacteria 1718
31 Ga0068869_100119920 3300005334 Bacteria 2010
32 Ga0068869_100147918 3300005334 Unclassified 1819
33 Ga0068869_100222847 3300005334 Unclassified 1495
34 Ga0068869_100696073 3300005334 Unclassified 866
35 Ga0070666_10312883 3300005335 Unclassified 1119
36 Ga0070682_100174645 3300005337 Unclassified 1496
37 Ga0070689_100000072 3300005340 Bacteria 60316
38 Ga0070689_100268565 3300005340 Unclassified 1412
39 Ga0070689_100271320 3300005340 Bacteria 1405
40 Ga0070691_10172583 3300005341 Unclassified 1121
41 Ga0070687_100168114 3300005343 Unclassified 1303
42 Ga0070692_10083253 3300005345 Bacteria 1727
43 Ga0070675_100397908 3300005354 Unclassified 1228
44 Ga0070671_100032832 3300005355 Bacteria 4290
45 Ga0070671_100037725 3300005355 Unclassified 4008
46 Ga0070671_100263532 3300005355 Bacteria 1465
47 Ga0070673_100026091 3300005364 Bacteria 4310
48 Ga0070673_100353345 3300005364 Bacteria 1305
49 Ga0070688_100364704 3300005365 Bacteria 1061
50 Ga0070667_100100947 3300005367 Bacteria 2492
51 Ga0070703_10005349 3300005406 Bacteria 3586
52 Ga0070713_100078868 3300005436 Bacteria 2804
53 Ga0070701_10031897 3300005438 Bacteria 2618
54 Ga0070701_10095739 3300005438 Unclassified 1635
55 Ga0070701_10250657 3300005438 Unclassified 1069
56 Ga0070701_10436917 3300005438 Unclassified 837
57 Ga0070705_100000368 3300005440 Bacteria 26424
58 Ga0070705_100122265 3300005440 Bacteria 1683
59 Ga0070705_100249677 3300005440 Unclassified 1245
60 Ga0070700_100000005 3300005441 Bacteria 233160
61 Ga0070700_100013213 3300005441 Bacteria 4634
62 Ga0070700_100039925 3300005441 Bacteria 2870
63 Ga0070700_100095902 3300005441 Bacteria 1945
64 Ga0070700_100694944 3300005441 Unclassified 808
65 Ga0070694_100020234 3300005444 Bacteria 4240
66 Ga0070694_100039216 3300005444 Bacteria 3152
67 Ga0070694_100131752 3300005444 Bacteria 1807
68 Ga0070694_100149841 3300005444 Bacteria 1703
69 Ga0070694_100287873 3300005444 Unclassified 1255
70 Ga0070694_100354343 3300005444 Bacteria 1138
71 Ga0070694_100438551 3300005444 Unclassified 1029
72 Ga0070678_100187309 3300005456 Unclassified 1699
73 Ga0070662_100410088 3300005457 Bacteria 1119
74 Ga0070681_10005713 3300005458 Bacteria 12025
75 Ga0070681_10339607 3300005458 Bacteria 1412
76 Ga0068867_100037909 3300005459 Bacteria 3506
77 Ga0068867_100098675 3300005459 Unclassified 2228
78 Ga0070685_10037095 3300005466 Unclassified 2759
79 Ga0070706_100000905 3300005467 Bacteria 32470
80 Ga0070706_100043717 3300005467 Bacteria 4139
81 Ga0070707_100245955 3300005468 Unclassified 1741
82 Ga0070707_100953792 3300005468 Bacteria 823
83 Ga0070698_100022602 3300005471 Bacteria 6577
84 Ga0070698_100027692 3300005471 Bacteria 5891
85 Ga0070698_100045623 3300005471 Bacteria 4486
86 Ga0070698_100114842 3300005471 Bacteria 2657
87 Ga0070698_100193181 3300005471 Unclassified 1973
88 Ga0070699_100001460 3300005518 Bacteria 21670
89 Ga0070699_100018881 3300005518 Bacteria 5926
90 Ga0070699_100052146 3300005518 Bacteria 3541
91 Ga0070699_100249942 3300005518 Unclassified 1584
92 Ga0070699_100281295 3300005518 Bacteria 1490
93 Ga0070679_100282305 3300005530 Bacteria 1613
94 Ga0070697_100094626 3300005536 Bacteria 2476
95 Ga0070697_100333955 3300005536 Unclassified 1307
96 Ga0070686_100046512 3300005544 Unclassified 2739
97 Ga0070686_100426203 3300005544 Bacteria 1015
98 Ga0070695_100017896 3300005545 Bacteria 4299
99 Ga0070695_100075956 3300005545 Bacteria 2212
100 Ga0070695_100239103 3300005545 Unclassified 1316
101 Ga0070695_100368552 3300005545 Bacteria 1081
102 Ga0070695_100489895 3300005545 Unclassified 949
103 Ga0070695_100753275 3300005545 Unclassified 777
104 Ga0070696_100134968 3300005546 Unclassified 1798
105 Ga0070696_100202370 3300005546 Bacteria 1483
106 Ga0070693_100004080 3300005547 Bacteria 6876
107 Ga0070693_100029258 3300005547 Bacteria 3003
108 Ga0070665_100191359 3300005548 Bacteria 2047
109 Ga0070704_100083619 3300005549 Bacteria 2357
110 Ga0070704_100115126 3300005549 Bacteria 2054
111 Ga0070704_100276727 3300005549 Bacteria 1389
112 Ga0070704_100622348 3300005549 Unclassified 951
113 Ga0070704_100638916 3300005549 Bacteria 939
114 Ga0070664_101128494 3300005564 Bacteria 739
115 Ga0068857_100222815 3300005577 Bacteria 1723
116 Ga0068857_100479290 3300005577 Bacteria 1166
117 Ga0068854_100003245 3300005578 Bacteria 10138
118 Ga0068854_100112987 3300005578 Bacteria 2051
119 Ga0068854_100299880 3300005578 Unclassified 1300
120 Ga0070702_100688688 3300005615 Bacteria 778
121 Ga0068852_100736267 3300005616 Unclassified 997
122 Ga0068859_100008723 3300005617 Bacteria 10242
123 Ga0068859_100020685 3300005617 Bacteria 6604
124 Ga0068859_100065167 3300005617 Bacteria 3677
125 Ga0068859_100068120 3300005617 Bacteria 3594
126 Ga0068859_100155535 3300005617 Bacteria 2363
127 Ga0068859_100188338 3300005617 Bacteria 2147
128 Ga0068859_100357853 3300005617 Bacteria 1555
129 Ga0068859_100596752 3300005617 Bacteria 1197
130 Ga0068859_100858159 3300005617 Bacteria 994
131 Ga0068859_101253620 3300005617 Unclassified 817
132 Ga0068864_100002893 3300005618 Bacteria 14185
133 Ga0068864_100078779 3300005618 Unclassified 2884
134 Ga0068864_100215603 3300005618 Unclassified 1769
135 Ga0068864_100349589 3300005618 Unclassified 1394
136 Ga0068864_100394262 3300005618 Bacteria 1314
137 Ga0068864_100708199 3300005618 Bacteria 984
138 Ga0068866_10052944 3300005718 Bacteria 2073
139 Ga0068866_10623003 3300005718 Bacteria 731
140 Ga0068861_100001848 3300005719 Bacteria 13617
141 Ga0068851_10228347 3300005834 Unclassified 1048
142 Ga0068870_10097936 3300005840 Bacteria 1651
143 Ga0068870_10132226 3300005840 Unclassified 1451
144 Ga0068863_100047038 3300005841 Bacteria 4094
145 Ga0068863_100274515 3300005841 Bacteria 1632
146 Ga0068863_100313257 3300005841 Unclassified 1524
147 Ga0068863_100319893 3300005841 Bacteria 1507
148 Ga0068863_100351743 3300005841 Bacteria 1435
149 Ga0068863_100424570 3300005841 Bacteria 1303
150 Ga0068863_100679037 3300005841 Bacteria 1023
151 Ga0068858_100112189 3300005842 Unclassified 2546
152 Ga0068858_100114869 3300005842 Bacteria 2515
153 Ga0068858_100121850 3300005842 Bacteria 2439
154 Ga0068858_100168704 3300005842 Bacteria 2063
155 Ga0068858_100196492 3300005842 Bacteria 1906
156 Ga0068858_100272704 3300005842 Bacteria 1610
157 Ga0068858_100384735 3300005842 Bacteria 1347
158 Ga0068860_100060232 3300005843 Bacteria 3608
159 Ga0068860_100289765 3300005843 Bacteria 1602
160 Ga0068860_100532424 3300005843 Bacteria 1175
161 Ga0068860_100555280 3300005843 Bacteria 1151
162 Ga0068862_100085625 3300005844 Bacteria 2739
163 Ga0081540_1090277 3300005983 Unclassified 1349
164 Ga0081539_10000056 3300005985 Bacteria 256522
165 Ga0081539_10000281 3300005985 Bacteria 114795
166 Ga0081539_10001024 3300005985 Bacteria 51459
167 Ga0081539_10012860 3300005985 Bacteria 6379
168 Ga0081539_10105896 3300005985 Bacteria 1425
169 Ga0070716_100045338 3300006173 Bacteria 2468
170 Ga0097621_100003746 3300006237 Bacteria 10532
171 Ga0097621_100024026 3300006237 Bacteria 4754
172 Ga0097621_100875206 3300006237 Unclassified 836
173 Ga0068871_100005511 3300006358 Bacteria 8877
174 Ga0068871_100022221 3300006358 Bacteria 4891
175 Ga0068871_100199283 3300006358 Unclassified 1728
176 Ga0075428_100002943 3300006844 Bacteria 18557
177 Ga0075428_100015903 3300006844 Bacteria 8324
178 Ga0075428_100045420 3300006844 Bacteria 4826
179 Ga0075428_100158877 3300006844 Unclassified 2454
