F461360
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 541 | 224 | 541 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10788957|Ga0105237_107889571 |
| Length | 216 |
| Sequence | MGEMVQFPFAGGSTGGYLATPKQGNGPGVIVIQEWWGLVDHIKDVCDRFADEGFVALAPDLYHGKTAKSPDEAGKLMMAMRIDEAERDLSAAVQYLSTQDSTTSDKVGVVGFCMGGALSLYCVVFYGGHPKVKPDLPNLHAPVLGLYGEKDKGITPETVHKLERDVKALGKSIEVVIYPGADHAFFNDQRPQVYNAEAAADAWRRTIAFLREHLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 177 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 178 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 186 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 187 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 190 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 191 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 192 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 193 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 194 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 195 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 197 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 198 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 201 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 202 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 203 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 204 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 205 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 206 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 207 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 208 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 211 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 214 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 215 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 98.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3433698 | 2162886007 | Bacteria | 2192 |
| 2 | MBSR1b_contig_12507348 | 2162886012 | Bacteria | 1427 |
| 3 | MBSR1b_contig_861221 | 2162886012 | Bacteria | 1460 |
| 4 | CNBas_1000895 | 3300000531 | Unclassified | 1474 |
| 5 | CNAas_1000325 | 3300000532 | Unclassified | 4584 |
| 6 | JGI24751J29686_10000329 | 3300002459 | Bacteria | 17504 |
| 7 | JGI25406J46586_10001381 | 3300003203 | Bacteria | 11458 |
| 8 | JGI25406J46586_10002828 | 3300003203 | Bacteria | 8170 |
| 9 | rootH2_10172926 | 3300003320 | Unclassified | 1625 |
| 10 | rootL2_10163588 | 3300003322 | Bacteria | 1815 |
| 11 | Ga0065714_10064452 | 3300005288 | Bacteria | 75496 |
| 12 | Ga0065704_10001026 | 3300005289 | Bacteria | 13177 |
| 13 | Ga0065712_10000126 | 3300005290 | Bacteria | 75495 |
| 14 | Ga0065712_10020674 | 3300005290 | Bacteria | 1583 |
| 15 | Ga0065712_10033281 | 3300005290 | Bacteria | 1179 |
| 16 | Ga0065712_10070138 | 3300005290 | Bacteria | 6294 |
| 17 | Ga0065712_10119890 | 3300005290 | Bacteria | 1686 |
| 18 | Ga0065715_10002697 | 3300005293 | Bacteria | 5254 |
| 19 | Ga0065715_10007206 | 3300005293 | Bacteria | 3097 |
| 20 | Ga0065715_10008548 | 3300005293 | Bacteria | 3167 |
| 21 | Ga0065715_10096483 | 3300005293 | Bacteria | 3871 |
| 22 | Ga0065715_10126569 | 3300005293 | Unclassified | 2106 |
| 23 | Ga0065715_10312783 | 3300005293 | Unclassified | 1009 |
| 24 | Ga0065707_10000828 | 3300005295 | Bacteria | 12929 |
| 25 | Ga0065707_10198880 | 3300005295 | Bacteria | 1321 |
| 26 | Ga0070676_10085425 | 3300005328 | Bacteria | 1923 |
| 27 | Ga0070670_100146176 | 3300005331 | Bacteria | 2045 |
| 28 | Ga0070670_100213142 | 3300005331 | Unclassified | 1679 |
| 29 | Ga0070670_100382508 | 3300005331 | Bacteria | 1240 |
| 30 | Ga0070677_10047661 | 3300005333 | Bacteria | 1718 |
| 31 | Ga0068869_100119920 | 3300005334 | Bacteria | 2010 |
| 32 | Ga0068869_100147918 | 3300005334 | Unclassified | 1819 |
| 33 | Ga0068869_100222847 | 3300005334 | Unclassified | 1495 |
| 34 | Ga0068869_100696073 | 3300005334 | Unclassified | 866 |
| 35 | Ga0070666_10312883 | 3300005335 | Unclassified | 1119 |
| 36 | Ga0070682_100174645 | 3300005337 | Unclassified | 1496 |
| 37 | Ga0070689_100000072 | 3300005340 | Bacteria | 60316 |
| 38 | Ga0070689_100268565 | 3300005340 | Unclassified | 1412 |
| 39 | Ga0070689_100271320 | 3300005340 | Bacteria | 1405 |
| 40 | Ga0070691_10172583 | 3300005341 | Unclassified | 1121 |
| 41 | Ga0070687_100168114 | 3300005343 | Unclassified | 1303 |
| 42 | Ga0070692_10083253 | 3300005345 | Bacteria | 1727 |
| 43 | Ga0070675_100397908 | 3300005354 | Unclassified | 1228 |
| 44 | Ga0070671_100032832 | 3300005355 | Bacteria | 4290 |
| 45 | Ga0070671_100037725 | 3300005355 | Unclassified | 4008 |
| 46 | Ga0070671_100263532 | 3300005355 | Bacteria | 1465 |
| 47 | Ga0070673_100026091 | 3300005364 | Bacteria | 4310 |
| 48 | Ga0070673_100353345 | 3300005364 | Bacteria | 1305 |
| 49 | Ga0070688_100364704 | 3300005365 | Bacteria | 1061 |
| 50 | Ga0070667_100100947 | 3300005367 | Bacteria | 2492 |
| 51 | Ga0070703_10005349 | 3300005406 | Bacteria | 3586 |
| 52 | Ga0070713_100078868 | 3300005436 | Bacteria | 2804 |
| 53 | Ga0070701_10031897 | 3300005438 | Bacteria | 2618 |
| 54 | Ga0070701_10095739 | 3300005438 | Unclassified | 1635 |
| 55 | Ga0070701_10250657 | 3300005438 | Unclassified | 1069 |
| 56 | Ga0070701_10436917 | 3300005438 | Unclassified | 837 |
| 57 | Ga0070705_100000368 | 3300005440 | Bacteria | 26424 |
| 58 | Ga0070705_100122265 | 3300005440 | Bacteria | 1683 |
| 59 | Ga0070705_100249677 | 3300005440 | Unclassified | 1245 |
| 60 | Ga0070700_100000005 | 3300005441 | Bacteria | 233160 |
| 61 | Ga0070700_100013213 | 3300005441 | Bacteria | 4634 |
| 62 | Ga0070700_100039925 | 3300005441 | Bacteria | 2870 |
| 63 | Ga0070700_100095902 | 3300005441 | Bacteria | 1945 |
| 64 | Ga0070700_100694944 | 3300005441 | Unclassified | 808 |
| 65 | Ga0070694_100020234 | 3300005444 | Bacteria | 4240 |
| 66 | Ga0070694_100039216 | 3300005444 | Bacteria | 3152 |
| 67 | Ga0070694_100131752 | 3300005444 | Bacteria | 1807 |
| 68 | Ga0070694_100149841 | 3300005444 | Bacteria | 1703 |
| 69 | Ga0070694_100287873 | 3300005444 | Unclassified | 1255 |
| 70 | Ga0070694_100354343 | 3300005444 | Bacteria | 1138 |
| 71 | Ga0070694_100438551 | 3300005444 | Unclassified | 1029 |
| 72 | Ga0070678_100187309 | 3300005456 | Unclassified | 1699 |
| 73 | Ga0070662_100410088 | 3300005457 | Bacteria | 1119 |
| 74 | Ga0070681_10005713 | 3300005458 | Bacteria | 12025 |
| 75 | Ga0070681_10339607 | 3300005458 | Bacteria | 1412 |
| 76 | Ga0068867_100037909 | 3300005459 | Bacteria | 3506 |
| 77 | Ga0068867_100098675 | 3300005459 | Unclassified | 2228 |
| 78 | Ga0070685_10037095 | 3300005466 | Unclassified | 2759 |
| 79 | Ga0070706_100000905 | 3300005467 | Bacteria | 32470 |
| 80 | Ga0070706_100043717 | 3300005467 | Bacteria | 4139 |
| 81 | Ga0070707_100245955 | 3300005468 | Unclassified | 1741 |
| 82 | Ga0070707_100953792 | 3300005468 | Bacteria | 823 |
| 83 | Ga0070698_100022602 | 3300005471 | Bacteria | 6577 |
| 84 | Ga0070698_100027692 | 3300005471 | Bacteria | 5891 |
| 85 | Ga0070698_100045623 | 3300005471 | Bacteria | 4486 |
| 86 | Ga0070698_100114842 | 3300005471 | Bacteria | 2657 |
| 87 | Ga0070698_100193181 | 3300005471 | Unclassified | 1973 |
| 88 | Ga0070699_100001460 | 3300005518 | Bacteria | 21670 |
| 89 | Ga0070699_100018881 | 3300005518 | Bacteria | 5926 |
| 90 | Ga0070699_100052146 | 3300005518 | Bacteria | 3541 |
| 91 | Ga0070699_100249942 | 3300005518 | Unclassified | 1584 |
| 92 | Ga0070699_100281295 | 3300005518 | Bacteria | 1490 |
| 93 | Ga0070679_100282305 | 3300005530 | Bacteria | 1613 |
| 94 | Ga0070697_100094626 | 3300005536 | Bacteria | 2476 |
| 95 | Ga0070697_100333955 | 3300005536 | Unclassified | 1307 |
| 96 | Ga0070686_100046512 | 3300005544 | Unclassified | 2739 |
| 97 | Ga0070686_100426203 | 3300005544 | Bacteria | 1015 |
| 98 | Ga0070695_100017896 | 3300005545 | Bacteria | 4299 |
| 99 | Ga0070695_100075956 | 3300005545 | Bacteria | 2212 |
| 100 | Ga0070695_100239103 | 3300005545 | Unclassified | 1316 |
| 101 | Ga0070695_100368552 | 3300005545 | Bacteria | 1081 |
| 102 | Ga0070695_100489895 | 3300005545 | Unclassified | 949 |
| 103 | Ga0070695_100753275 | 3300005545 | Unclassified | 777 |
| 104 | Ga0070696_100134968 | 3300005546 | Unclassified | 1798 |
| 105 | Ga0070696_100202370 | 3300005546 | Bacteria | 1483 |
| 106 | Ga0070693_100004080 | 3300005547 | Bacteria | 6876 |
| 107 | Ga0070693_100029258 | 3300005547 | Bacteria | 3003 |
| 108 | Ga0070665_100191359 | 3300005548 | Bacteria | 2047 |
| 109 | Ga0070704_100083619 | 3300005549 | Bacteria | 2357 |
| 110 | Ga0070704_100115126 | 3300005549 | Bacteria | 2054 |
| 111 | Ga0070704_100276727 | 3300005549 | Bacteria | 1389 |
| 112 | Ga0070704_100622348 | 3300005549 | Unclassified | 951 |
| 113 | Ga0070704_100638916 | 3300005549 | Bacteria | 939 |
| 114 | Ga0070664_101128494 | 3300005564 | Bacteria | 739 |
| 115 | Ga0068857_100222815 | 3300005577 | Bacteria | 1723 |
| 116 | Ga0068857_100479290 | 3300005577 | Bacteria | 1166 |
| 117 | Ga0068854_100003245 | 3300005578 | Bacteria | 10138 |
| 118 | Ga0068854_100112987 | 3300005578 | Bacteria | 2051 |
| 119 | Ga0068854_100299880 | 3300005578 | Unclassified | 1300 |
| 120 | Ga0070702_100688688 | 3300005615 | Bacteria | 778 |
| 121 | Ga0068852_100736267 | 3300005616 | Unclassified | 997 |
| 122 | Ga0068859_100008723 | 3300005617 | Bacteria | 10242 |
| 123 | Ga0068859_100020685 | 3300005617 | Bacteria | 6604 |
| 124 | Ga0068859_100065167 | 3300005617 | Bacteria | 3677 |
| 125 | Ga0068859_100068120 | 3300005617 | Bacteria | 3594 |
| 126 | Ga0068859_100155535 | 3300005617 | Bacteria | 2363 |
| 127 | Ga0068859_100188338 | 3300005617 | Bacteria | 2147 |
| 128 | Ga0068859_100357853 | 3300005617 | Bacteria | 1555 |
| 129 | Ga0068859_100596752 | 3300005617 | Bacteria | 1197 |
| 130 | Ga0068859_100858159 | 3300005617 | Bacteria | 994 |
| 131 | Ga0068859_101253620 | 3300005617 | Unclassified | 817 |
| 132 | Ga0068864_100002893 | 3300005618 | Bacteria | 14185 |
| 133 | Ga0068864_100078779 | 3300005618 | Unclassified | 2884 |
| 134 | Ga0068864_100215603 | 3300005618 | Unclassified | 1769 |
| 135 | Ga0068864_100349589 | 3300005618 | Unclassified | 1394 |
| 136 | Ga0068864_100394262 | 3300005618 | Bacteria | 1314 |
| 137 | Ga0068864_100708199 | 3300005618 | Bacteria | 984 |
| 138 | Ga0068866_10052944 | 3300005718 | Bacteria | 2073 |
| 139 | Ga0068866_10623003 | 3300005718 | Bacteria | 731 |
| 140 | Ga0068861_100001848 | 3300005719 | Bacteria | 13617 |
| 141 | Ga0068851_10228347 | 3300005834 | Unclassified | 1048 |
| 142 | Ga0068870_10097936 | 3300005840 | Bacteria | 1651 |
| 143 | Ga0068870_10132226 | 3300005840 | Unclassified | 1451 |
| 144 | Ga0068863_100047038 | 3300005841 | Bacteria | 4094 |
| 145 | Ga0068863_100274515 | 3300005841 | Bacteria | 1632 |
| 146 | Ga0068863_100313257 | 3300005841 | Unclassified | 1524 |
| 147 | Ga0068863_100319893 | 3300005841 | Bacteria | 1507 |
| 148 | Ga0068863_100351743 | 3300005841 | Bacteria | 1435 |
| 149 | Ga0068863_100424570 | 3300005841 | Bacteria | 1303 |
| 150 | Ga0068863_100679037 | 3300005841 | Bacteria | 1023 |
| 151 | Ga0068858_100112189 | 3300005842 | Unclassified | 2546 |
| 152 | Ga0068858_100114869 | 3300005842 | Bacteria | 2515 |
| 153 | Ga0068858_100121850 | 3300005842 | Bacteria | 2439 |
| 154 | Ga0068858_100168704 | 3300005842 | Bacteria | 2063 |
| 155 | Ga0068858_100196492 | 3300005842 | Bacteria | 1906 |
| 156 | Ga0068858_100272704 | 3300005842 | Bacteria | 1610 |
| 157 | Ga0068858_100384735 | 3300005842 | Bacteria | 1347 |
| 158 | Ga0068860_100060232 | 3300005843 | Bacteria | 3608 |
| 159 | Ga0068860_100289765 | 3300005843 | Bacteria | 1602 |
| 160 | Ga0068860_100532424 | 3300005843 | Bacteria | 1175 |
| 161 | Ga0068860_100555280 | 3300005843 | Bacteria | 1151 |
| 162 | Ga0068862_100085625 | 3300005844 | Bacteria | 2739 |
| 163 | Ga0081540_1090277 | 3300005983 | Unclassified | 1349 |
| 164 | Ga0081539_10000056 | 3300005985 | Bacteria | 256522 |
| 165 | Ga0081539_10000281 | 3300005985 | Bacteria | 114795 |
| 166 | Ga0081539_10001024 | 3300005985 | Bacteria | 51459 |
| 167 | Ga0081539_10012860 | 3300005985 | Bacteria | 6379 |
| 168 | Ga0081539_10105896 | 3300005985 | Bacteria | 1425 |
| 169 | Ga0070716_100045338 | 3300006173 | Bacteria | 2468 |
| 170 | Ga0097621_100003746 | 3300006237 | Bacteria | 10532 |
| 171 | Ga0097621_100024026 | 3300006237 | Bacteria | 4754 |
| 172 | Ga0097621_100875206 | 3300006237 | Unclassified | 836 |
| 173 | Ga0068871_100005511 | 3300006358 | Bacteria | 8877 |
| 174 | Ga0068871_100022221 | 3300006358 | Bacteria | 4891 |
| 175 | Ga0068871_100199283 | 3300006358 | Unclassified | 1728 |
| 176 | Ga0075428_100002943 | 3300006844 | Bacteria | 18557 |
| 177 | Ga0075428_100015903 | 3300006844 | Bacteria | 8324 |
| 178 | Ga0075428_100045420 | 3300006844 | Bacteria | 4826 |
| 179 | Ga0075428_100158877 | 3300006844 | Unclassified | 2454 |
| 180 | Ga0075428_100186373 | 3300006844 | Bacteria | 2245 |
| 181 | Ga0075430_100136978 | 3300006846 | Bacteria | 2039 |
| 182 | Ga0075431_100047836 | 3300006847 | Bacteria | 4410 |
| 183 | Ga0075431_100074862 | 3300006847 | Bacteria | 3494 |
| 184 | Ga0075433_10014257 | 3300006852 | Bacteria | 6491 |
| 185 | Ga0075433_10028656 | 3300006852 | Bacteria | 4737 |
| 186 | Ga0075433_10029785 | 3300006852 | Bacteria | 4653 |
| 187 | Ga0075433_10086425 | 3300006852 | Bacteria | 2769 |
| 188 | Ga0075433_10163150 | 3300006852 | Bacteria | 1983 |
| 189 | Ga0075433_10254477 | 3300006852 | Bacteria | 1558 |
| 190 | Ga0075433_10614861 | 3300006852 | Bacteria | 953 |
| 191 | Ga0075434_100044322 | 3300006871 | Bacteria | 4413 |
| 192 | Ga0075434_100190007 | 3300006871 | Unclassified | 2074 |
| 193 | Ga0075434_100428093 | 3300006871 | Bacteria | 1345 |
| 194 | Ga0075434_100747112 | 3300006871 | Bacteria | 995 |
| 195 | Ga0075429_100044176 | 3300006880 | Bacteria | 3876 |
| 196 | Ga0075429_100068229 | 3300006880 | Bacteria | 3095 |
| 197 | Ga0075429_100436656 | 3300006880 | Bacteria | 1147 |
| 198 | Ga0097620_100008723 | 3300006931 | Bacteria | 10242 |
| 199 | Ga0097620_100020685 | 3300006931 | Bacteria | 6604 |
| 200 | Ga0097620_100048082 | 3300006931 | Bacteria | 4285 |
| 201 | Ga0097620_100065169 | 3300006931 | Bacteria | 3677 |
| 202 | Ga0097620_100068121 | 3300006931 | Bacteria | 3594 |
| 203 | Ga0097620_100155545 | 3300006931 | Bacteria | 2363 |
| 204 | Ga0097620_100188347 | 3300006931 | Bacteria | 2147 |
| 205 | Ga0097620_100357828 | 3300006931 | Bacteria | 1555 |
| 206 | Ga0097620_100391461 | 3300006931 | Bacteria | 1485 |
| 207 | Ga0097620_100596764 | 3300006931 | Bacteria | 1197 |
| 208 | Ga0097620_100858139 | 3300006931 | Bacteria | 994 |
| 209 | Ga0097620_101253699 | 3300006931 | Unclassified | 817 |
| 210 | Ga0075435_100119463 | 3300007076 | Bacteria | 2198 |
| 211 | Ga0075435_100178641 | 3300007076 | Unclassified | 1793 |
| 212 | Ga0099794_10013356 | 3300007265 | Bacteria | 3573 |
| 213 | Ga0105240_10023614 | 3300009093 | Bacteria | 8124 |
| 214 | Ga0105240_10080187 | 3300009093 | Unclassified | 4015 |
| 215 | Ga0105240_10321750 | 3300009093 | Bacteria | 1763 |
| 216 | Ga0111539_10007731 | 3300009094 | Bacteria | 13729 |
| 217 | Ga0111539_10010931 | 3300009094 | Bacteria | 11425 |
| 218 | Ga0111539_10033292 | 3300009094 | Bacteria | 6258 |
| 219 | Ga0111539_10189092 | 3300009094 | Bacteria | 2403 |
| 220 | Ga0111539_10293769 | 3300009094 | Bacteria | 1891 |
| 221 | Ga0111539_10418210 | 3300009094 | Bacteria | 1561 |
| 222 | Ga0111539_10904849 | 3300009094 | Unclassified | 1026 |
| 223 | Ga0105245_10016130 | 3300009098 | Bacteria | 6509 |
| 224 | Ga0105247_10086185 | 3300009101 | Bacteria | 1987 |
| 225 | Ga0105247_10442315 | 3300009101 | Bacteria | 935 |
| 226 | Ga0114129_10000386 | 3300009147 | Bacteria | 51383 |
| 227 | Ga0114129_10001678 | 3300009147 | Bacteria | 30169 |
| 228 | Ga0114129_10017547 | 3300009147 | Bacteria | 10190 |
| 229 | Ga0114129_10023920 | 3300009147 | Bacteria | 8657 |
| 230 | Ga0114129_10035104 | 3300009147 | Bacteria | 7085 |
| 231 | Ga0114129_10056371 | 3300009147 | Bacteria | 5504 |
| 232 | Ga0114129_10116828 | 3300009147 | Bacteria | 3676 |
| 233 | Ga0114129_10179894 | 3300009147 | Bacteria | 2878 |
| 234 | Ga0114129_10222450 | 3300009147 | Bacteria | 2546 |