180 Ga0075428_100186373 3300006844 Bacteria 2245
181 Ga0075430_100136978 3300006846 Bacteria 2039
182 Ga0075431_100047836 3300006847 Bacteria 4410
183 Ga0075431_100074862 3300006847 Bacteria 3494
184 Ga0075433_10014257 3300006852 Bacteria 6491
185 Ga0075433_10028656 3300006852 Bacteria 4737
186 Ga0075433_10029785 3300006852 Bacteria 4653
187 Ga0075433_10086425 3300006852 Bacteria 2769
188 Ga0075433_10163150 3300006852 Bacteria 1983
189 Ga0075433_10254477 3300006852 Bacteria 1558
190 Ga0075433_10614861 3300006852 Bacteria 953
191 Ga0075434_100044322 3300006871 Bacteria 4413
192 Ga0075434_100190007 3300006871 Unclassified 2074
193 Ga0075434_100428093 3300006871 Bacteria 1345
194 Ga0075434_100747112 3300006871 Bacteria 995
195 Ga0075429_100044176 3300006880 Bacteria 3876
196 Ga0075429_100068229 3300006880 Bacteria 3095
197 Ga0075429_100436656 3300006880 Bacteria 1147
198 Ga0097620_100008723 3300006931 Bacteria 10242
199 Ga0097620_100020685 3300006931 Bacteria 6604
200 Ga0097620_100048082 3300006931 Bacteria 4285
201 Ga0097620_100065169 3300006931 Bacteria 3677
202 Ga0097620_100068121 3300006931 Bacteria 3594
203 Ga0097620_100155545 3300006931 Bacteria 2363
204 Ga0097620_100188347 3300006931 Bacteria 2147
205 Ga0097620_100357828 3300006931 Bacteria 1555
206 Ga0097620_100391461 3300006931 Bacteria 1485
207 Ga0097620_100596764 3300006931 Bacteria 1197
208 Ga0097620_100858139 3300006931 Bacteria 994
209 Ga0097620_101253699 3300006931 Unclassified 817
210 Ga0075435_100119463 3300007076 Bacteria 2198
211 Ga0075435_100178641 3300007076 Unclassified 1793
212 Ga0099794_10013356 3300007265 Bacteria 3573
213 Ga0105240_10023614 3300009093 Bacteria 8124
214 Ga0105240_10080187 3300009093 Unclassified 4015
215 Ga0105240_10321750 3300009093 Bacteria 1763
216 Ga0111539_10007731 3300009094 Bacteria 13729
217 Ga0111539_10010931 3300009094 Bacteria 11425
218 Ga0111539_10033292 3300009094 Bacteria 6258
219 Ga0111539_10189092 3300009094 Bacteria 2403
220 Ga0111539_10293769 3300009094 Bacteria 1891
221 Ga0111539_10418210 3300009094 Bacteria 1561
222 Ga0111539_10904849 3300009094 Unclassified 1026
223 Ga0105245_10016130 3300009098 Bacteria 6509
224 Ga0105247_10086185 3300009101 Bacteria 1987
225 Ga0105247_10442315 3300009101 Bacteria 935
226 Ga0114129_10000386 3300009147 Bacteria 51383
227 Ga0114129_10001678 3300009147 Bacteria 30169
228 Ga0114129_10017547 3300009147 Bacteria 10190
229 Ga0114129_10023920 3300009147 Bacteria 8657
230 Ga0114129_10035104 3300009147 Bacteria 7085
231 Ga0114129_10056371 3300009147 Bacteria 5504
232 Ga0114129_10116828 3300009147 Bacteria 3676
233 Ga0114129_10179894 3300009147 Bacteria 2878
234 Ga0114129_10222450 3300009147 Bacteria 2546
235 Ga0114129_10350631 3300009147 Bacteria 1955
236 Ga0114129_10412598 3300009147 Bacteria 1778
237 Ga0114129_10437479 3300009147 Bacteria 1717
238 Ga0114129_10450030 3300009147 Bacteria 1689
239 Ga0114129_10499859 3300009147 Bacteria 1588
240 Ga0114129_10698277 3300009147 Bacteria 1304
241 Ga0114129_11713406 3300009147 Unclassified 766
242 Ga0105243_10011061 3300009148 Bacteria 6826
243 Ga0105243_10012616 3300009148 Bacteria 6383
244 Ga0105243_10666150 3300009148 Unclassified 1010
245 Ga0105241_10095634 3300009174 Bacteria 2352
246 Ga0105241_10241519 3300009174 Bacteria 1527
247 Ga0105241_10382176 3300009174 Bacteria 1231
248 Ga0105241_10534338 3300009174 Bacteria 1050
249 Ga0105241_10734808 3300009174 Bacteria 904
250 Ga0105242_10019725 3300009176 Bacteria 5284
251 Ga0105242_10403887 3300009176 Bacteria 1276
252 Ga0105242_10458701 3300009176 Bacteria 1203
253 Ga0105242_10637219 3300009176 Bacteria 1035
254 Ga0105248_10002076 3300009177 Bacteria 22166
255 Ga0105248_10002454 3300009177 Bacteria 20600
256 Ga0105248_10465440 3300009177 Bacteria 1425
257 Ga0105248_10514888 3300009177 Bacteria 1349
258 Ga0105248_10527239 3300009177 Bacteria 1332
259 Ga0105248_10697787 3300009177 Unclassified 1145
260 Ga0105237_10178454 3300009545 Bacteria 2124
261 Ga0105237_10388186 3300009545 Unclassified 1401
262 Ga0105237_10788957 3300009545 Unclassified 957
263 Ga0105238_10005709 3300009551 Bacteria 12297
264 Ga0105238_11207971 3300009551 Unclassified 781
265 Ga0105249_10014928 3300009553 Bacteria 6870
266 Ga0105249_10038036 3300009553 Bacteria 4366
267 Ga0105249_10835623 3300009553 Bacteria 986
268 Ga0105246_10135558 3300011119 Bacteria 1845
269 Ga0105246_10391150 3300011119 Unclassified 1152
270 Ga0157373_10038585 3300013100 Bacteria 3423
271 Ga0157373_10045912 3300013100 Bacteria 3118
272 Ga0157374_10212114 3300013296 Bacteria 1899
273 Ga0157374_10734099 3300013296 Unclassified 1002
274 Ga0157378_10007115 3300013297 Bacteria 9771
275 Ga0157378_10366173 3300013297 Bacteria 1412
276 Ga0163162_10004933 3300013306 Bacteria 12858
277 Ga0163162_10012377 3300013306 Bacteria 8330
278 Ga0163162_10166972 3300013306 Bacteria 2325
279 Ga0163162_10451757 3300013306 Unclassified 1417
280 Ga0163162_10633681 3300013306 Unclassified 1193
281 Ga0157372_10072507 3300013307 Bacteria 3881
282 Ga0157372_10177364 3300013307 Bacteria 2466
283 Ga0157372_10233928 3300013307 Unclassified 2131
284 Ga0157372_10672076 3300013307 Unclassified 1206
285 Ga0157375_10035396 3300013308 Bacteria 4766
286 Ga0157375_10041345 3300013308 Bacteria 4450
287 Ga0157375_10152911 3300013308 Bacteria 2444
288 Ga0157375_10308040 3300013308 Bacteria 1748
289 Ga0157375_10559813 3300013308 Bacteria 1304
290 Ga0163163_10000241 3300014325 Bacteria 55923
291 Ga0163163_10006595 3300014325 Bacteria 10166
292 Ga0163163_10007667 3300014325 Bacteria 9536
293 Ga0163163_10028821 3300014325 Bacteria 5336
294 Ga0163163_10031143 3300014325 Bacteria 5147
295 Ga0163163_10835306 3300014325 Bacteria 985
296 Ga0163163_11145764 3300014325 Bacteria 840
297 Ga0163163_11197549 3300014325 Unclassified 822
298 Ga0157380_10004089 3300014326 Bacteria 10078
299 Ga0157380_10020803 3300014326 Bacteria 4911
300 Ga0157380_10273325 3300014326 Bacteria 1542
301 Ga0157380_10903834 3300014326 Bacteria 909
302 Ga0157377_10019907 3300014745 Unclassified 3510
303 Ga0157377_10043397 3300014745 Bacteria 2502
304 Ga0157379_10193245 3300014968 Bacteria 1839
305 Ga0157379_10684779 3300014968 Bacteria 962
306 Ga0157376_10298428 3300014969 Unclassified 1524
307 Ga0163161_10019096 3300017792 Unclassified 4804
308 Ga0207697_10057503 3300025315 Bacteria 1614
309 Ga0207697_10074744 3300025315 Unclassified 1423
310 Ga0207697_10107462 3300025315 Bacteria 1193
311 Ga0207656_10163700 3300025321 Unclassified 1060
312 Ga0207653_10008427 3300025885 Bacteria 3210
313 Ga0207642_10091307 3300025899 Bacteria 1505
314 Ga0207642_10205311 3300025899 Bacteria 1091
315 Ga0207710_10000529 3300025900 Bacteria 23411
316 Ga0207647_10040188 3300025904 Bacteria 2947
317 Ga0207645_10310461 3300025907 Bacteria 1051
318 Ga0207643_10010832 3300025908 Bacteria 4917
319 Ga0207643_10016467 3300025908 Bacteria 4033
320 Ga0207643_10141996 3300025908 Unclassified 1435
321 Ga0207643_10246273 3300025908 Bacteria 1100
322 Ga0207684_10000520 3300025910 Bacteria 47656
323 Ga0207684_10193565 3300025910 Bacteria 1754
324 Ga0207654_10307832 3300025911 Bacteria 1079
325 Ga0207707_10014000 3300025912 Bacteria 6994
326 Ga0207707_10445018 3300025912 Bacteria 1109
327 Ga0207695_10103128 3300025913 Bacteria 2844
328 Ga0207695_10353696 3300025913 Bacteria 1356
329 Ga0207671_10043832 3300025914 Bacteria 3308
330 Ga0207671_10177904 3300025914 Bacteria 1654
331 Ga0207660_10431747 3300025917 Bacteria 1064
332 Ga0207662_10014215 3300025918 Bacteria 4463
333 Ga0207662_10281197 3300025918 Unclassified 1101
334 Ga0207662_10349483 3300025918 Unclassified 993
335 Ga0207652_10405109 3300025921 Bacteria 1231
336 Ga0207646_10000128 3300025922 Bacteria 103131
337 Ga0207646_10034005 3300025922 Bacteria 4607
338 Ga0207646_10166838 3300025922 Unclassified 1988
339 Ga0207681_10068631 3300025923 Unclassified 2463
340 Ga0207694_10004008 3300025924 Bacteria 11609
341 Ga0207694_10152651 3300025924 Unclassified 1861
342 Ga0207650_10000009 3300025925 Bacteria 483583
343 Ga0207650_10290620 3300025925 Bacteria 1333
344 Ga0207650_10303422 3300025925 Unclassified 1305
345 Ga0207687_10959614 3300025927 Unclassified 733
346 Ga0207700_10164822 3300025928 Bacteria 1843
347 Ga0207644_10022739 3300025931 Bacteria 4286
348 Ga0207644_10452183 3300025931 Bacteria 1055
349 Ga0207686_10402947 3300025934 Bacteria 1042
350 Ga0207709_10336646 3300025935 Bacteria 1134
351 Ga0207670_10026612 3300025936 Bacteria 3647
352 Ga0207670_10146827 3300025936 Unclassified 1745
353 Ga0207670_10587736 3300025936 Unclassified 913
354 Ga0207704_10108882 3300025938 Unclassified 1867
355 Ga0207704_10121530 3300025938 Bacteria 1788
356 Ga0207665_10027591 3300025939 Bacteria 3751
357 Ga0207691_10014937 3300025940 Bacteria 7398
358 Ga0207711_10008113 3300025941 Bacteria 8789
359 Ga0207711_10185768 3300025941 Bacteria 1892
360 Ga0207711_10322617 3300025941 Bacteria 1427
361 Ga0207711_10450532 3300025941 Bacteria 1198
362 Ga0207711_10658894 3300025941 Unclassified 976
363 Ga0207689_10007209 3300025942 Bacteria 9766
364 Ga0207689_10187235 3300025942 Bacteria 1707
365 Ga0207689_10265424 3300025942 Bacteria 1421
366 Ga0207689_10520419 3300025942 Unclassified 998
367 Ga0207689_10698836 3300025942 Unclassified 855
368 Ga0207679_10056252 3300025945 Bacteria 2904
369 Ga0207651_10145476 3300025960 Bacteria 1837
370 Ga0207712_10009655 3300025961 Bacteria 6116
371 Ga0207712_10562418 3300025961 Bacteria 982
372 Ga0207640_10016956 3300025981 Bacteria 4250
373 Ga0207640_10135703 3300025981 Bacteria 1786
374 Ga0207658_10106351 3300025986 Bacteria 2209
375 Ga0207677_10117725 3300026023 Bacteria 1992
376 Ga0207703_10072629 3300026035 Unclassified 2844
377 Ga0207703_10079358 3300026035 Bacteria 2731
378 Ga0207703_10086659 3300026035 Bacteria 2624
379 Ga0207703_10196591 3300026035 Bacteria 1790
380 Ga0207703_10556742 3300026035 Unclassified 1082
381 Ga0207703_10829930 3300026035 Unclassified 883
382 Ga0207703_11179057 3300026035 Unclassified 736
383 Ga0207639_10259143 3300026041 Unclassified 1520
384 Ga0207639_10577705 3300026041 Bacteria 1034
385 Ga0207708_10000017 3300026075 Bacteria 190414
386 Ga0207708_10058116 3300026075 Bacteria 2951
387 Ga0207641_10125889 3300026088 Bacteria 2294
388 Ga0207641_10426174 3300026088 Bacteria 1278
389 Ga0207641_10521749 3300026088 Bacteria 1156
390 Ga0207641_10776395 3300026088 Bacteria 947
391 Ga0207648_10023843 3300026089 Bacteria 5472
392 Ga0207648_10130504 3300026089 Bacteria 2212
393 Ga0207648_10249173 3300026089 Unclassified 1583
394 Ga0207648_10290497 3300026089 Bacteria 1464
395 Ga0207648_10929772 3300026089 Unclassified 813
396 Ga0207676_10058419 3300026095 Bacteria 3043
397 Ga0207676_10104050 3300026095 Bacteria 2360
398 Ga0207676_10107655 3300026095 Unclassified 2325
399 Ga0207676_10111206 3300026095 Bacteria 2292
400 Ga0207676_10137077 3300026095 Unclassified 2090
401 Ga0207676_10595471 3300026095 Bacteria 1061
402 Ga0207676_10597252 3300026095 Unclassified 1060
403 Ga0207676_10698862 3300026095 Unclassified 982
404 Ga0207676_10932332 3300026095 Unclassified 853
405 Ga0207674_10166499 3300026116 Bacteria 2158
406 Ga0207674_10224987 3300026116 Bacteria 1825
407 Ga0207675_100004402 3300026118 Bacteria 13602
408 Ga0207675_100100814 3300026118 Unclassified 2720
409 Ga0207675_100417195 3300026118 Unclassified 1325
410 Ga0207683_10153575 3300026121 Bacteria 2078
411 Ga0207698_10071353 3300026142 Bacteria 2756
412 Ga0207698_10360396 3300026142 Bacteria 1377
413 Ga0207698_10542023 3300026142 Bacteria 1139
414 Ga0207428_10348799 3300027907 Bacteria 1089
415 Ga0268265_10144734 3300028380 Bacteria 1995
416 Ga0268265_10306453 3300028380 Bacteria 1432
417 Ga0268264_10512587 3300028381 Bacteria 1171
418 Ga0268264_10532175 3300028381 Bacteria 1150
419 Ga0268264_10664631 3300028381 Unclassified 1032
420 Ga0268264_10855332 3300028381 Unclassified 911
421 Ga0307408_100006178 3300031548 Bacteria 7953
422 Ga0307408_100042759 3300031548 Bacteria 3221
423 Ga0307408_100098497 3300031548 Unclassified 2223
424 Ga0307408_100156783 3300031548 Bacteria 1804
425 Ga0307405_10004641 3300031731 Bacteria 6524
426 Ga0307405_10043594 3300031731 Bacteria 2739
427 Ga0307405_10228570 3300031731 Bacteria 1370
428 Ga0307413_10370021 3300031824 Bacteria 1113
429 Ga0307410_10069655 3300031852 Bacteria 2434
430 Ga0307410_10341972 3300031852 Unclassified 1193
431 Ga0307410_10357277 3300031852 Bacteria 1169
432 Ga0307406_10000720 3300031901 Bacteria 18677
433 Ga0307407_10330832 3300031903 Bacteria 1072
434 Ga0307412_10012138 3300031911 Bacteria 5008
435 Ga0307412_10018148 3300031911 Bacteria 4227
436 Ga0307412_10210116 3300031911 Unclassified 1484
437 Ga0307409_100060923 3300031995 Bacteria 2946
438 Ga0307409_100143569 3300031995 Bacteria 2061
439 Ga0307409_100219397 3300031995 Bacteria 1716
440 Ga0307416_100075140 3300032002 Bacteria 2827
441 Ga0307416_100395502 3300032002 Unclassified 1417
442 Ga0307414_10021134 3300032004 Bacteria 4075
443 Ga0307411_10037911 3300032005 Bacteria 3035
444 Ga0307415_100088855 3300032126 Bacteria 2230
445 Ga0307415_100308852 3300032126 Unclassified 1313
446 Ga0373952_0047472 3300035092 Bacteria 1013
447 Ga0373932_0161566 3300035112 Bacteria 775
448 Ga0373960_0055006 3300035121 Bacteria 1192
449 Ga0373933_0601833 3300035724 Unclassified 722
450 Ga0373937_0095683 3300036401 Unclassified 2754
451 Ga0395900_0048967 3300037418 Bacteria 4353
452 Ga0395898_0206242 3300037466 Bacteria 1875
453 Ga0395901_0398604 3300038443 Unclassified 1414
454 Ga0439448_0139057 3300042005 Unclassified 840
455 Ga0439457_044097 3300042014 Bacteria 996
456 Ga0450889_003289 3300042144 Bacteria 1595
457 Ga0466967_0320024 3300045976 Bacteria 1496
458 Ga0466967_0396115 3300045976 Unclassified 1343
459 Ga0496102_0018502 3300048905 Bacteria 6123
460 Ga0496104_0383001 3300048907 Bacteria 1319
461 Ga0496104_0628588 3300048907 Bacteria 983
462 Ga0496106_0441841 3300048909 Bacteria 1045
463 Ga0496108_0233021 3300048911 Bacteria 1601
464 Ga0496112_0102304 3300048915 Bacteria 2835
465 Ga0496112_0120722 3300048915 Unclassified 2591
466 Ga0496112_0291866 3300048915 Bacteria 1577
467 Ga0501291_041944 3300049514 Bacteria 807
468 Ga0501303_003828 3300049526 Unclassified 1222
469 Ga0501048_0628052 3300049582 Unclassified 771
470 Ga0501077_0161271 3300049593 Bacteria 1424
471 Ga0501198_000621 3300049649 Unclassified 4406
472 Ga0501198_002365 3300049649 Bacteria 2537
473 Ga0501202_046889 3300049652 Unclassified 948
474 Ga0501214_018486 3300049659 Unclassified 862
475 Ga0501216_002572 3300049660 Bacteria 2591
476 Ga0501217_001210 3300049661 Bacteria 4763
477 Ga0501217_002028 3300049661 Bacteria 3918
478 Ga0501217_039054 3300049661 Unclassified 1201
479 Ga0501223_000855 3300049663 Bacteria 7227
480 Ga0501223_009006 3300049663 Bacteria 2028
481 Ga0501227_000381 3300049665 Bacteria 9381