| 235 | Ga0114129_10350631 | 3300009147 | Bacteria | 1955 |
| 236 | Ga0114129_10412598 | 3300009147 | Bacteria | 1778 |
| 237 | Ga0114129_10437479 | 3300009147 | Bacteria | 1717 |
| 238 | Ga0114129_10450030 | 3300009147 | Bacteria | 1689 |
| 239 | Ga0114129_10499859 | 3300009147 | Bacteria | 1588 |
| 240 | Ga0114129_10698277 | 3300009147 | Bacteria | 1304 |
| 241 | Ga0114129_11713406 | 3300009147 | Unclassified | 766 |
| 242 | Ga0105243_10011061 | 3300009148 | Bacteria | 6826 |
| 243 | Ga0105243_10012616 | 3300009148 | Bacteria | 6383 |
| 244 | Ga0105243_10666150 | 3300009148 | Unclassified | 1010 |
| 245 | Ga0105241_10095634 | 3300009174 | Bacteria | 2352 |
| 246 | Ga0105241_10241519 | 3300009174 | Bacteria | 1527 |
| 247 | Ga0105241_10382176 | 3300009174 | Bacteria | 1231 |
| 248 | Ga0105241_10534338 | 3300009174 | Bacteria | 1050 |
| 249 | Ga0105241_10734808 | 3300009174 | Bacteria | 904 |
| 250 | Ga0105242_10019725 | 3300009176 | Bacteria | 5284 |
| 251 | Ga0105242_10403887 | 3300009176 | Bacteria | 1276 |
| 252 | Ga0105242_10458701 | 3300009176 | Bacteria | 1203 |
| 253 | Ga0105242_10637219 | 3300009176 | Bacteria | 1035 |
| 254 | Ga0105248_10002076 | 3300009177 | Bacteria | 22166 |
| 255 | Ga0105248_10002454 | 3300009177 | Bacteria | 20600 |
| 256 | Ga0105248_10465440 | 3300009177 | Bacteria | 1425 |
| 257 | Ga0105248_10514888 | 3300009177 | Bacteria | 1349 |
| 258 | Ga0105248_10527239 | 3300009177 | Bacteria | 1332 |
| 259 | Ga0105248_10697787 | 3300009177 | Unclassified | 1145 |
| 260 | Ga0105237_10178454 | 3300009545 | Bacteria | 2124 |
| 261 | Ga0105237_10388186 | 3300009545 | Unclassified | 1401 |
| 262 | Ga0105237_10788957 | 3300009545 | Unclassified | 957 |
| 263 | Ga0105238_10005709 | 3300009551 | Bacteria | 12297 |
| 264 | Ga0105238_11207971 | 3300009551 | Unclassified | 781 |
| 265 | Ga0105249_10014928 | 3300009553 | Bacteria | 6870 |
| 266 | Ga0105249_10038036 | 3300009553 | Bacteria | 4366 |
| 267 | Ga0105249_10835623 | 3300009553 | Bacteria | 986 |
| 268 | Ga0105246_10135558 | 3300011119 | Bacteria | 1845 |
| 269 | Ga0105246_10391150 | 3300011119 | Unclassified | 1152 |
| 270 | Ga0157373_10038585 | 3300013100 | Bacteria | 3423 |
| 271 | Ga0157373_10045912 | 3300013100 | Bacteria | 3118 |
| 272 | Ga0157374_10212114 | 3300013296 | Bacteria | 1899 |
| 273 | Ga0157374_10734099 | 3300013296 | Unclassified | 1002 |
| 274 | Ga0157378_10007115 | 3300013297 | Bacteria | 9771 |
| 275 | Ga0157378_10366173 | 3300013297 | Bacteria | 1412 |
| 276 | Ga0163162_10004933 | 3300013306 | Bacteria | 12858 |
| 277 | Ga0163162_10012377 | 3300013306 | Bacteria | 8330 |
| 278 | Ga0163162_10166972 | 3300013306 | Bacteria | 2325 |
| 279 | Ga0163162_10451757 | 3300013306 | Unclassified | 1417 |
| 280 | Ga0163162_10633681 | 3300013306 | Unclassified | 1193 |
| 281 | Ga0157372_10072507 | 3300013307 | Bacteria | 3881 |
| 282 | Ga0157372_10177364 | 3300013307 | Bacteria | 2466 |
| 283 | Ga0157372_10233928 | 3300013307 | Unclassified | 2131 |
| 284 | Ga0157372_10672076 | 3300013307 | Unclassified | 1206 |
| 285 | Ga0157375_10035396 | 3300013308 | Bacteria | 4766 |
| 286 | Ga0157375_10041345 | 3300013308 | Bacteria | 4450 |
| 287 | Ga0157375_10152911 | 3300013308 | Bacteria | 2444 |
| 288 | Ga0157375_10308040 | 3300013308 | Bacteria | 1748 |
| 289 | Ga0157375_10559813 | 3300013308 | Bacteria | 1304 |
| 290 | Ga0163163_10000241 | 3300014325 | Bacteria | 55923 |
| 291 | Ga0163163_10006595 | 3300014325 | Bacteria | 10166 |
| 292 | Ga0163163_10007667 | 3300014325 | Bacteria | 9536 |
| 293 | Ga0163163_10028821 | 3300014325 | Bacteria | 5336 |
| 294 | Ga0163163_10031143 | 3300014325 | Bacteria | 5147 |
| 295 | Ga0163163_10835306 | 3300014325 | Bacteria | 985 |
| 296 | Ga0163163_11145764 | 3300014325 | Bacteria | 840 |
| 297 | Ga0163163_11197549 | 3300014325 | Unclassified | 822 |
| 298 | Ga0157380_10004089 | 3300014326 | Bacteria | 10078 |
| 299 | Ga0157380_10020803 | 3300014326 | Bacteria | 4911 |
| 300 | Ga0157380_10273325 | 3300014326 | Bacteria | 1542 |
| 301 | Ga0157380_10903834 | 3300014326 | Bacteria | 909 |
| 302 | Ga0157377_10019907 | 3300014745 | Unclassified | 3510 |
| 303 | Ga0157377_10043397 | 3300014745 | Bacteria | 2502 |
| 304 | Ga0157379_10193245 | 3300014968 | Bacteria | 1839 |
| 305 | Ga0157379_10684779 | 3300014968 | Bacteria | 962 |
| 306 | Ga0157376_10298428 | 3300014969 | Unclassified | 1524 |
| 307 | Ga0163161_10019096 | 3300017792 | Unclassified | 4804 |
| 308 | Ga0207697_10057503 | 3300025315 | Bacteria | 1614 |
| 309 | Ga0207697_10074744 | 3300025315 | Unclassified | 1423 |
| 310 | Ga0207697_10107462 | 3300025315 | Bacteria | 1193 |
| 311 | Ga0207656_10163700 | 3300025321 | Unclassified | 1060 |
| 312 | Ga0207653_10008427 | 3300025885 | Bacteria | 3210 |
| 313 | Ga0207642_10091307 | 3300025899 | Bacteria | 1505 |
| 314 | Ga0207642_10205311 | 3300025899 | Bacteria | 1091 |
| 315 | Ga0207710_10000529 | 3300025900 | Bacteria | 23411 |
| 316 | Ga0207647_10040188 | 3300025904 | Bacteria | 2947 |
| 317 | Ga0207645_10310461 | 3300025907 | Bacteria | 1051 |
| 318 | Ga0207643_10010832 | 3300025908 | Bacteria | 4917 |
| 319 | Ga0207643_10016467 | 3300025908 | Bacteria | 4033 |
| 320 | Ga0207643_10141996 | 3300025908 | Unclassified | 1435 |
| 321 | Ga0207643_10246273 | 3300025908 | Bacteria | 1100 |
| 322 | Ga0207684_10000520 | 3300025910 | Bacteria | 47656 |
| 323 | Ga0207684_10193565 | 3300025910 | Bacteria | 1754 |
| 324 | Ga0207654_10307832 | 3300025911 | Bacteria | 1079 |
| 325 | Ga0207707_10014000 | 3300025912 | Bacteria | 6994 |
| 326 | Ga0207707_10445018 | 3300025912 | Bacteria | 1109 |
| 327 | Ga0207695_10103128 | 3300025913 | Bacteria | 2844 |
| 328 | Ga0207695_10353696 | 3300025913 | Bacteria | 1356 |
| 329 | Ga0207671_10043832 | 3300025914 | Bacteria | 3308 |
| 330 | Ga0207671_10177904 | 3300025914 | Bacteria | 1654 |
| 331 | Ga0207660_10431747 | 3300025917 | Bacteria | 1064 |
| 332 | Ga0207662_10014215 | 3300025918 | Bacteria | 4463 |
| 333 | Ga0207662_10281197 | 3300025918 | Unclassified | 1101 |
| 334 | Ga0207662_10349483 | 3300025918 | Unclassified | 993 |
| 335 | Ga0207652_10405109 | 3300025921 | Bacteria | 1231 |
| 336 | Ga0207646_10000128 | 3300025922 | Bacteria | 103131 |
| 337 | Ga0207646_10034005 | 3300025922 | Bacteria | 4607 |
| 338 | Ga0207646_10166838 | 3300025922 | Unclassified | 1988 |
| 339 | Ga0207681_10068631 | 3300025923 | Unclassified | 2463 |
| 340 | Ga0207694_10004008 | 3300025924 | Bacteria | 11609 |
| 341 | Ga0207694_10152651 | 3300025924 | Unclassified | 1861 |
| 342 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 343 | Ga0207650_10290620 | 3300025925 | Bacteria | 1333 |
| 344 | Ga0207650_10303422 | 3300025925 | Unclassified | 1305 |
| 345 | Ga0207687_10959614 | 3300025927 | Unclassified | 733 |
| 346 | Ga0207700_10164822 | 3300025928 | Bacteria | 1843 |
| 347 | Ga0207644_10022739 | 3300025931 | Bacteria | 4286 |
| 348 | Ga0207644_10452183 | 3300025931 | Bacteria | 1055 |
| 349 | Ga0207686_10402947 | 3300025934 | Bacteria | 1042 |
| 350 | Ga0207709_10336646 | 3300025935 | Bacteria | 1134 |
| 351 | Ga0207670_10026612 | 3300025936 | Bacteria | 3647 |
| 352 | Ga0207670_10146827 | 3300025936 | Unclassified | 1745 |
| 353 | Ga0207670_10587736 | 3300025936 | Unclassified | 913 |
| 354 | Ga0207704_10108882 | 3300025938 | Unclassified | 1867 |
| 355 | Ga0207704_10121530 | 3300025938 | Bacteria | 1788 |
| 356 | Ga0207665_10027591 | 3300025939 | Bacteria | 3751 |
| 357 | Ga0207691_10014937 | 3300025940 | Bacteria | 7398 |
| 358 | Ga0207711_10008113 | 3300025941 | Bacteria | 8789 |
| 359 | Ga0207711_10185768 | 3300025941 | Bacteria | 1892 |
| 360 | Ga0207711_10322617 | 3300025941 | Bacteria | 1427 |
| 361 | Ga0207711_10450532 | 3300025941 | Bacteria | 1198 |
| 362 | Ga0207711_10658894 | 3300025941 | Unclassified | 976 |
| 363 | Ga0207689_10007209 | 3300025942 | Bacteria | 9766 |
| 364 | Ga0207689_10187235 | 3300025942 | Bacteria | 1707 |
| 365 | Ga0207689_10265424 | 3300025942 | Bacteria | 1421 |
| 366 | Ga0207689_10520419 | 3300025942 | Unclassified | 998 |
| 367 | Ga0207689_10698836 | 3300025942 | Unclassified | 855 |
| 368 | Ga0207679_10056252 | 3300025945 | Bacteria | 2904 |
| 369 | Ga0207651_10145476 | 3300025960 | Bacteria | 1837 |
| 370 | Ga0207712_10009655 | 3300025961 | Bacteria | 6116 |
| 371 | Ga0207712_10562418 | 3300025961 | Bacteria | 982 |
| 372 | Ga0207640_10016956 | 3300025981 | Bacteria | 4250 |
| 373 | Ga0207640_10135703 | 3300025981 | Bacteria | 1786 |
| 374 | Ga0207658_10106351 | 3300025986 | Bacteria | 2209 |
| 375 | Ga0207677_10117725 | 3300026023 | Bacteria | 1992 |
| 376 | Ga0207703_10072629 | 3300026035 | Unclassified | 2844 |
| 377 | Ga0207703_10079358 | 3300026035 | Bacteria | 2731 |
| 378 | Ga0207703_10086659 | 3300026035 | Bacteria | 2624 |
| 379 | Ga0207703_10196591 | 3300026035 | Bacteria | 1790 |
| 380 | Ga0207703_10556742 | 3300026035 | Unclassified | 1082 |
| 381 | Ga0207703_10829930 | 3300026035 | Unclassified | 883 |
| 382 | Ga0207703_11179057 | 3300026035 | Unclassified | 736 |
| 383 | Ga0207639_10259143 | 3300026041 | Unclassified | 1520 |
| 384 | Ga0207639_10577705 | 3300026041 | Bacteria | 1034 |
| 385 | Ga0207708_10000017 | 3300026075 | Bacteria | 190414 |
| 386 | Ga0207708_10058116 | 3300026075 | Bacteria | 2951 |
| 387 | Ga0207641_10125889 | 3300026088 | Bacteria | 2294 |
| 388 | Ga0207641_10426174 | 3300026088 | Bacteria | 1278 |
| 389 | Ga0207641_10521749 | 3300026088 | Bacteria | 1156 |
| 390 | Ga0207641_10776395 | 3300026088 | Bacteria | 947 |
| 391 | Ga0207648_10023843 | 3300026089 | Bacteria | 5472 |
| 392 | Ga0207648_10130504 | 3300026089 | Bacteria | 2212 |
| 393 | Ga0207648_10249173 | 3300026089 | Unclassified | 1583 |
| 394 | Ga0207648_10290497 | 3300026089 | Bacteria | 1464 |
| 395 | Ga0207648_10929772 | 3300026089 | Unclassified | 813 |
| 396 | Ga0207676_10058419 | 3300026095 | Bacteria | 3043 |
| 397 | Ga0207676_10104050 | 3300026095 | Bacteria | 2360 |
| 398 | Ga0207676_10107655 | 3300026095 | Unclassified | 2325 |
| 399 | Ga0207676_10111206 | 3300026095 | Bacteria | 2292 |
| 400 | Ga0207676_10137077 | 3300026095 | Unclassified | 2090 |
| 401 | Ga0207676_10595471 | 3300026095 | Bacteria | 1061 |
| 402 | Ga0207676_10597252 | 3300026095 | Unclassified | 1060 |
| 403 | Ga0207676_10698862 | 3300026095 | Unclassified | 982 |
| 404 | Ga0207676_10932332 | 3300026095 | Unclassified | 853 |
| 405 | Ga0207674_10166499 | 3300026116 | Bacteria | 2158 |
| 406 | Ga0207674_10224987 | 3300026116 | Bacteria | 1825 |
| 407 | Ga0207675_100004402 | 3300026118 | Bacteria | 13602 |
| 408 | Ga0207675_100100814 | 3300026118 | Unclassified | 2720 |
| 409 | Ga0207675_100417195 | 3300026118 | Unclassified | 1325 |
| 410 | Ga0207683_10153575 | 3300026121 | Bacteria | 2078 |
| 411 | Ga0207698_10071353 | 3300026142 | Bacteria | 2756 |
| 412 | Ga0207698_10360396 | 3300026142 | Bacteria | 1377 |
| 413 | Ga0207698_10542023 | 3300026142 | Bacteria | 1139 |
| 414 | Ga0207428_10348799 | 3300027907 | Bacteria | 1089 |
| 415 | Ga0268265_10144734 | 3300028380 | Bacteria | 1995 |
| 416 | Ga0268265_10306453 | 3300028380 | Bacteria | 1432 |
| 417 | Ga0268264_10512587 | 3300028381 | Bacteria | 1171 |
| 418 | Ga0268264_10532175 | 3300028381 | Bacteria | 1150 |
| 419 | Ga0268264_10664631 | 3300028381 | Unclassified | 1032 |
| 420 | Ga0268264_10855332 | 3300028381 | Unclassified | 911 |
| 421 | Ga0307408_100006178 | 3300031548 | Bacteria | 7953 |
| 422 | Ga0307408_100042759 | 3300031548 | Bacteria | 3221 |
| 423 | Ga0307408_100098497 | 3300031548 | Unclassified | 2223 |
| 424 | Ga0307408_100156783 | 3300031548 | Bacteria | 1804 |
| 425 | Ga0307405_10004641 | 3300031731 | Bacteria | 6524 |
| 426 | Ga0307405_10043594 | 3300031731 | Bacteria | 2739 |
| 427 | Ga0307405_10228570 | 3300031731 | Bacteria | 1370 |
| 428 | Ga0307413_10370021 | 3300031824 | Bacteria | 1113 |
| 429 | Ga0307410_10069655 | 3300031852 | Bacteria | 2434 |
| 430 | Ga0307410_10341972 | 3300031852 | Unclassified | 1193 |
| 431 | Ga0307410_10357277 | 3300031852 | Bacteria | 1169 |
| 432 | Ga0307406_10000720 | 3300031901 | Bacteria | 18677 |
| 433 | Ga0307407_10330832 | 3300031903 | Bacteria | 1072 |
| 434 | Ga0307412_10012138 | 3300031911 | Bacteria | 5008 |
| 435 | Ga0307412_10018148 | 3300031911 | Bacteria | 4227 |
| 436 | Ga0307412_10210116 | 3300031911 | Unclassified | 1484 |
| 437 | Ga0307409_100060923 | 3300031995 | Bacteria | 2946 |
| 438 | Ga0307409_100143569 | 3300031995 | Bacteria | 2061 |
| 439 | Ga0307409_100219397 | 3300031995 | Bacteria | 1716 |
| 440 | Ga0307416_100075140 | 3300032002 | Bacteria | 2827 |
| 441 | Ga0307416_100395502 | 3300032002 | Unclassified | 1417 |
| 442 | Ga0307414_10021134 | 3300032004 | Bacteria | 4075 |
| 443 | Ga0307411_10037911 | 3300032005 | Bacteria | 3035 |
| 444 | Ga0307415_100088855 | 3300032126 | Bacteria | 2230 |
| 445 | Ga0307415_100308852 | 3300032126 | Unclassified | 1313 |
| 446 | Ga0373952_0047472 | 3300035092 | Bacteria | 1013 |
| 447 | Ga0373932_0161566 | 3300035112 | Bacteria | 775 |
| 448 | Ga0373960_0055006 | 3300035121 | Bacteria | 1192 |
| 449 | Ga0373933_0601833 | 3300035724 | Unclassified | 722 |
| 450 | Ga0373937_0095683 | 3300036401 | Unclassified | 2754 |
| 451 | Ga0395900_0048967 | 3300037418 | Bacteria | 4353 |
| 452 | Ga0395898_0206242 | 3300037466 | Bacteria | 1875 |
| 453 | Ga0395901_0398604 | 3300038443 | Unclassified | 1414 |
| 454 | Ga0439448_0139057 | 3300042005 | Unclassified | 840 |
| 455 | Ga0439457_044097 | 3300042014 | Bacteria | 996 |
| 456 | Ga0450889_003289 | 3300042144 | Bacteria | 1595 |
| 457 | Ga0466967_0320024 | 3300045976 | Bacteria | 1496 |
| 458 | Ga0466967_0396115 | 3300045976 | Unclassified | 1343 |
| 459 | Ga0496102_0018502 | 3300048905 | Bacteria | 6123 |
| 460 | Ga0496104_0383001 | 3300048907 | Bacteria | 1319 |
| 461 | Ga0496104_0628588 | 3300048907 | Bacteria | 983 |
| 462 | Ga0496106_0441841 | 3300048909 | Bacteria | 1045 |
| 463 | Ga0496108_0233021 | 3300048911 | Bacteria | 1601 |
| 464 | Ga0496112_0102304 | 3300048915 | Bacteria | 2835 |
| 465 | Ga0496112_0120722 | 3300048915 | Unclassified | 2591 |
| 466 | Ga0496112_0291866 | 3300048915 | Bacteria | 1577 |
| 467 | Ga0501291_041944 | 3300049514 | Bacteria | 807 |
| 468 | Ga0501303_003828 | 3300049526 | Unclassified | 1222 |
| 469 | Ga0501048_0628052 | 3300049582 | Unclassified | 771 |
| 470 | Ga0501077_0161271 | 3300049593 | Bacteria | 1424 |
| 471 | Ga0501198_000621 | 3300049649 | Unclassified | 4406 |
| 472 | Ga0501198_002365 | 3300049649 | Bacteria | 2537 |
| 473 | Ga0501202_046889 | 3300049652 | Unclassified | 948 |
| 474 | Ga0501214_018486 | 3300049659 | Unclassified | 862 |
| 475 | Ga0501216_002572 | 3300049660 | Bacteria | 2591 |
| 476 | Ga0501217_001210 | 3300049661 | Bacteria | 4763 |
| 477 | Ga0501217_002028 | 3300049661 | Bacteria | 3918 |
| 478 | Ga0501217_039054 | 3300049661 | Unclassified | 1201 |
| 479 | Ga0501223_000855 | 3300049663 | Bacteria | 7227 |
| 480 | Ga0501223_009006 | 3300049663 | Bacteria | 2028 |
| 481 | Ga0501227_000381 | 3300049665 | Bacteria | 9381 |
| 482 | Ga0501230_003826 | 3300049667 | Unclassified | 2028 |
| 483 | Ga0501233_002731 | 3300049668 | Bacteria | 3128 |
| 484 | Ga0501235_000548 | 3300049669 | Bacteria | 7512 |
| 485 | Ga0501235_017456 | 3300049669 | Unclassified | 1588 |
| 486 | Ga0501240_000136 | 3300049673 | Bacteria | 4917 |
| 487 | Ga0501243_004935 | 3300049675 | Bacteria | 2003 |
| 488 | Ga0501249_078513 | 3300049679 | Unclassified | 775 |
| 489 | Ga0501250_015666 | 3300049680 | Unclassified | 934 |
| 490 | Ga0501253_002493 | 3300049683 | Bacteria | 2080 |
| 491 | Ga0501255_023706 | 3300049684 | Unclassified | 812 |
| 492 | Ga0501257_004958 | 3300049686 | Bacteria | 2918 |
| 493 | Ga0501260_006518 | 3300049689 | Unclassified | 1123 |
| 494 | Ga0501221_004881 | 3300049704 | Bacteria | 2232 |
| 495 | Ga0501221_095987 | 3300049704 | Unclassified | 730 |
| 496 | Ga0501225_0000813 | 3300049705 | Bacteria | 9765 |
| 497 | Ga0501234_000120 | 3300049707 | Bacteria | 10189 |
| 498 | Ga0501245_009124 | 3300049708 | Unclassified | 1420 |
| 499 | Ga0501079_0334507 | 3300049741 | Bacteria | 1186 |
| 500 | Ga0501083_0024462 | 3300049744 | Bacteria | 4184 |