482 Ga0501230_003826 3300049667 Unclassified 2028
483 Ga0501233_002731 3300049668 Bacteria 3128
484 Ga0501235_000548 3300049669 Bacteria 7512
485 Ga0501235_017456 3300049669 Unclassified 1588
486 Ga0501240_000136 3300049673 Bacteria 4917
487 Ga0501243_004935 3300049675 Bacteria 2003
488 Ga0501249_078513 3300049679 Unclassified 775
489 Ga0501250_015666 3300049680 Unclassified 934
490 Ga0501253_002493 3300049683 Bacteria 2080
491 Ga0501255_023706 3300049684 Unclassified 812
492 Ga0501257_004958 3300049686 Bacteria 2918
493 Ga0501260_006518 3300049689 Unclassified 1123
494 Ga0501221_004881 3300049704 Bacteria 2232
495 Ga0501221_095987 3300049704 Unclassified 730
496 Ga0501225_0000813 3300049705 Bacteria 9765
497 Ga0501234_000120 3300049707 Bacteria 10189
498 Ga0501245_009124 3300049708 Unclassified 1420
499 Ga0501079_0334507 3300049741 Bacteria 1186
500 Ga0501083_0024462 3300049744 Bacteria 4184
501 Ga0501268_024355 3300049765 Unclassified 1057
502 Ga0501270_002776 3300049767 Unclassified 1828
503 Ga0501226_000367 3300049853 Bacteria 6535
504 nmdc:mga05p37_101851_c1 3300050507 Unclassified 3536
505 nmdc:mga05p37_101_c1 3300050507 Bacteria 77106
506 nmdc:mga05p37_127046_c1 3300050507 Bacteria 3130
507 nmdc:mga05p37_15892_c1 3300050507 Bacteria 9053
508 nmdc:mga05p37_19220_c1 3300050507 Bacteria 8265
509 nmdc:mga05p37_231649_c1 3300050507 Bacteria 2225
510 nmdc:mga05p37_237816_c1 3300050507 Bacteria 2191
511 nmdc:mga05p37_267019_c1 3300050507 Bacteria 2046
512 nmdc:mga05p37_65590_c1 3300050507 Bacteria 4466
513 nmdc:mga05p37_72020_c1 3300050507 Bacteria 4252
514 nmdc:mga05p37_806229_c1 3300050507 Unclassified 1026
515 nmdc:mga05p37_815338_c1 3300050507 Unclassified 1019
516 nmdc:mga09592_134585_c1 3300050508 Bacteria 2128
517 nmdc:mga09592_358176_c1 3300050508 Bacteria 1262
518 nmdc:mga09592_358529_c1 3300050508 Bacteria 1262
519 nmdc:mga09592_38797_c1 3300050508 Bacteria 3999
520 nmdc:mga0qj67_177707_c1 3300050509 Bacteria 1729
521 nmdc:mga06r32_41436_c1 3300050510 Bacteria 4375
522 nmdc:mga06r32_450728_c1 3300050510 Unclassified 1266
523 nmdc:mga06r32_91925_c1 3300050510 Bacteria 2966
524 nmdc:mga08y16_22040_c1 3300050511 Bacteria 6727
525 nmdc:mga08y16_23608_c1 3300050511 Bacteria 6495
526 nmdc:mga08y16_63802_c1 3300050511 Bacteria 3848
527 nmdc:mga08y16_71647_c1 3300050511 Bacteria 3611
528 nmdc:mga0n895_299898_c1 3300050512 Bacteria 1629
529 nmdc:mga0n895_53598_c1 3300050512 Bacteria 3964
530 nmdc:mga0n895_801500_c1 3300050512 Unclassified 932
531 nmdc:mga08x19_25213_c1 3300050514 Bacteria 3703
532 nmdc:mga08x19_7604_c1 3300050514 Bacteria 6435
533 nmdc:mga0a205_127947_c1 3300050515 Bacteria 2440
534 nmdc:mga0a205_154306_c1 3300050515 Bacteria 2195
535 nmdc:mga0a205_194545_c1 3300050515 Bacteria 1919
536 nmdc:mga0a205_372533_c1 3300050515 Bacteria 1294
537 nmdc:mga0a205_43103_c1 3300050515 Bacteria 4351
538 nmdc:mga0a205_48984_c1 3300050515 Bacteria 4078
539 nmdc:mga0a205_54423_c1 3300050515 Bacteria 3864
540 nmdc:mga0a205_57361_c1 3300050515 Bacteria 3760
541 Ga0501084_0467671 3300054114 Bacteria 1066

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10141996 Ga0207643_101419962 191
2 3300049526 Ga0501303_003828 Ga0501303_003828_17_604 195
3 3300049661 Ga0501217_039054 Ga0501217_039054_63_650 195
4 3300049669 Ga0501235_017456 Ga0501235_017456_772_1359 195
5 3300049675 Ga0501243_004935 Ga0501243_004935_76_663 195
6 3300049679 Ga0501249_078513 Ga0501249_078513_104_691 195
7 3300049684 Ga0501255_023706 Ga0501255_023706_189_776 195
8 3300049689 Ga0501260_006518 Ga0501260_006518_80_667 195
9 3300049704 Ga0501221_095987 Ga0501221_095987_80_667 195
10 3300049659 Ga0501214_018486 Ga0501214_018486_15_605 196
11 3300035724 Ga0373933_0601833 Ga0373933_0601833_102_695 197
12 3300009101 Ga0105247_10442315 Ga0105247_104423152 198
13 3300025907 Ga0207645_10310461 Ga0207645_103104612 198
14 3300009147 Ga0114129_10437479 Ga0114129_104374792 209
15 3300050507 nmdc:mga05p37_267019_c1 nmdc:mga05p37_267019_c1_863_1558 209
16 3300050508 nmdc:mga09592_358176_c1 nmdc:mga09592_358176_c1_284_979 209
17 3300025935 Ga0207709_10336646 Ga0207709_103366462 212
18 3300009545 Ga0105237_10788957 Ga0105237_107889571 216
19 3300014325 Ga0163163_11197549 Ga0163163_111975491 222
20 3300035112 Ga0373932_0161566 Ga0373932_0161566_31_699 222
21 3300050515 nmdc:mga0a205_127947_c1 nmdc:mga0a205_127947_c1_1641_2309 222
22 3300005290 Ga0065712_10020674 Ga0065712_100206741 223
23 3300005293 Ga0065715_10096483 Ga0065715_100964831 223
24 3300005333 Ga0070677_10047661 Ga0070677_100476612 223
25 3300005364 Ga0070673_100026091 Ga0070673_1000260912 223
26 3300005441 Ga0070700_100095902 Ga0070700_1000959022 223
27 3300005444 Ga0070694_100131752 Ga0070694_1001317522 223
28 3300005549 Ga0070704_100115126 Ga0070704_1001151262 223
29 3300006880 Ga0075429_100436656 Ga0075429_1004366561 223
30 3300009094 Ga0111539_10010931 Ga0111539_100109316 223
31 3300009147 Ga0114129_10179894 Ga0114129_101798943 223
32 3300013308 Ga0157375_10152911 Ga0157375_101529112 223
33 3300014326 Ga0157380_10020803 Ga0157380_100208032 223
34 3300031548 Ga0307408_100156783 Ga0307408_1001567832 223
35 3300031824 Ga0307413_10370021 Ga0307413_103700212 223
36 3300031852 Ga0307410_10341972 Ga0307410_103419722 223
37 3300031911 Ga0307412_10210116 Ga0307412_102101162 223
38 3300032002 Ga0307416_100395502 Ga0307416_1003955022 223
39 3300032126 Ga0307415_100308852 Ga0307415_1003088522 223
40 3300049582 Ga0501048_0628052 Ga0501048_0628052_66_743 223
41 3300049593 Ga0501077_0161271 Ga0501077_0161271_436_1110 223
42 3300049741 Ga0501079_0334507 Ga0501079_0334507_53_748 223
43 3300049767 Ga0501270_002776 Ga0501270_002776_871_1554 223
44 3300050508 nmdc:mga09592_134585_c1 nmdc:mga09592_134585_c1_327_998 223
45 3300050508 nmdc:mga09592_358529_c1 nmdc:mga09592_358529_c1_564_1241 223
46 3300050509 nmdc:mga0qj67_177707_c1 nmdc:mga0qj67_177707_c1_862_1539 223
47 3300050510 nmdc:mga06r32_91925_c1 nmdc:mga06r32_91925_c1_548_1225 223
48 3300050511 nmdc:mga08y16_63802_c1 nmdc:mga08y16_63802_c1_975_1670 223
49 3300054114 Ga0501084_0467671 Ga0501084_0467671_63_758 223
50 3300005364 Ga0070673_100353345 Ga0070673_1003533451 224
51 3300005436 Ga0070713_100078868 Ga0070713_1000788683 224
52 3300005457 Ga0070662_100410088 Ga0070662_1004100881 224
53 3300005471 Ga0070698_100027692 Ga0070698_1000276922 224
54 3300005518 Ga0070699_100249942 Ga0070699_1002499422 224
55 3300005518 Ga0070699_100281295 Ga0070699_1002812952 224
56 3300005545 Ga0070695_100489895 Ga0070695_1004898952 224
57 3300005577 Ga0068857_100222815 Ga0068857_1002228152 224
58 3300006844 Ga0075428_100158877 Ga0075428_1001588771 224
59 3300006844 Ga0075428_100186373 Ga0075428_1001863734 224
60 3300006852 Ga0075433_10086425 Ga0075433_100864253 224
61 3300006852 Ga0075433_10254477 Ga0075433_102544772 224
62 3300006871 Ga0075434_100428093 Ga0075434_1004280931 224
63 3300006871 Ga0075434_100747112 Ga0075434_1007471121 224
64 3300007265 Ga0099794_10013356 Ga0099794_100133563 224
65 3300009093 Ga0105240_10023614 Ga0105240_100236143 224
66 3300009094 Ga0111539_10293769 Ga0111539_102937692 224
67 3300009147 Ga0114129_10023920 Ga0114129_100239208 224
68 3300009147 Ga0114129_10350631 Ga0114129_103506312 224
69 3300009147 Ga0114129_10450030 Ga0114129_104500302 224
70 3300009147 Ga0114129_10698277 Ga0114129_106982771 224
71 3300009147 Ga0114129_11713406 Ga0114129_117134061 224
72 3300013296 Ga0157374_10212114 Ga0157374_102121142 224