| 501 | Ga0501268_024355 | 3300049765 | Unclassified | 1057 |
| 502 | Ga0501270_002776 | 3300049767 | Unclassified | 1828 |
| 503 | Ga0501226_000367 | 3300049853 | Bacteria | 6535 |
| 504 | nmdc:mga05p37_101851_c1 | 3300050507 | Unclassified | 3536 |
| 505 | nmdc:mga05p37_101_c1 | 3300050507 | Bacteria | 77106 |
| 506 | nmdc:mga05p37_127046_c1 | 3300050507 | Bacteria | 3130 |
| 507 | nmdc:mga05p37_15892_c1 | 3300050507 | Bacteria | 9053 |
| 508 | nmdc:mga05p37_19220_c1 | 3300050507 | Bacteria | 8265 |
| 509 | nmdc:mga05p37_231649_c1 | 3300050507 | Bacteria | 2225 |
| 510 | nmdc:mga05p37_237816_c1 | 3300050507 | Bacteria | 2191 |
| 511 | nmdc:mga05p37_267019_c1 | 3300050507 | Bacteria | 2046 |
| 512 | nmdc:mga05p37_65590_c1 | 3300050507 | Bacteria | 4466 |
| 513 | nmdc:mga05p37_72020_c1 | 3300050507 | Bacteria | 4252 |
| 514 | nmdc:mga05p37_806229_c1 | 3300050507 | Unclassified | 1026 |
| 515 | nmdc:mga05p37_815338_c1 | 3300050507 | Unclassified | 1019 |
| 516 | nmdc:mga09592_134585_c1 | 3300050508 | Bacteria | 2128 |
| 517 | nmdc:mga09592_358176_c1 | 3300050508 | Bacteria | 1262 |
| 518 | nmdc:mga09592_358529_c1 | 3300050508 | Bacteria | 1262 |
| 519 | nmdc:mga09592_38797_c1 | 3300050508 | Bacteria | 3999 |
| 520 | nmdc:mga0qj67_177707_c1 | 3300050509 | Bacteria | 1729 |
| 521 | nmdc:mga06r32_41436_c1 | 3300050510 | Bacteria | 4375 |
| 522 | nmdc:mga06r32_450728_c1 | 3300050510 | Unclassified | 1266 |
| 523 | nmdc:mga06r32_91925_c1 | 3300050510 | Bacteria | 2966 |
| 524 | nmdc:mga08y16_22040_c1 | 3300050511 | Bacteria | 6727 |
| 525 | nmdc:mga08y16_23608_c1 | 3300050511 | Bacteria | 6495 |
| 526 | nmdc:mga08y16_63802_c1 | 3300050511 | Bacteria | 3848 |
| 527 | nmdc:mga08y16_71647_c1 | 3300050511 | Bacteria | 3611 |
| 528 | nmdc:mga0n895_299898_c1 | 3300050512 | Bacteria | 1629 |
| 529 | nmdc:mga0n895_53598_c1 | 3300050512 | Bacteria | 3964 |
| 530 | nmdc:mga0n895_801500_c1 | 3300050512 | Unclassified | 932 |
| 531 | nmdc:mga08x19_25213_c1 | 3300050514 | Bacteria | 3703 |
| 532 | nmdc:mga08x19_7604_c1 | 3300050514 | Bacteria | 6435 |
| 533 | nmdc:mga0a205_127947_c1 | 3300050515 | Bacteria | 2440 |
| 534 | nmdc:mga0a205_154306_c1 | 3300050515 | Bacteria | 2195 |
| 535 | nmdc:mga0a205_194545_c1 | 3300050515 | Bacteria | 1919 |
| 536 | nmdc:mga0a205_372533_c1 | 3300050515 | Bacteria | 1294 |
| 537 | nmdc:mga0a205_43103_c1 | 3300050515 | Bacteria | 4351 |
| 538 | nmdc:mga0a205_48984_c1 | 3300050515 | Bacteria | 4078 |
| 539 | nmdc:mga0a205_54423_c1 | 3300050515 | Bacteria | 3864 |
| 540 | nmdc:mga0a205_57361_c1 | 3300050515 | Bacteria | 3760 |
| 541 | Ga0501084_0467671 | 3300054114 | Bacteria | 1066 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10141996 | Ga0207643_101419962 | 191 |
| 2 | 3300049526 | Ga0501303_003828 | Ga0501303_003828_17_604 | 195 |
| 3 | 3300049661 | Ga0501217_039054 | Ga0501217_039054_63_650 | 195 |
| 4 | 3300049669 | Ga0501235_017456 | Ga0501235_017456_772_1359 | 195 |
| 5 | 3300049675 | Ga0501243_004935 | Ga0501243_004935_76_663 | 195 |
| 6 | 3300049679 | Ga0501249_078513 | Ga0501249_078513_104_691 | 195 |
| 7 | 3300049684 | Ga0501255_023706 | Ga0501255_023706_189_776 | 195 |
| 8 | 3300049689 | Ga0501260_006518 | Ga0501260_006518_80_667 | 195 |
| 9 | 3300049704 | Ga0501221_095987 | Ga0501221_095987_80_667 | 195 |
| 10 | 3300049659 | Ga0501214_018486 | Ga0501214_018486_15_605 | 196 |
| 11 | 3300035724 | Ga0373933_0601833 | Ga0373933_0601833_102_695 | 197 |
| 12 | 3300009101 | Ga0105247_10442315 | Ga0105247_104423152 | 198 |
| 13 | 3300025907 | Ga0207645_10310461 | Ga0207645_103104612 | 198 |
| 14 | 3300009147 | Ga0114129_10437479 | Ga0114129_104374792 | 209 |
| 15 | 3300050507 | nmdc:mga05p37_267019_c1 | nmdc:mga05p37_267019_c1_863_1558 | 209 |
| 16 | 3300050508 | nmdc:mga09592_358176_c1 | nmdc:mga09592_358176_c1_284_979 | 209 |
| 17 | 3300025935 | Ga0207709_10336646 | Ga0207709_103366462 | 212 |
| 18 | 3300009545 | Ga0105237_10788957 | Ga0105237_107889571 | 216 |
| 19 | 3300014325 | Ga0163163_11197549 | Ga0163163_111975491 | 222 |
| 20 | 3300035112 | Ga0373932_0161566 | Ga0373932_0161566_31_699 | 222 |
| 21 | 3300050515 | nmdc:mga0a205_127947_c1 | nmdc:mga0a205_127947_c1_1641_2309 | 222 |
| 22 | 3300005290 | Ga0065712_10020674 | Ga0065712_100206741 | 223 |
| 23 | 3300005293 | Ga0065715_10096483 | Ga0065715_100964831 | 223 |
| 24 | 3300005333 | Ga0070677_10047661 | Ga0070677_100476612 | 223 |
| 25 | 3300005364 | Ga0070673_100026091 | Ga0070673_1000260912 | 223 |
| 26 | 3300005441 | Ga0070700_100095902 | Ga0070700_1000959022 | 223 |
| 27 | 3300005444 | Ga0070694_100131752 | Ga0070694_1001317522 | 223 |
| 28 | 3300005549 | Ga0070704_100115126 | Ga0070704_1001151262 | 223 |
| 29 | 3300006880 | Ga0075429_100436656 | Ga0075429_1004366561 | 223 |
| 30 | 3300009094 | Ga0111539_10010931 | Ga0111539_100109316 | 223 |
| 31 | 3300009147 | Ga0114129_10179894 | Ga0114129_101798943 | 223 |
| 32 | 3300013308 | Ga0157375_10152911 | Ga0157375_101529112 | 223 |
| 33 | 3300014326 | Ga0157380_10020803 | Ga0157380_100208032 | 223 |
| 34 | 3300031548 | Ga0307408_100156783 | Ga0307408_1001567832 | 223 |
| 35 | 3300031824 | Ga0307413_10370021 | Ga0307413_103700212 | 223 |
| 36 | 3300031852 | Ga0307410_10341972 | Ga0307410_103419722 | 223 |
| 37 | 3300031911 | Ga0307412_10210116 | Ga0307412_102101162 | 223 |
| 38 | 3300032002 | Ga0307416_100395502 | Ga0307416_1003955022 | 223 |
| 39 | 3300032126 | Ga0307415_100308852 | Ga0307415_1003088522 | 223 |
| 40 | 3300049582 | Ga0501048_0628052 | Ga0501048_0628052_66_743 | 223 |
| 41 | 3300049593 | Ga0501077_0161271 | Ga0501077_0161271_436_1110 | 223 |
| 42 | 3300049741 | Ga0501079_0334507 | Ga0501079_0334507_53_748 | 223 |
| 43 | 3300049767 | Ga0501270_002776 | Ga0501270_002776_871_1554 | 223 |
| 44 | 3300050508 | nmdc:mga09592_134585_c1 | nmdc:mga09592_134585_c1_327_998 | 223 |
| 45 | 3300050508 | nmdc:mga09592_358529_c1 | nmdc:mga09592_358529_c1_564_1241 | 223 |
| 46 | 3300050509 | nmdc:mga0qj67_177707_c1 | nmdc:mga0qj67_177707_c1_862_1539 | 223 |
| 47 | 3300050510 | nmdc:mga06r32_91925_c1 | nmdc:mga06r32_91925_c1_548_1225 | 223 |
| 48 | 3300050511 | nmdc:mga08y16_63802_c1 | nmdc:mga08y16_63802_c1_975_1670 | 223 |
| 49 | 3300054114 | Ga0501084_0467671 | Ga0501084_0467671_63_758 | 223 |
| 50 | 3300005364 | Ga0070673_100353345 | Ga0070673_1003533451 | 224 |
| 51 | 3300005436 | Ga0070713_100078868 | Ga0070713_1000788683 | 224 |
| 52 | 3300005457 | Ga0070662_100410088 | Ga0070662_1004100881 | 224 |
| 53 | 3300005471 | Ga0070698_100027692 | Ga0070698_1000276922 | 224 |
| 54 | 3300005518 | Ga0070699_100249942 | Ga0070699_1002499422 | 224 |
| 55 | 3300005518 | Ga0070699_100281295 | Ga0070699_1002812952 | 224 |
| 56 | 3300005545 | Ga0070695_100489895 | Ga0070695_1004898952 | 224 |
| 57 | 3300005577 | Ga0068857_100222815 | Ga0068857_1002228152 | 224 |
| 58 | 3300006844 | Ga0075428_100158877 | Ga0075428_1001588771 | 224 |
| 59 | 3300006844 | Ga0075428_100186373 | Ga0075428_1001863734 | 224 |
| 60 | 3300006852 | Ga0075433_10086425 | Ga0075433_100864253 | 224 |
| 61 | 3300006852 | Ga0075433_10254477 | Ga0075433_102544772 | 224 |
| 62 | 3300006871 | Ga0075434_100428093 | Ga0075434_1004280931 | 224 |
| 63 | 3300006871 | Ga0075434_100747112 | Ga0075434_1007471121 | 224 |
| 64 | 3300007265 | Ga0099794_10013356 | Ga0099794_100133563 | 224 |
| 65 | 3300009093 | Ga0105240_10023614 | Ga0105240_100236143 | 224 |
| 66 | 3300009094 | Ga0111539_10293769 | Ga0111539_102937692 | 224 |
| 67 | 3300009147 | Ga0114129_10023920 | Ga0114129_100239208 | 224 |
| 68 | 3300009147 | Ga0114129_10350631 | Ga0114129_103506312 | 224 |
| 69 | 3300009147 | Ga0114129_10450030 | Ga0114129_104500302 | 224 |
| 70 | 3300009147 | Ga0114129_10698277 | Ga0114129_106982771 | 224 |
| 71 | 3300009147 | Ga0114129_11713406 | Ga0114129_117134061 | 224 |
| 72 | 3300013296 | Ga0157374_10212114 | Ga0157374_102121142 | 224 |
| 73 | 3300013297 | Ga0157378_10007115 | Ga0157378_100071153 | 224 |
| 74 | 3300025913 | Ga0207695_10353696 | Ga0207695_103536962 | 224 |
| 75 | 3300025928 | Ga0207700_10164822 | Ga0207700_101648222 | 224 |
| 76 | 3300026116 | Ga0207674_10166499 | Ga0207674_101664992 | 224 |
| 77 | 3300050507 | nmdc:mga05p37_127046_c1 | nmdc:mga05p37_127046_c1_1394_2068 | 224 |
| 78 | 3300050507 | nmdc:mga05p37_237816_c1 | nmdc:mga05p37_237816_c1_1464_2138 | 224 |
| 79 | 3300050507 | nmdc:mga05p37_72020_c1 | nmdc:mga05p37_72020_c1_2900_3574 | 224 |
| 80 | 3300050512 | nmdc:mga0n895_801500_c1 | nmdc:mga0n895_801500_c1_136_813 | 224 |
| 81 | 3300050514 | nmdc:mga08x19_25213_c1 | nmdc:mga08x19_25213_c1_2743_3417 | 224 |
| 82 | 3300050515 | nmdc:mga0a205_154306_c1 | nmdc:mga0a205_154306_c1_71_748 | 224 |
| 83 | 3300050515 | nmdc:mga0a205_194545_c1 | nmdc:mga0a205_194545_c1_906_1580 | 224 |
| 84 | 3300050515 | nmdc:mga0a205_372533_c1 | nmdc:mga0a205_372533_c1_543_1217 | 224 |
| 85 | 2162886012 | MBSR1b_contig_12507348 | MBSR1b_0264.00000610 | 225 |
| 86 | 2162886012 | MBSR1b_contig_861221 | MBSR1b_0240.00002710 | 225 |
| 87 | 3300000531 | CNBas_1000895 | CNBas_10008952 | 225 |
| 88 | 3300003203 | JGI25406J46586_10001381 | JGI25406J46586_1000138110 | 225 |
| 89 | 3300003320 | rootH2_10172926 | rootH2_101729262 | 225 |
| 90 | 3300003322 | rootL2_10163588 | rootL2_101635883 | 225 |
| 91 | 3300005290 | Ga0065712_10033281 | Ga0065712_100332812 | 225 |
| 92 | 3300005290 | Ga0065712_10070138 | Ga0065712_100701385 | 225 |
| 93 | 3300005290 | Ga0065712_10119890 | Ga0065712_101198902 | 225 |
| 94 | 3300005293 | Ga0065715_10002697 | Ga0065715_100026975 | 225 |
| 95 | 3300005293 | Ga0065715_10007206 | Ga0065715_100072064 | 225 |
| 96 | 3300005293 | Ga0065715_10008548 | Ga0065715_100085482 | 225 |
| 97 | 3300005293 | Ga0065715_10312783 | Ga0065715_103127832 | 225 |
| 98 | 3300005328 | Ga0070676_10085425 | Ga0070676_100854251 | 225 |
| 99 | 3300005331 | Ga0070670_100213142 | Ga0070670_1002131422 | 225 |
| 100 | 3300005331 | Ga0070670_100382508 | Ga0070670_1003825082 | 225 |
| 101 | 3300005334 | Ga0068869_100147918 | Ga0068869_1001479182 | 225 |
| 102 | 3300005334 | Ga0068869_100696073 | Ga0068869_1006960731 | 225 |
| 103 | 3300005335 | Ga0070666_10312883 | Ga0070666_103128832 | 225 |
| 104 | 3300005337 | Ga0070682_100174645 | Ga0070682_1001746452 | 225 |
| 105 | 3300005340 | Ga0070689_100268565 | Ga0070689_1002685652 | 225 |
| 106 | 3300005341 | Ga0070691_10172583 | Ga0070691_101725831 | 225 |
| 107 | 3300005343 | Ga0070687_100168114 | Ga0070687_1001681142 | 225 |
| 108 | 3300005345 | Ga0070692_10083253 | Ga0070692_100832532 | 225 |
| 109 | 3300005354 | Ga0070675_100397908 | Ga0070675_1003979082 | 225 |
| 110 | 3300005355 | Ga0070671_100032832 | Ga0070671_1000328322 | 225 |
| 111 | 3300005355 | Ga0070671_100037725 | Ga0070671_1000377252 | 225 |
| 112 | 3300005355 | Ga0070671_100263532 | Ga0070671_1002635321 | 225 |
| 113 | 3300005365 | Ga0070688_100364704 | Ga0070688_1003647041 | 225 |
| 114 | 3300005367 | Ga0070667_100100947 | Ga0070667_1001009472 | 225 |
| 115 | 3300005438 | Ga0070701_10250657 | Ga0070701_102506571 | 225 |
| 116 | 3300005438 | Ga0070701_10436917 | Ga0070701_104369171 | 225 |
| 117 | 3300005440 | Ga0070705_100000368 | Ga0070705_1000003686 | 225 |
| 118 | 3300005440 | Ga0070705_100249677 | Ga0070705_1002496772 | 225 |
| 119 | 3300005441 | Ga0070700_100013213 | Ga0070700_1000132135 | 225 |
| 120 | 3300005441 | Ga0070700_100694944 | Ga0070700_1006949441 | 225 |
| 121 | 3300005444 | Ga0070694_100020234 | Ga0070694_1000202342 | 225 |
| 122 | 3300005444 | Ga0070694_100287873 | Ga0070694_1002878732 | 225 |
| 123 | 3300005444 | Ga0070694_100354343 | Ga0070694_1003543431 | 225 |
| 124 | 3300005444 | Ga0070694_100438551 | Ga0070694_1004385511 | 225 |
| 125 | 3300005456 | Ga0070678_100187309 | Ga0070678_1001873091 | 225 |
| 126 | 3300005458 | Ga0070681_10339607 | Ga0070681_103396071 | 225 |
| 127 | 3300005459 | Ga0068867_100037909 | Ga0068867_1000379092 | 225 |
| 128 | 3300005459 | Ga0068867_100098675 | Ga0068867_1000986751 | 225 |
| 129 | 3300005466 | Ga0070685_10037095 | Ga0070685_100370952 | 225 |
| 130 | 3300005467 | Ga0070706_100043717 | Ga0070706_1000437174 | 225 |
| 131 | 3300005468 | Ga0070707_100953792 | Ga0070707_1009537921 | 225 |
| 132 | 3300005471 | Ga0070698_100114842 | Ga0070698_1001148421 | 225 |
| 133 | 3300005471 | Ga0070698_100193181 | Ga0070698_1001931812 | 225 |
| 134 | 3300005544 | Ga0070686_100046512 | Ga0070686_1000465122 | 225 |
| 135 | 3300005545 | Ga0070695_100017896 | Ga0070695_1000178964 | 225 |
| 136 | 3300005545 | Ga0070695_100075956 | Ga0070695_1000759562 | 225 |
| 137 | 3300005545 | Ga0070695_100753275 | Ga0070695_1007532751 | 225 |
| 138 | 3300005546 | Ga0070696_100202370 | Ga0070696_1002023701 | 225 |
| 139 | 3300005548 | Ga0070665_100191359 | Ga0070665_1001913592 | 225 |
| 140 | 3300005549 | Ga0070704_100622348 | Ga0070704_1006223482 | 225 |
| 141 | 3300005549 | Ga0070704_100638916 | Ga0070704_1006389161 | 225 |
| 142 | 3300005564 | Ga0070664_101128494 | Ga0070664_1011284941 | 225 |
| 143 | 3300005577 | Ga0068857_100479290 | Ga0068857_1004792902 | 225 |
| 144 | 3300005578 | Ga0068854_100003245 | Ga0068854_10000324511 | 225 |
| 145 | 3300005578 | Ga0068854_100112987 | Ga0068854_1001129872 | 225 |
| 146 | 3300005617 | Ga0068859_100020685 | Ga0068859_1000206853 | 225 |
| 147 | 3300005617 | Ga0068859_100065167 | Ga0068859_1000651673 | 225 |
| 148 | 3300005617 | Ga0068859_100068120 | Ga0068859_1000681204 | 225 |
| 149 | 3300005617 | Ga0068859_100188338 | Ga0068859_1001883381 | 225 |
| 150 | 3300005617 | Ga0068859_100596752 | Ga0068859_1005967522 | 225 |
| 151 | 3300005617 | Ga0068859_101253620 | Ga0068859_1012536202 | 225 |
| 152 | 3300005618 | Ga0068864_100002893 | Ga0068864_1000028933 | 225 |
| 153 | 3300005618 | Ga0068864_100215603 | Ga0068864_1002156032 | 225 |
| 154 | 3300005618 | Ga0068864_100349589 | Ga0068864_1003495892 | 225 |
| 155 | 3300005618 | Ga0068864_100394262 | Ga0068864_1003942622 | 225 |
| 156 | 3300005618 | Ga0068864_100708199 | Ga0068864_1007081992 | 225 |
| 157 | 3300005718 | Ga0068866_10052944 | Ga0068866_100529444 | 225 |
| 158 | 3300005718 | Ga0068866_10623003 | Ga0068866_106230031 | 225 |
| 159 | 3300005840 | Ga0068870_10132226 | Ga0068870_101322262 | 225 |
| 160 | 3300005841 | Ga0068863_100319893 | Ga0068863_1003198931 | 225 |
| 161 | 3300005841 | Ga0068863_100679037 | Ga0068863_1006790372 | 225 |
| 162 | 3300005842 | Ga0068858_100112189 | Ga0068858_1001121892 | 225 |
| 163 | 3300005842 | Ga0068858_100114869 | Ga0068858_1001148694 | 225 |
| 164 | 3300005842 | Ga0068858_100168704 | Ga0068858_1001687043 | 225 |
| 165 | 3300005842 | Ga0068858_100196492 | Ga0068858_1001964922 | 225 |
| 166 | 3300005842 | Ga0068858_100272704 | Ga0068858_1002727041 | 225 |
| 167 | 3300005843 | Ga0068860_100289765 | Ga0068860_1002897652 | 225 |
| 168 | 3300005843 | Ga0068860_100532424 | Ga0068860_1005324242 | 225 |
| 169 | 3300005843 | Ga0068860_100555280 | Ga0068860_1005552802 | 225 |
| 170 | 3300005844 | Ga0068862_100085625 | Ga0068862_1000856252 | 225 |
| 171 | 3300005983 | Ga0081540_1090277 | Ga0081540_10902772 | 225 |
| 172 | 3300005985 | Ga0081539_10000056 | Ga0081539_10000056163 | 225 |
| 173 | 3300005985 | Ga0081539_10000281 | Ga0081539_1000028175 | 225 |
| 174 | 3300005985 | Ga0081539_10105896 | Ga0081539_101058961 | 225 |
| 175 | 3300006173 | Ga0070716_100045338 | Ga0070716_1000453381 | 225 |
| 176 | 3300006237 | Ga0097621_100003746 | Ga0097621_1000037462 | 225 |
| 177 | 3300006237 | Ga0097621_100024026 | Ga0097621_1000240264 | 225 |
| 178 | 3300006237 | Ga0097621_100875206 | Ga0097621_1008752062 | 225 |
| 179 | 3300006358 | Ga0068871_100005511 | Ga0068871_1000055114 | 225 |
| 180 | 3300006358 | Ga0068871_100022221 | Ga0068871_1000222212 | 225 |
| 181 | 3300006358 | Ga0068871_100199283 | Ga0068871_1001992833 | 225 |
| 182 | 3300006844 | Ga0075428_100002943 | Ga0075428_1000029437 | 225 |
| 183 | 3300006844 | Ga0075428_100015903 | Ga0075428_1000159033 | 225 |
| 184 | 3300006844 | Ga0075428_100045420 | Ga0075428_1000454205 | 225 |
| 185 | 3300006846 | Ga0075430_100136978 | Ga0075430_1001369782 | 225 |
| 186 | 3300006847 | Ga0075431_100074862 | Ga0075431_1000748623 | 225 |
| 187 | 3300006852 | Ga0075433_10014257 | Ga0075433_100142573 | 225 |