73 3300013297 Ga0157378_10007115 Ga0157378_100071153 224
74 3300025913 Ga0207695_10353696 Ga0207695_103536962 224
75 3300025928 Ga0207700_10164822 Ga0207700_101648222 224
76 3300026116 Ga0207674_10166499 Ga0207674_101664992 224
77 3300050507 nmdc:mga05p37_127046_c1 nmdc:mga05p37_127046_c1_1394_2068 224
78 3300050507 nmdc:mga05p37_237816_c1 nmdc:mga05p37_237816_c1_1464_2138 224
79 3300050507 nmdc:mga05p37_72020_c1 nmdc:mga05p37_72020_c1_2900_3574 224
80 3300050512 nmdc:mga0n895_801500_c1 nmdc:mga0n895_801500_c1_136_813 224
81 3300050514 nmdc:mga08x19_25213_c1 nmdc:mga08x19_25213_c1_2743_3417 224
82 3300050515 nmdc:mga0a205_154306_c1 nmdc:mga0a205_154306_c1_71_748 224
83 3300050515 nmdc:mga0a205_194545_c1 nmdc:mga0a205_194545_c1_906_1580 224
84 3300050515 nmdc:mga0a205_372533_c1 nmdc:mga0a205_372533_c1_543_1217 224
85 2162886012 MBSR1b_contig_12507348 MBSR1b_0264.00000610 225
86 2162886012 MBSR1b_contig_861221 MBSR1b_0240.00002710 225
87 3300000531 CNBas_1000895 CNBas_10008952 225
88 3300003203 JGI25406J46586_10001381 JGI25406J46586_1000138110 225
89 3300003320 rootH2_10172926 rootH2_101729262 225
90 3300003322 rootL2_10163588 rootL2_101635883 225
91 3300005290 Ga0065712_10033281 Ga0065712_100332812 225
92 3300005290 Ga0065712_10070138 Ga0065712_100701385 225
93 3300005290 Ga0065712_10119890 Ga0065712_101198902 225
94 3300005293 Ga0065715_10002697 Ga0065715_100026975 225
95 3300005293 Ga0065715_10007206 Ga0065715_100072064 225
96 3300005293 Ga0065715_10008548 Ga0065715_100085482 225
97 3300005293 Ga0065715_10312783 Ga0065715_103127832 225
98 3300005328 Ga0070676_10085425 Ga0070676_100854251 225
99 3300005331 Ga0070670_100213142 Ga0070670_1002131422 225
100 3300005331 Ga0070670_100382508 Ga0070670_1003825082 225
101 3300005334 Ga0068869_100147918 Ga0068869_1001479182 225
102 3300005334 Ga0068869_100696073 Ga0068869_1006960731 225
103 3300005335 Ga0070666_10312883 Ga0070666_103128832 225
104 3300005337 Ga0070682_100174645 Ga0070682_1001746452 225
105 3300005340 Ga0070689_100268565 Ga0070689_1002685652 225
106 3300005341 Ga0070691_10172583 Ga0070691_101725831 225
107 3300005343 Ga0070687_100168114 Ga0070687_1001681142 225
108 3300005345 Ga0070692_10083253 Ga0070692_100832532 225
109 3300005354 Ga0070675_100397908 Ga0070675_1003979082 225
110 3300005355 Ga0070671_100032832 Ga0070671_1000328322 225
111 3300005355 Ga0070671_100037725 Ga0070671_1000377252 225
112 3300005355 Ga0070671_100263532 Ga0070671_1002635321 225
113 3300005365 Ga0070688_100364704 Ga0070688_1003647041 225
114 3300005367 Ga0070667_100100947 Ga0070667_1001009472 225
115 3300005438 Ga0070701_10250657 Ga0070701_102506571 225
116 3300005438 Ga0070701_10436917 Ga0070701_104369171 225
117 3300005440 Ga0070705_100000368 Ga0070705_1000003686 225
118 3300005440 Ga0070705_100249677 Ga0070705_1002496772 225
119 3300005441 Ga0070700_100013213 Ga0070700_1000132135 225
120 3300005441 Ga0070700_100694944 Ga0070700_1006949441 225
121 3300005444 Ga0070694_100020234 Ga0070694_1000202342 225
122 3300005444 Ga0070694_100287873 Ga0070694_1002878732 225
123 3300005444 Ga0070694_100354343 Ga0070694_1003543431 225
124 3300005444 Ga0070694_100438551 Ga0070694_1004385511 225
125 3300005456 Ga0070678_100187309 Ga0070678_1001873091 225
126 3300005458 Ga0070681_10339607 Ga0070681_103396071 225
127 3300005459 Ga0068867_100037909 Ga0068867_1000379092 225
128 3300005459 Ga0068867_100098675 Ga0068867_1000986751 225
129 3300005466 Ga0070685_10037095 Ga0070685_100370952 225
130 3300005467 Ga0070706_100043717 Ga0070706_1000437174 225
131 3300005468 Ga0070707_100953792 Ga0070707_1009537921 225
132 3300005471 Ga0070698_100114842 Ga0070698_1001148421 225
133 3300005471 Ga0070698_100193181 Ga0070698_1001931812 225
134 3300005544 Ga0070686_100046512 Ga0070686_1000465122 225
135 3300005545 Ga0070695_100017896 Ga0070695_1000178964 225
136 3300005545 Ga0070695_100075956 Ga0070695_1000759562 225
137 3300005545 Ga0070695_100753275 Ga0070695_1007532751 225
138 3300005546 Ga0070696_100202370 Ga0070696_1002023701 225
139 3300005548 Ga0070665_100191359 Ga0070665_1001913592 225
140 3300005549 Ga0070704_100622348 Ga0070704_1006223482 225
141 3300005549 Ga0070704_100638916 Ga0070704_1006389161 225
142 3300005564 Ga0070664_101128494 Ga0070664_1011284941 225
143 3300005577 Ga0068857_100479290 Ga0068857_1004792902 225
144 3300005578 Ga0068854_100003245 Ga0068854_10000324511 225
145 3300005578 Ga0068854_100112987 Ga0068854_1001129872 225
146 3300005617 Ga0068859_100020685 Ga0068859_1000206853 225
147 3300005617 Ga0068859_100065167 Ga0068859_1000651673 225
148 3300005617 Ga0068859_100068120 Ga0068859_1000681204 225
149 3300005617 Ga0068859_100188338 Ga0068859_1001883381 225
150 3300005617 Ga0068859_100596752 Ga0068859_1005967522 225
151 3300005617 Ga0068859_101253620 Ga0068859_1012536202 225
152 3300005618 Ga0068864_100002893 Ga0068864_1000028933 225
153 3300005618 Ga0068864_100215603 Ga0068864_1002156032 225
154 3300005618 Ga0068864_100349589 Ga0068864_1003495892 225
155 3300005618 Ga0068864_100394262 Ga0068864_1003942622 225
156 3300005618 Ga0068864_100708199 Ga0068864_1007081992 225
157 3300005718 Ga0068866_10052944 Ga0068866_100529444 225
158 3300005718 Ga0068866_10623003 Ga0068866_106230031 225
159 3300005840 Ga0068870_10132226 Ga0068870_101322262 225
160 3300005841 Ga0068863_100319893 Ga0068863_1003198931 225
161 3300005841 Ga0068863_100679037 Ga0068863_1006790372 225
162 3300005842 Ga0068858_100112189 Ga0068858_1001121892 225
163 3300005842 Ga0068858_100114869 Ga0068858_1001148694 225
164 3300005842 Ga0068858_100168704 Ga0068858_1001687043 225
165 3300005842 Ga0068858_100196492 Ga0068858_1001964922 225
166 3300005842 Ga0068858_100272704 Ga0068858_1002727041 225
167 3300005843 Ga0068860_100289765 Ga0068860_1002897652 225
168 3300005843 Ga0068860_100532424 Ga0068860_1005324242 225
169 3300005843 Ga0068860_100555280 Ga0068860_1005552802 225
170 3300005844 Ga0068862_100085625 Ga0068862_1000856252 225
171 3300005983 Ga0081540_1090277 Ga0081540_10902772 225
172 3300005985 Ga0081539_10000056 Ga0081539_10000056163 225
173 3300005985 Ga0081539_10000281 Ga0081539_1000028175 225
174 3300005985 Ga0081539_10105896 Ga0081539_101058961 225
175 3300006173 Ga0070716_100045338 Ga0070716_1000453381 225
176 3300006237 Ga0097621_100003746 Ga0097621_1000037462 225
177 3300006237 Ga0097621_100024026 Ga0097621_1000240264 225
178 3300006237 Ga0097621_100875206 Ga0097621_1008752062 225
179 3300006358 Ga0068871_100005511 Ga0068871_1000055114 225
180 3300006358 Ga0068871_100022221 Ga0068871_1000222212 225
181 3300006358 Ga0068871_100199283 Ga0068871_1001992833 225
182 3300006844 Ga0075428_100002943 Ga0075428_1000029437 225
183 3300006844 Ga0075428_100015903 Ga0075428_1000159033 225
184 3300006844 Ga0075428_100045420 Ga0075428_1000454205 225
185 3300006846 Ga0075430_100136978 Ga0075430_1001369782 225
186 3300006847 Ga0075431_100074862 Ga0075431_1000748623 225
187 3300006852 Ga0075433_10014257 Ga0075433_100142573 225
188 3300006852 Ga0075433_10614861 Ga0075433_106148612 225
189 3300006871 Ga0075434_100190007 Ga0075434_1001900073 225
190 3300006880 Ga0075429_100044176 Ga0075429_1000441763 225
191 3300006931 Ga0097620_100020685 Ga0097620_1000206853 225
192 3300006931 Ga0097620_100065169 Ga0097620_1000651694 225
193 3300006931 Ga0097620_100068121 Ga0097620_1000681212 225
194 3300006931 Ga0097620_100188347 Ga0097620_1001883471 225