| 188 | 3300006852 | Ga0075433_10614861 | Ga0075433_106148612 | 225 |
| 189 | 3300006871 | Ga0075434_100190007 | Ga0075434_1001900073 | 225 |
| 190 | 3300006880 | Ga0075429_100044176 | Ga0075429_1000441763 | 225 |
| 191 | 3300006931 | Ga0097620_100020685 | Ga0097620_1000206853 | 225 |
| 192 | 3300006931 | Ga0097620_100065169 | Ga0097620_1000651694 | 225 |
| 193 | 3300006931 | Ga0097620_100068121 | Ga0097620_1000681212 | 225 |
| 194 | 3300006931 | Ga0097620_100188347 | Ga0097620_1001883471 | 225 |
| 195 | 3300006931 | Ga0097620_100596764 | Ga0097620_1005967642 | 225 |
| 196 | 3300006931 | Ga0097620_101253699 | Ga0097620_1012536992 | 225 |
| 197 | 3300007076 | Ga0075435_100119463 | Ga0075435_1001194631 | 225 |
| 198 | 3300009093 | Ga0105240_10321750 | Ga0105240_103217502 | 225 |
| 199 | 3300009094 | Ga0111539_10033292 | Ga0111539_100332926 | 225 |
| 200 | 3300009094 | Ga0111539_10189092 | Ga0111539_101890922 | 225 |
| 201 | 3300009094 | Ga0111539_10904849 | Ga0111539_109048491 | 225 |
| 202 | 3300009098 | Ga0105245_10016130 | Ga0105245_100161307 | 225 |
| 203 | 3300009147 | Ga0114129_10000386 | Ga0114129_1000038612 | 225 |
| 204 | 3300009147 | Ga0114129_10001678 | Ga0114129_1000167824 | 225 |
| 205 | 3300009147 | Ga0114129_10017547 | Ga0114129_100175474 | 225 |
| 206 | 3300009147 | Ga0114129_10035104 | Ga0114129_100351043 | 225 |
| 207 | 3300009147 | Ga0114129_10056371 | Ga0114129_100563716 | 225 |
| 208 | 3300009147 | Ga0114129_10222450 | Ga0114129_102224504 | 225 |
| 209 | 3300009147 | Ga0114129_10499859 | Ga0114129_104998592 | 225 |
| 210 | 3300009148 | Ga0105243_10011061 | Ga0105243_100110611 | 225 |
| 211 | 3300009148 | Ga0105243_10012616 | Ga0105243_100126161 | 225 |
| 212 | 3300009148 | Ga0105243_10666150 | Ga0105243_106661501 | 225 |
| 213 | 3300009174 | Ga0105241_10095634 | Ga0105241_100956342 | 225 |
| 214 | 3300009174 | Ga0105241_10241519 | Ga0105241_102415192 | 225 |
| 215 | 3300009174 | Ga0105241_10734808 | Ga0105241_107348081 | 225 |
| 216 | 3300009176 | Ga0105242_10019725 | Ga0105242_100197252 | 225 |
| 217 | 3300009176 | Ga0105242_10403887 | Ga0105242_104038872 | 225 |
| 218 | 3300009176 | Ga0105242_10637219 | Ga0105242_106372192 | 225 |
| 219 | 3300009177 | Ga0105248_10002454 | Ga0105248_100024546 | 225 |
| 220 | 3300009177 | Ga0105248_10514888 | Ga0105248_105148881 | 225 |
| 221 | 3300009177 | Ga0105248_10527239 | Ga0105248_105272392 | 225 |
| 222 | 3300009177 | Ga0105248_10697787 | Ga0105248_106977872 | 225 |
| 223 | 3300009545 | Ga0105237_10388186 | Ga0105237_103881862 | 225 |
| 224 | 3300009551 | Ga0105238_10005709 | Ga0105238_100057091 | 225 |
| 225 | 3300009551 | Ga0105238_11207971 | Ga0105238_112079711 | 225 |
| 226 | 3300009553 | Ga0105249_10014928 | Ga0105249_100149282 | 225 |
| 227 | 3300009553 | Ga0105249_10038036 | Ga0105249_100380365 | 225 |
| 228 | 3300009553 | Ga0105249_10835623 | Ga0105249_108356231 | 225 |
| 229 | 3300011119 | Ga0105246_10135558 | Ga0105246_101355583 | 225 |
| 230 | 3300011119 | Ga0105246_10391150 | Ga0105246_103911502 | 225 |
| 231 | 3300013100 | Ga0157373_10038585 | Ga0157373_100385852 | 225 |
| 232 | 3300013296 | Ga0157374_10734099 | Ga0157374_107340991 | 225 |
| 233 | 3300013297 | Ga0157378_10366173 | Ga0157378_103661731 | 225 |
| 234 | 3300013306 | Ga0163162_10004933 | Ga0163162_100049332 | 225 |
| 235 | 3300013306 | Ga0163162_10012377 | Ga0163162_100123777 | 225 |
| 236 | 3300013306 | Ga0163162_10166972 | Ga0163162_101669722 | 225 |
| 237 | 3300013306 | Ga0163162_10451757 | Ga0163162_104517572 | 225 |
| 238 | 3300013306 | Ga0163162_10633681 | Ga0163162_106336812 | 225 |
| 239 | 3300013307 | Ga0157372_10072507 | Ga0157372_100725072 | 225 |
| 240 | 3300013307 | Ga0157372_10177364 | Ga0157372_101773642 | 225 |
| 241 | 3300013307 | Ga0157372_10672076 | Ga0157372_106720762 | 225 |
| 242 | 3300013308 | Ga0157375_10035396 | Ga0157375_100353966 | 225 |
| 243 | 3300013308 | Ga0157375_10041345 | Ga0157375_100413455 | 225 |
| 244 | 3300013308 | Ga0157375_10308040 | Ga0157375_103080402 | 225 |
| 245 | 3300013308 | Ga0157375_10559813 | Ga0157375_105598131 | 225 |
| 246 | 3300014325 | Ga0163163_10006595 | Ga0163163_100065954 | 225 |
| 247 | 3300014325 | Ga0163163_10028821 | Ga0163163_100288215 | 225 |
| 248 | 3300014325 | Ga0163163_10031143 | Ga0163163_100311432 | 225 |
| 249 | 3300014325 | Ga0163163_10835306 | Ga0163163_108353061 | 225 |
| 250 | 3300014326 | Ga0157380_10004089 | Ga0157380_100040892 | 225 |
| 251 | 3300014326 | Ga0157380_10273325 | Ga0157380_102733252 | 225 |
| 252 | 3300014745 | Ga0157377_10019907 | Ga0157377_100199073 | 225 |
| 253 | 3300014968 | Ga0157379_10684779 | Ga0157379_106847792 | 225 |
| 254 | 3300014969 | Ga0157376_10298428 | Ga0157376_102984281 | 225 |
| 255 | 3300017792 | Ga0163161_10019096 | Ga0163161_100190963 | 225 |
| 256 | 3300025315 | Ga0207697_10074744 | Ga0207697_100747442 | 225 |
| 257 | 3300025315 | Ga0207697_10107462 | Ga0207697_101074622 | 225 |
| 258 | 3300025899 | Ga0207642_10205311 | Ga0207642_102053111 | 225 |
| 259 | 3300025904 | Ga0207647_10040188 | Ga0207647_100401884 | 225 |
| 260 | 3300025908 | Ga0207643_10016467 | Ga0207643_100164672 | 225 |
| 261 | 3300025910 | Ga0207684_10193565 | Ga0207684_101935653 | 225 |
| 262 | 3300025912 | Ga0207707_10014000 | Ga0207707_100140002 | 225 |
| 263 | 3300025913 | Ga0207695_10103128 | Ga0207695_101031282 | 225 |
| 264 | 3300025918 | Ga0207662_10014215 | Ga0207662_100142151 | 225 |
| 265 | 3300025918 | Ga0207662_10281197 | Ga0207662_102811972 | 225 |
| 266 | 3300025924 | Ga0207694_10152651 | Ga0207694_101526511 | 225 |
| 267 | 3300025925 | Ga0207650_10290620 | Ga0207650_102906202 | 225 |
| 268 | 3300025925 | Ga0207650_10303422 | Ga0207650_103034223 | 225 |
| 269 | 3300025927 | Ga0207687_10959614 | Ga0207687_109596141 | 225 |
| 270 | 3300025931 | Ga0207644_10022739 | Ga0207644_100227392 | 225 |
| 271 | 3300025931 | Ga0207644_10452183 | Ga0207644_104521831 | 225 |
| 272 | 3300025934 | Ga0207686_10402947 | Ga0207686_104029472 | 225 |
| 273 | 3300025936 | Ga0207670_10146827 | Ga0207670_101468272 | 225 |
| 274 | 3300025938 | Ga0207704_10108882 | Ga0207704_101088822 | 225 |
| 275 | 3300025938 | Ga0207704_10121530 | Ga0207704_101215303 | 225 |
| 276 | 3300025939 | Ga0207665_10027591 | Ga0207665_100275914 | 225 |
| 277 | 3300025940 | Ga0207691_10014937 | Ga0207691_100149374 | 225 |
| 278 | 3300025941 | Ga0207711_10185768 | Ga0207711_101857681 | 225 |
| 279 | 3300025941 | Ga0207711_10450532 | Ga0207711_104505321 | 225 |
| 280 | 3300025941 | Ga0207711_10658894 | Ga0207711_106588941 | 225 |
| 281 | 3300025942 | Ga0207689_10007209 | Ga0207689_100072092 | 225 |
| 282 | 3300025942 | Ga0207689_10520419 | Ga0207689_105204192 | 225 |
| 283 | 3300025942 | Ga0207689_10698836 | Ga0207689_106988361 | 225 |
| 284 | 3300025945 | Ga0207679_10056252 | Ga0207679_100562522 | 225 |
| 285 | 3300025961 | Ga0207712_10009655 | Ga0207712_100096553 | 225 |
| 286 | 3300025961 | Ga0207712_10562418 | Ga0207712_105624182 | 225 |
| 287 | 3300026023 | Ga0207677_10117725 | Ga0207677_101177251 | 225 |
| 288 | 3300026035 | Ga0207703_10072629 | Ga0207703_100726292 | 225 |
| 289 | 3300026035 | Ga0207703_10079358 | Ga0207703_100793582 | 225 |
| 290 | 3300026035 | Ga0207703_10086659 | Ga0207703_100866592 | 225 |
| 291 | 3300026035 | Ga0207703_10556742 | Ga0207703_105567421 | 225 |
| 292 | 3300026035 | Ga0207703_10829930 | Ga0207703_108299301 | 225 |
| 293 | 3300026035 | Ga0207703_11179057 | Ga0207703_111790571 | 225 |
| 294 | 3300026041 | Ga0207639_10259143 | Ga0207639_102591432 | 225 |
| 295 | 3300026075 | Ga0207708_10058116 | Ga0207708_100581162 | 225 |
| 296 | 3300026088 | Ga0207641_10776395 | Ga0207641_107763951 | 225 |
| 297 | 3300026089 | Ga0207648_10023843 | Ga0207648_100238436 | 225 |
| 298 | 3300026089 | Ga0207648_10130504 | Ga0207648_101305042 | 225 |
| 299 | 3300026089 | Ga0207648_10929772 | Ga0207648_109297722 | 225 |
| 300 | 3300026095 | Ga0207676_10104050 | Ga0207676_101040502 | 225 |
| 301 | 3300026095 | Ga0207676_10111206 | Ga0207676_101112064 | 225 |
| 302 | 3300026095 | Ga0207676_10932332 | Ga0207676_109323322 | 225 |