195 3300006931 Ga0097620_100596764 Ga0097620_1005967642 225
196 3300006931 Ga0097620_101253699 Ga0097620_1012536992 225
197 3300007076 Ga0075435_100119463 Ga0075435_1001194631 225
198 3300009093 Ga0105240_10321750 Ga0105240_103217502 225
199 3300009094 Ga0111539_10033292 Ga0111539_100332926 225
200 3300009094 Ga0111539_10189092 Ga0111539_101890922 225
201 3300009094 Ga0111539_10904849 Ga0111539_109048491 225
202 3300009098 Ga0105245_10016130 Ga0105245_100161307 225
203 3300009147 Ga0114129_10000386 Ga0114129_1000038612 225
204 3300009147 Ga0114129_10001678 Ga0114129_1000167824 225
205 3300009147 Ga0114129_10017547 Ga0114129_100175474 225
206 3300009147 Ga0114129_10035104 Ga0114129_100351043 225
207 3300009147 Ga0114129_10056371 Ga0114129_100563716 225
208 3300009147 Ga0114129_10222450 Ga0114129_102224504 225
209 3300009147 Ga0114129_10499859 Ga0114129_104998592 225
210 3300009148 Ga0105243_10011061 Ga0105243_100110611 225
211 3300009148 Ga0105243_10012616 Ga0105243_100126161 225
212 3300009148 Ga0105243_10666150 Ga0105243_106661501 225
213 3300009174 Ga0105241_10095634 Ga0105241_100956342 225
214 3300009174 Ga0105241_10241519 Ga0105241_102415192 225
215 3300009174 Ga0105241_10734808 Ga0105241_107348081 225
216 3300009176 Ga0105242_10019725 Ga0105242_100197252 225
217 3300009176 Ga0105242_10403887 Ga0105242_104038872 225
218 3300009176 Ga0105242_10637219 Ga0105242_106372192 225
219 3300009177 Ga0105248_10002454 Ga0105248_100024546 225
220 3300009177 Ga0105248_10514888 Ga0105248_105148881 225
221 3300009177 Ga0105248_10527239 Ga0105248_105272392 225
222 3300009177 Ga0105248_10697787 Ga0105248_106977872 225
223 3300009545 Ga0105237_10388186 Ga0105237_103881862 225
224 3300009551 Ga0105238_10005709 Ga0105238_100057091 225
225 3300009551 Ga0105238_11207971 Ga0105238_112079711 225
226 3300009553 Ga0105249_10014928 Ga0105249_100149282 225
227 3300009553 Ga0105249_10038036 Ga0105249_100380365 225
228 3300009553 Ga0105249_10835623 Ga0105249_108356231 225
229 3300011119 Ga0105246_10135558 Ga0105246_101355583 225
230 3300011119 Ga0105246_10391150 Ga0105246_103911502 225
231 3300013100 Ga0157373_10038585 Ga0157373_100385852 225
232 3300013296 Ga0157374_10734099 Ga0157374_107340991 225
233 3300013297 Ga0157378_10366173 Ga0157378_103661731 225
234 3300013306 Ga0163162_10004933 Ga0163162_100049332 225
235 3300013306 Ga0163162_10012377 Ga0163162_100123777 225
236 3300013306 Ga0163162_10166972 Ga0163162_101669722 225
237 3300013306 Ga0163162_10451757 Ga0163162_104517572 225
238 3300013306 Ga0163162_10633681 Ga0163162_106336812 225
239 3300013307 Ga0157372_10072507 Ga0157372_100725072 225
240 3300013307 Ga0157372_10177364 Ga0157372_101773642 225
241 3300013307 Ga0157372_10672076 Ga0157372_106720762 225
242 3300013308 Ga0157375_10035396 Ga0157375_100353966 225
243 3300013308 Ga0157375_10041345 Ga0157375_100413455 225
244 3300013308 Ga0157375_10308040 Ga0157375_103080402 225
245 3300013308 Ga0157375_10559813 Ga0157375_105598131 225
246 3300014325 Ga0163163_10006595 Ga0163163_100065954 225
247 3300014325 Ga0163163_10028821 Ga0163163_100288215 225
248 3300014325 Ga0163163_10031143 Ga0163163_100311432 225
249 3300014325 Ga0163163_10835306 Ga0163163_108353061 225
250 3300014326 Ga0157380_10004089 Ga0157380_100040892 225
251 3300014326 Ga0157380_10273325 Ga0157380_102733252 225
252 3300014745 Ga0157377_10019907 Ga0157377_100199073 225
253 3300014968 Ga0157379_10684779 Ga0157379_106847792 225
254 3300014969 Ga0157376_10298428 Ga0157376_102984281 225
255 3300017792 Ga0163161_10019096 Ga0163161_100190963 225
256 3300025315 Ga0207697_10074744 Ga0207697_100747442 225
257 3300025315 Ga0207697_10107462 Ga0207697_101074622 225
258 3300025899 Ga0207642_10205311 Ga0207642_102053111 225
259 3300025904 Ga0207647_10040188 Ga0207647_100401884 225
260 3300025908 Ga0207643_10016467 Ga0207643_100164672 225
261 3300025910 Ga0207684_10193565 Ga0207684_101935653 225
262 3300025912 Ga0207707_10014000 Ga0207707_100140002 225
263 3300025913 Ga0207695_10103128 Ga0207695_101031282 225
264 3300025918 Ga0207662_10014215 Ga0207662_100142151 225
265 3300025918 Ga0207662_10281197 Ga0207662_102811972 225
266 3300025924 Ga0207694_10152651 Ga0207694_101526511 225
267 3300025925 Ga0207650_10290620 Ga0207650_102906202 225
268 3300025925 Ga0207650_10303422 Ga0207650_103034223 225
269 3300025927 Ga0207687_10959614 Ga0207687_109596141 225
270 3300025931 Ga0207644_10022739 Ga0207644_100227392 225
271 3300025931 Ga0207644_10452183 Ga0207644_104521831 225
272 3300025934 Ga0207686_10402947 Ga0207686_104029472 225
273 3300025936 Ga0207670_10146827 Ga0207670_101468272 225
274 3300025938 Ga0207704_10108882 Ga0207704_101088822 225
275 3300025938 Ga0207704_10121530 Ga0207704_101215303 225
276 3300025939 Ga0207665_10027591 Ga0207665_100275914 225
277 3300025940 Ga0207691_10014937 Ga0207691_100149374 225
278 3300025941 Ga0207711_10185768 Ga0207711_101857681 225
279 3300025941 Ga0207711_10450532 Ga0207711_104505321 225
280 3300025941 Ga0207711_10658894 Ga0207711_106588941 225
281 3300025942 Ga0207689_10007209 Ga0207689_100072092 225
282 3300025942 Ga0207689_10520419 Ga0207689_105204192 225
283 3300025942 Ga0207689_10698836 Ga0207689_106988361 225
284 3300025945 Ga0207679_10056252 Ga0207679_100562522 225
285 3300025961 Ga0207712_10009655 Ga0207712_100096553 225
286 3300025961 Ga0207712_10562418 Ga0207712_105624182 225
287 3300026023 Ga0207677_10117725 Ga0207677_101177251 225
288 3300026035 Ga0207703_10072629 Ga0207703_100726292 225
289 3300026035 Ga0207703_10079358 Ga0207703_100793582 225
290 3300026035 Ga0207703_10086659 Ga0207703_100866592 225
291 3300026035 Ga0207703_10556742 Ga0207703_105567421 225
292 3300026035 Ga0207703_10829930 Ga0207703_108299301 225
293 3300026035 Ga0207703_11179057 Ga0207703_111790571 225
294 3300026041 Ga0207639_10259143 Ga0207639_102591432 225
295 3300026075 Ga0207708_10058116 Ga0207708_100581162 225
296 3300026088 Ga0207641_10776395 Ga0207641_107763951 225
297 3300026089 Ga0207648_10023843 Ga0207648_100238436 225
298 3300026089 Ga0207648_10130504 Ga0207648_101305042 225
299 3300026089 Ga0207648_10929772 Ga0207648_109297722 225
300 3300026095 Ga0207676_10104050 Ga0207676_101040502 225
301 3300026095 Ga0207676_10111206 Ga0207676_101112064 225
302 3300026095 Ga0207676_10932332 Ga0207676_109323322 225
303 3300026116 Ga0207674_10224987 Ga0207674_102249873 225
304 3300026118 Ga0207675_100100814 Ga0207675_1001008143 225
305 3300026118 Ga0207675_100417195 Ga0207675_1004171952 225
306 3300026121 Ga0207683_10153575 Ga0207683_101535753 225
307 3300026142 Ga0207698_10542023 Ga0207698_105420232 225
308 3300027907 Ga0207428_10348799 Ga0207428_103487992 225
309 3300028380 Ga0268265_10144734 Ga0268265_101447342 225
310 3300028381 Ga0268264_10512587 Ga0268264_105125871 225
311 3300028381 Ga0268264_10532175 Ga0268264_105321752 225
312 3300028381 Ga0268264_10664631 Ga0268264_106646311 225
313 3300031548 Ga0307408_100042759 Ga0307408_1000427592 225
314 3300031731 Ga0307405_10043594 Ga0307405_100435944 225
315 3300031731 Ga0307405_10228570 Ga0307405_102285702 225
316 3300031852 Ga0307410_10357277 Ga0307410_103572771 225
317 3300031911 Ga0307412_10018148 Ga0307412_100181484 225
318 3300031995 Ga0307409_100060923 Ga0307409_1000609232 225
319 3300031995 Ga0307409_100143569 Ga0307409_1001435692 225
320 3300031995 Ga0307409_100219397 Ga0307409_1002193972 225
321 3300032002 Ga0307416_100075140 Ga0307416_1000751402 225
322 3300036401 Ga0373937_0095683 Ga0373937_0095683_1699_2376 225
323 3300037466 Ga0395898_0206242 Ga0395898_0206242_261_938 225
324 3300042014 Ga0439457_044097 Ga0439457_044097_239_916 225
325 3300045976 Ga0466967_0320024 Ga0466967_0320024_118_795 225
326 3300048907 Ga0496104_0628588 Ga0496104_0628588_85_762 225
327 3300048909 Ga0496106_0441841 Ga0496106_0441841_279_956 225
328 3300048915 Ga0496112_0120722 Ga0496112_0120722_84_761 225
329 3300048915 Ga0496112_0291866 Ga0496112_0291866_491_1168 225
330 3300049649 Ga0501198_002365 Ga0501198_002365_121_798 225
331 3300049652 Ga0501202_046889 Ga0501202_046889_156_833 225
332 3300049660 Ga0501216_002572 Ga0501216_002572_108_785 225
333 3300049661 Ga0501217_002028 Ga0501217_002028_149_826 225
334 3300049708 Ga0501245_009124 Ga0501245_009124_577_1254 225
335 3300049744 Ga0501083_0024462 Ga0501083_0024462_1621_2298 225
336 3300049765 Ga0501268_024355 Ga0501268_024355_262_939 225
337 3300050507 nmdc:mga05p37_101851_c1 nmdc:mga05p37_101851_c1_640_1320 225
338 3300050507 nmdc:mga05p37_101_c1 nmdc:mga05p37_101_c1_70897_71577 225
339 3300050507 nmdc:mga05p37_15892_c1 nmdc:mga05p37_15892_c1_378_1127 225
340 3300050507 nmdc:mga05p37_19220_c1 nmdc:mga05p37_19220_c1_1086_1763 225
341 3300050507 nmdc:mga05p37_815338_c1 nmdc:mga05p37_815338_c1_267_944 225
342 3300050508 nmdc:mga09592_38797_c1 nmdc:mga09592_38797_c1_924_1601 225
343 3300050510 nmdc:mga06r32_41436_c1 nmdc:mga06r32_41436_c1_3636_4313 225
344 3300050510 nmdc:mga06r32_450728_c1 nmdc:mga06r32_450728_c1_236_913 225
345 3300050511 nmdc:mga08y16_23608_c1 nmdc:mga08y16_23608_c1_3876_4556 225
346 3300050511 nmdc:mga08y16_71647_c1 nmdc:mga08y16_71647_c1_1880_2557 225
347 3300050514 nmdc:mga08x19_7604_c1 nmdc:mga08x19_7604_c1_3993_4682 225
348 2162886007 SwRhRL2b_contig_3433698 SwRhRL2b_0105.00006240 226
349 3300000532 CNAas_1000325 CNAas_10003252 226
350 3300002459 JGI24751J29686_10000329 JGI24751J29686_100003292 226
351 3300003203 JGI25406J46586_10002828 JGI25406J46586_100028288 226
352 3300005288 Ga0065714_10064452 Ga0065714_100644525 226
353 3300005289 Ga0065704_10001026 Ga0065704_100010263 226
354 3300005290 Ga0065712_10000126 Ga0065712_100001265 226
355 3300005293 Ga0065715_10126569 Ga0065715_101265692 226
356 3300005295 Ga0065707_10000828 Ga0065707_100008283 226
357 3300005295 Ga0065707_10198880 Ga0065707_101988802 226
358 3300005331 Ga0070670_100146176 Ga0070670_1001461762 226
359 3300005334 Ga0068869_100119920 Ga0068869_1001199203 226
360 3300005334 Ga0068869_100222847 Ga0068869_1002228472 226
361 3300005340 Ga0070689_100000072 Ga0070689_10000007217 226
362 3300005340 Ga0070689_100271320 Ga0070689_1002713202 226
363 3300005406 Ga0070703_10005349 Ga0070703_100053494 226
364 3300005438 Ga0070701_10031897 Ga0070701_100318972 226
365 3300005438 Ga0070701_10095739 Ga0070701_100957393 226
366 3300005440 Ga0070705_100122265 Ga0070705_1001222652 226
367 3300005441 Ga0070700_100000005 Ga0070700_100000005132 226
368 3300005441 Ga0070700_100039925 Ga0070700_1000399251 226
369 3300005444 Ga0070694_100039216 Ga0070694_1000392164 226
370 3300005444 Ga0070694_100149841 Ga0070694_1001498413 226
371 3300005458 Ga0070681_10005713 Ga0070681_100057132 226
372 3300005467 Ga0070706_100000905 Ga0070706_10000090516 226
373 3300005468 Ga0070707_100245955 Ga0070707_1002459552 226
374 3300005471 Ga0070698_100022602 Ga0070698_1000226023 226
375 3300005471 Ga0070698_100045623 Ga0070698_1000456232 226
376 3300005518 Ga0070699_100001460 Ga0070699_10000146011 226
377 3300005518 Ga0070699_100018881 Ga0070699_1000188812 226
378 3300005518 Ga0070699_100052146 Ga0070699_1000521463 226
379 3300005530 Ga0070679_100282305 Ga0070679_1002823052 226
380 3300005536 Ga0070697_100094626 Ga0070697_1000946261 226
381 3300005536 Ga0070697_100333955 Ga0070697_1003339552 226
382 3300005544 Ga0070686_100426203 Ga0070686_1004262032 226
383 3300005545 Ga0070695_100239103 Ga0070695_1002391032 226
384 3300005545 Ga0070695_100368552 Ga0070695_1003685521 226
385 3300005546 Ga0070696_100134968 Ga0070696_1001349683 226
386 3300005547 Ga0070693_100004080 Ga0070693_1000040801 226
387 3300005547 Ga0070693_100029258 Ga0070693_1000292583 226
388 3300005549 Ga0070704_100083619 Ga0070704_1000836193 226
389 3300005549 Ga0070704_100276727 Ga0070704_1002767272 226
390 3300005578 Ga0068854_100299880 Ga0068854_1002998802 226
391 3300005615 Ga0070702_100688688 Ga0070702_1006886881 226
392 3300005616 Ga0068852_100736267 Ga0068852_1007362672 226
393 3300005617 Ga0068859_100008723 Ga0068859_1000087237 226
394 3300005617 Ga0068859_100155535 Ga0068859_1001555352 226
395 3300005617 Ga0068859_100357853 Ga0068859_1003578532 226
396 3300005617 Ga0068859_100858159 Ga0068859_1008581591 226
397 3300005618 Ga0068864_100078779 Ga0068864_1000787792 226
398 3300005719 Ga0068861_100001848 Ga0068861_1000018482 226
399 3300005834 Ga0068851_10228347 Ga0068851_102283472 226
400 3300005840 Ga0068870_10097936 Ga0068870_100979363 226
401 3300005841 Ga0068863_100047038 Ga0068863_1000470382 226
402 3300005841 Ga0068863_100274515 Ga0068863_1002745152 226
403 3300005841 Ga0068863_100313257 Ga0068863_1003132571 226
404 3300005841 Ga0068863_100351743 Ga0068863_1003517432 226
405 3300005841 Ga0068863_100424570 Ga0068863_1004245702 226
406 3300005842 Ga0068858_100121850 Ga0068858_1001218502 226
407 3300005842 Ga0068858_100384735 Ga0068858_1003847352 226
408 3300005843 Ga0068860_100060232 Ga0068860_1000602321 226
409 3300005985 Ga0081539_10001024 Ga0081539_1000102415 226
410 3300005985 Ga0081539_10012860 Ga0081539_100128602 226
411 3300006847 Ga0075431_100047836 Ga0075431_1000478362 226
412 3300006852 Ga0075433_10028656 Ga0075433_100286563 226
413 3300006852 Ga0075433_10029785 Ga0075433_100297852 226
414 3300006852 Ga0075433_10163150 Ga0075433_101631502 226
415 3300006871 Ga0075434_100044322 Ga0075434_1000443222 226
416 3300006880 Ga0075429_100068229 Ga0075429_1000682292 226
417 3300006931 Ga0097620_100008723 Ga0097620_1000087234 226
418 3300006931 Ga0097620_100048082 Ga0097620_1000480822 226
419 3300006931 Ga0097620_100155545 Ga0097620_1001555452 226
420 3300006931 Ga0097620_100357828 Ga0097620_1003578282 226
421 3300006931 Ga0097620_100391461 Ga0097620_1003914612 226
422 3300006931 Ga0097620_100858139 Ga0097620_1008581391 226
423 3300007076 Ga0075435_100178641 Ga0075435_1001786412 226
424 3300009093 Ga0105240_10080187 Ga0105240_100801872 226
425 3300009094 Ga0111539_10007731 Ga0111539_100077319 226
426 3300009094 Ga0111539_10418210 Ga0111539_104182102 226
427 3300009101 Ga0105247_10086185 Ga0105247_100861853 226
428 3300009147 Ga0114129_10116828 Ga0114129_101168282 226
429 3300009147 Ga0114129_10412598 Ga0114129_104125982 226
430 3300009174 Ga0105241_10382176 Ga0105241_103821762 226
431 3300009174 Ga0105241_10534338 Ga0105241_105343382 226
432 3300009176 Ga0105242_10458701 Ga0105242_104587011 226
433 3300009177 Ga0105248_10002076 Ga0105248_100020766 226
434 3300009177 Ga0105248_10465440 Ga0105248_104654403 226
435 3300009545 Ga0105237_10178454 Ga0105237_101784542 226
436 3300013100 Ga0157373_10045912 Ga0157373_100459122 226
437 3300013307 Ga0157372_10233928 Ga0157372_102339282 226
438 3300014325 Ga0163163_10000241 Ga0163163_100002412 226
439 3300014325 Ga0163163_10007667 Ga0163163_100076674 226
440 3300014325 Ga0163163_11145764 Ga0163163_111457641 226
441 3300014326 Ga0157380_10903834 Ga0157380_109038341 226
442 3300014745 Ga0157377_10043397 Ga0157377_100433972 226
443 3300014968 Ga0157379_10193245 Ga0157379_101932453 226
444 3300025315 Ga0207697_10057503 Ga0207697_100575032 226
445 3300025321 Ga0207656_10163700 Ga0207656_101637002 226
446 3300025885 Ga0207653_10008427 Ga0207653_100084272 226
447 3300025899 Ga0207642_10091307 Ga0207642_100913072 226
448 3300025900 Ga0207710_10000529 Ga0207710_1000052913 226
449 3300025908 Ga0207643_10010832 Ga0207643_100108323 226
450 3300025908 Ga0207643_10246273 Ga0207643_102462732 226
451 3300025910 Ga0207684_10000520 Ga0207684_1000052019 226
452 3300025911 Ga0207654_10307832 Ga0207654_103078323 226
453 3300025912 Ga0207707_10445018 Ga0207707_104450181 226
454 3300025914 Ga0207671_10043832 Ga0207671_100438322 226
455 3300025914 Ga0207671_10177904 Ga0207671_101779042 226
456 3300025917 Ga0207660_10431747 Ga0207660_104317472 226
457 3300025918 Ga0207662_10349483 Ga0207662_103494831 226
458 3300025921 Ga0207652_10405109 Ga0207652_104051092 226
459 3300025922 Ga0207646_10000128 Ga0207646_1000012890 226
460 3300025922 Ga0207646_10034005 Ga0207646_100340053 226
461 3300025922 Ga0207646_10166838 Ga0207646_101668382 226
462 3300025923 Ga0207681_10068631 Ga0207681_100686312 226
463 3300025924 Ga0207694_10004008 Ga0207694_1000400812 226
464 3300025925 Ga0207650_10000009 Ga0207650_10000009151 226
465 3300025936 Ga0207670_10026612 Ga0207670_100266123 226
466 3300025936 Ga0207670_10587736 Ga0207670_105877362 226
467 3300025941 Ga0207711_10008113 Ga0207711_100081137 226
468 3300025941 Ga0207711_10322617 Ga0207711_103226172 226
469 3300025942 Ga0207689_10187235 Ga0207689_101872352 226
470 3300025942 Ga0207689_10265424 Ga0207689_102654242 226
471 3300025960 Ga0207651_10145476 Ga0207651_101454762 226
472 3300025981 Ga0207640_10016956 Ga0207640_100169562 226
473 3300025981 Ga0207640_10135703 Ga0207640_101357033 226
474 3300025986 Ga0207658_10106351 Ga0207658_101063512 226
475 3300026035 Ga0207703_10196591 Ga0207703_101965913 226
476 3300026041 Ga0207639_10577705 Ga0207639_105777052 226
477 3300026075 Ga0207708_10000017 Ga0207708_10000017111 226
478 3300026088 Ga0207641_10125889 Ga0207641_101258892 226
479 3300026088 Ga0207641_10426174 Ga0207641_104261742 226
480 3300026088 Ga0207641_10521749 Ga0207641_105217493 226
481 3300026089 Ga0207648_10249173 Ga0207648_102491732 226
482 3300026089 Ga0207648_10290497 Ga0207648_102904972 226
483 3300026095 Ga0207676_10058419 Ga0207676_100584193 226
484 3300026095 Ga0207676_10107655 Ga0207676_101076552 226
485 3300026095 Ga0207676_10137077 Ga0207676_101370772 226
486 3300026095 Ga0207676_10595471 Ga0207676_105954712 226
487 3300026095 Ga0207676_10597252 Ga0207676_105972522 226
488 3300026095 Ga0207676_10698862 Ga0207676_106988621 226
489 3300026118 Ga0207675_100004402 Ga0207675_1000044022 226
490 3300026142 Ga0207698_10071353 Ga0207698_100713534 226
491 3300026142 Ga0207698_10360396 Ga0207698_103603962 226
492 3300028380 Ga0268265_10306453 Ga0268265_103064532 226
493 3300028381 Ga0268264_10855332 Ga0268264_108553322 226
494 3300031548 Ga0307408_100006178 Ga0307408_1000061785 226
495 3300031548 Ga0307408_100098497 Ga0307408_1000984972 226
496 3300031731 Ga0307405_10004641 Ga0307405_100046414 226
497 3300031852 Ga0307410_10069655 Ga0307410_100696552 226
498 3300031901 Ga0307406_10000720 Ga0307406_100007205 226
499 3300031903 Ga0307407_10330832 Ga0307407_103308321 226
500 3300031911 Ga0307412_10012138 Ga0307412_100121387 226
501 3300032004 Ga0307414_10021134 Ga0307414_100211347 226
502 3300032005 Ga0307411_10037911 Ga0307411_100379112 226
503 3300032126 Ga0307415_100088855 Ga0307415_1000888552 226
504 3300035092 Ga0373952_0047472 Ga0373952_0047472_205_885 226
505 3300035121 Ga0373960_0055006 Ga0373960_0055006_255_935 226
506 3300037418 Ga0395900_0048967 Ga0395900_0048967_729_1409 226
507 3300038443 Ga0395901_0398604 Ga0395901_0398604_267_947 226
508 3300042005 Ga0439448_0139057 Ga0439448_0139057_50_730 226
509 3300042144 Ga0450889_003289 Ga0450889_003289_354_1034 226
510 3300045976 Ga0466967_0396115 Ga0466967_0396115_109_789 226
511 3300048905 Ga0496102_0018502 Ga0496102_0018502_5234_5935 226
512 3300048907 Ga0496104_0383001 Ga0496104_0383001_534_1235 226
513 3300048911 Ga0496108_0233021 Ga0496108_0233021_32_733 226
514 3300048915 Ga0496112_0102304 Ga0496112_0102304_934_1614 226
515 3300049514 Ga0501291_041944 Ga0501291_041944_20_700 226
516 3300049649 Ga0501198_000621 Ga0501198_000621_1778_2458 226
517 3300049661 Ga0501217_001210 Ga0501217_001210_3264_3944 226
518 3300049663 Ga0501223_000855 Ga0501223_000855_3239_3919 226
519 3300049663 Ga0501223_009006 Ga0501223_009006_739_1419 226
520 3300049665 Ga0501227_000381 Ga0501227_000381_3160_3840 226
521 3300049667 Ga0501230_003826 Ga0501230_003826_1139_1819 226
522 3300049668 Ga0501233_002731 Ga0501233_002731_1525_2205 226
523 3300049669 Ga0501235_000548 Ga0501235_000548_5630_6310 226
524 3300049673 Ga0501240_000136 Ga0501240_000136_2008_2688 226
525 3300049680 Ga0501250_015666 Ga0501250_015666_20_700 226
526 3300049683 Ga0501253_002493 Ga0501253_002493_97_777 226
527 3300049686 Ga0501257_004958 Ga0501257_004958_686_1366 226
528 3300049704 Ga0501221_004881 Ga0501221_004881_1509_2189 226
529 3300049705 Ga0501225_0000813 Ga0501225_0000813_3609_4289 226
530 3300049707 Ga0501234_000120 Ga0501234_000120_6476_7156 226
531 3300049853 Ga0501226_000367 Ga0501226_000367_5766_6446 226
532 3300050507 nmdc:mga05p37_231649_c1 nmdc:mga05p37_231649_c1_1490_2170 226
533 3300050507 nmdc:mga05p37_65590_c1 nmdc:mga05p37_65590_c1_2504_3184 226
534 3300050507 nmdc:mga05p37_806229_c1 nmdc:mga05p37_806229_c1_110_790 226
535 3300050511 nmdc:mga08y16_22040_c1 nmdc:mga08y16_22040_c1_2932_3612 226
536 3300050512 nmdc:mga0n895_299898_c1 nmdc:mga0n895_299898_c1_60_740 226
537 3300050512 nmdc:mga0n895_53598_c1 nmdc:mga0n895_53598_c1_230_910 226
538 3300050515 nmdc:mga0a205_43103_c1 nmdc:mga0a205_43103_c1_550_1230 226
539 3300050515 nmdc:mga0a205_48984_c1 nmdc:mga0a205_48984_c1_3082_3762 226
540 3300050515 nmdc:mga0a205_54423_c1 nmdc:mga0a205_54423_c1_768_1448 226
541 3300050515 nmdc:mga0a205_57361_c1 nmdc:mga0a205_57361_c1_598_1278 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

14

214

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.9265 5 225
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.9029 5 225
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.898 1 222
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.885 1 225
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.8824 5 225
ID Description Score Start End Superfamily
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8972 3 220 3.40.50.1820
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8957 2 224 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8833 16 224 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8818 1 225 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8814 1 222 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Q7RPM4-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9922 146 224 GO:0016787
AF-A0A2V8PCK0-F1-model_v4 Carboxymethylenebutenolidase 0.9857 149 224 GO:0016787
AF-A0A6L8GJE8-F1-model_v4 Dienelactone hydrolase family protein 0.984 92 224 GO:0016787
AF-A0A2V8Q4H5-F1-model_v4 Dienelactone hydrolase 0.9822 1 224 GO:0016787
AF-A0A1Q3MQA1-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9798 1 226 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.07 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map