| 303 | 3300026116 | Ga0207674_10224987 | Ga0207674_102249873 | 225 |
| 304 | 3300026118 | Ga0207675_100100814 | Ga0207675_1001008143 | 225 |
| 305 | 3300026118 | Ga0207675_100417195 | Ga0207675_1004171952 | 225 |
| 306 | 3300026121 | Ga0207683_10153575 | Ga0207683_101535753 | 225 |
| 307 | 3300026142 | Ga0207698_10542023 | Ga0207698_105420232 | 225 |
| 308 | 3300027907 | Ga0207428_10348799 | Ga0207428_103487992 | 225 |
| 309 | 3300028380 | Ga0268265_10144734 | Ga0268265_101447342 | 225 |
| 310 | 3300028381 | Ga0268264_10512587 | Ga0268264_105125871 | 225 |
| 311 | 3300028381 | Ga0268264_10532175 | Ga0268264_105321752 | 225 |
| 312 | 3300028381 | Ga0268264_10664631 | Ga0268264_106646311 | 225 |
| 313 | 3300031548 | Ga0307408_100042759 | Ga0307408_1000427592 | 225 |
| 314 | 3300031731 | Ga0307405_10043594 | Ga0307405_100435944 | 225 |
| 315 | 3300031731 | Ga0307405_10228570 | Ga0307405_102285702 | 225 |
| 316 | 3300031852 | Ga0307410_10357277 | Ga0307410_103572771 | 225 |
| 317 | 3300031911 | Ga0307412_10018148 | Ga0307412_100181484 | 225 |
| 318 | 3300031995 | Ga0307409_100060923 | Ga0307409_1000609232 | 225 |
| 319 | 3300031995 | Ga0307409_100143569 | Ga0307409_1001435692 | 225 |
| 320 | 3300031995 | Ga0307409_100219397 | Ga0307409_1002193972 | 225 |
| 321 | 3300032002 | Ga0307416_100075140 | Ga0307416_1000751402 | 225 |
| 322 | 3300036401 | Ga0373937_0095683 | Ga0373937_0095683_1699_2376 | 225 |
| 323 | 3300037466 | Ga0395898_0206242 | Ga0395898_0206242_261_938 | 225 |
| 324 | 3300042014 | Ga0439457_044097 | Ga0439457_044097_239_916 | 225 |
| 325 | 3300045976 | Ga0466967_0320024 | Ga0466967_0320024_118_795 | 225 |
| 326 | 3300048907 | Ga0496104_0628588 | Ga0496104_0628588_85_762 | 225 |
| 327 | 3300048909 | Ga0496106_0441841 | Ga0496106_0441841_279_956 | 225 |
| 328 | 3300048915 | Ga0496112_0120722 | Ga0496112_0120722_84_761 | 225 |
| 329 | 3300048915 | Ga0496112_0291866 | Ga0496112_0291866_491_1168 | 225 |
| 330 | 3300049649 | Ga0501198_002365 | Ga0501198_002365_121_798 | 225 |
| 331 | 3300049652 | Ga0501202_046889 | Ga0501202_046889_156_833 | 225 |
| 332 | 3300049660 | Ga0501216_002572 | Ga0501216_002572_108_785 | 225 |
| 333 | 3300049661 | Ga0501217_002028 | Ga0501217_002028_149_826 | 225 |
| 334 | 3300049708 | Ga0501245_009124 | Ga0501245_009124_577_1254 | 225 |
| 335 | 3300049744 | Ga0501083_0024462 | Ga0501083_0024462_1621_2298 | 225 |
| 336 | 3300049765 | Ga0501268_024355 | Ga0501268_024355_262_939 | 225 |
| 337 | 3300050507 | nmdc:mga05p37_101851_c1 | nmdc:mga05p37_101851_c1_640_1320 | 225 |
| 338 | 3300050507 | nmdc:mga05p37_101_c1 | nmdc:mga05p37_101_c1_70897_71577 | 225 |
| 339 | 3300050507 | nmdc:mga05p37_15892_c1 | nmdc:mga05p37_15892_c1_378_1127 | 225 |
| 340 | 3300050507 | nmdc:mga05p37_19220_c1 | nmdc:mga05p37_19220_c1_1086_1763 | 225 |
| 341 | 3300050507 | nmdc:mga05p37_815338_c1 | nmdc:mga05p37_815338_c1_267_944 | 225 |
| 342 | 3300050508 | nmdc:mga09592_38797_c1 | nmdc:mga09592_38797_c1_924_1601 | 225 |
| 343 | 3300050510 | nmdc:mga06r32_41436_c1 | nmdc:mga06r32_41436_c1_3636_4313 | 225 |
| 344 | 3300050510 | nmdc:mga06r32_450728_c1 | nmdc:mga06r32_450728_c1_236_913 | 225 |
| 345 | 3300050511 | nmdc:mga08y16_23608_c1 | nmdc:mga08y16_23608_c1_3876_4556 | 225 |
| 346 | 3300050511 | nmdc:mga08y16_71647_c1 | nmdc:mga08y16_71647_c1_1880_2557 | 225 |
| 347 | 3300050514 | nmdc:mga08x19_7604_c1 | nmdc:mga08x19_7604_c1_3993_4682 | 225 |
| 348 | 2162886007 | SwRhRL2b_contig_3433698 | SwRhRL2b_0105.00006240 | 226 |
| 349 | 3300000532 | CNAas_1000325 | CNAas_10003252 | 226 |
| 350 | 3300002459 | JGI24751J29686_10000329 | JGI24751J29686_100003292 | 226 |
| 351 | 3300003203 | JGI25406J46586_10002828 | JGI25406J46586_100028288 | 226 |
| 352 | 3300005288 | Ga0065714_10064452 | Ga0065714_100644525 | 226 |
| 353 | 3300005289 | Ga0065704_10001026 | Ga0065704_100010263 | 226 |
| 354 | 3300005290 | Ga0065712_10000126 | Ga0065712_100001265 | 226 |
| 355 | 3300005293 | Ga0065715_10126569 | Ga0065715_101265692 | 226 |
| 356 | 3300005295 | Ga0065707_10000828 | Ga0065707_100008283 | 226 |
| 357 | 3300005295 | Ga0065707_10198880 | Ga0065707_101988802 | 226 |
| 358 | 3300005331 | Ga0070670_100146176 | Ga0070670_1001461762 | 226 |
| 359 | 3300005334 | Ga0068869_100119920 | Ga0068869_1001199203 | 226 |
| 360 | 3300005334 | Ga0068869_100222847 | Ga0068869_1002228472 | 226 |
| 361 | 3300005340 | Ga0070689_100000072 | Ga0070689_10000007217 | 226 |
| 362 | 3300005340 | Ga0070689_100271320 | Ga0070689_1002713202 | 226 |
| 363 | 3300005406 | Ga0070703_10005349 | Ga0070703_100053494 | 226 |
| 364 | 3300005438 | Ga0070701_10031897 | Ga0070701_100318972 | 226 |
| 365 | 3300005438 | Ga0070701_10095739 | Ga0070701_100957393 | 226 |
| 366 | 3300005440 | Ga0070705_100122265 | Ga0070705_1001222652 | 226 |
| 367 | 3300005441 | Ga0070700_100000005 | Ga0070700_100000005132 | 226 |
| 368 | 3300005441 | Ga0070700_100039925 | Ga0070700_1000399251 | 226 |
| 369 | 3300005444 | Ga0070694_100039216 | Ga0070694_1000392164 | 226 |
| 370 | 3300005444 | Ga0070694_100149841 | Ga0070694_1001498413 | 226 |
| 371 | 3300005458 | Ga0070681_10005713 | Ga0070681_100057132 | 226 |
| 372 | 3300005467 | Ga0070706_100000905 | Ga0070706_10000090516 | 226 |
| 373 | 3300005468 | Ga0070707_100245955 | Ga0070707_1002459552 | 226 |
| 374 | 3300005471 | Ga0070698_100022602 | Ga0070698_1000226023 | 226 |
| 375 | 3300005471 | Ga0070698_100045623 | Ga0070698_1000456232 | 226 |
| 376 | 3300005518 | Ga0070699_100001460 | Ga0070699_10000146011 | 226 |
| 377 | 3300005518 | Ga0070699_100018881 | Ga0070699_1000188812 | 226 |
| 378 | 3300005518 | Ga0070699_100052146 | Ga0070699_1000521463 | 226 |
| 379 | 3300005530 | Ga0070679_100282305 | Ga0070679_1002823052 | 226 |
| 380 | 3300005536 | Ga0070697_100094626 | Ga0070697_1000946261 | 226 |
| 381 | 3300005536 | Ga0070697_100333955 | Ga0070697_1003339552 | 226 |
| 382 | 3300005544 | Ga0070686_100426203 | Ga0070686_1004262032 | 226 |
| 383 | 3300005545 | Ga0070695_100239103 | Ga0070695_1002391032 | 226 |
| 384 | 3300005545 | Ga0070695_100368552 | Ga0070695_1003685521 | 226 |
| 385 | 3300005546 | Ga0070696_100134968 | Ga0070696_1001349683 | 226 |
| 386 | 3300005547 | Ga0070693_100004080 | Ga0070693_1000040801 | 226 |
| 387 | 3300005547 | Ga0070693_100029258 | Ga0070693_1000292583 | 226 |
| 388 | 3300005549 | Ga0070704_100083619 | Ga0070704_1000836193 | 226 |
| 389 | 3300005549 | Ga0070704_100276727 | Ga0070704_1002767272 | 226 |
| 390 | 3300005578 | Ga0068854_100299880 | Ga0068854_1002998802 | 226 |
| 391 | 3300005615 | Ga0070702_100688688 | Ga0070702_1006886881 | 226 |
| 392 | 3300005616 | Ga0068852_100736267 | Ga0068852_1007362672 | 226 |
| 393 | 3300005617 | Ga0068859_100008723 | Ga0068859_1000087237 | 226 |
| 394 | 3300005617 | Ga0068859_100155535 | Ga0068859_1001555352 | 226 |
| 395 | 3300005617 | Ga0068859_100357853 | Ga0068859_1003578532 | 226 |
| 396 | 3300005617 | Ga0068859_100858159 | Ga0068859_1008581591 | 226 |
| 397 | 3300005618 | Ga0068864_100078779 | Ga0068864_1000787792 | 226 |
| 398 | 3300005719 | Ga0068861_100001848 | Ga0068861_1000018482 | 226 |
| 399 | 3300005834 | Ga0068851_10228347 | Ga0068851_102283472 | 226 |
| 400 | 3300005840 | Ga0068870_10097936 | Ga0068870_100979363 | 226 |
| 401 | 3300005841 | Ga0068863_100047038 | Ga0068863_1000470382 | 226 |
| 402 | 3300005841 | Ga0068863_100274515 | Ga0068863_1002745152 | 226 |
| 403 | 3300005841 | Ga0068863_100313257 | Ga0068863_1003132571 | 226 |
| 404 | 3300005841 | Ga0068863_100351743 | Ga0068863_1003517432 | 226 |
| 405 | 3300005841 | Ga0068863_100424570 | Ga0068863_1004245702 | 226 |
| 406 | 3300005842 | Ga0068858_100121850 | Ga0068858_1001218502 | 226 |
| 407 | 3300005842 | Ga0068858_100384735 | Ga0068858_1003847352 | 226 |
| 408 | 3300005843 | Ga0068860_100060232 | Ga0068860_1000602321 | 226 |
| 409 | 3300005985 | Ga0081539_10001024 | Ga0081539_1000102415 | 226 |
| 410 | 3300005985 | Ga0081539_10012860 | Ga0081539_100128602 | 226 |
| 411 | 3300006847 | Ga0075431_100047836 | Ga0075431_1000478362 | 226 |
| 412 | 3300006852 | Ga0075433_10028656 | Ga0075433_100286563 | 226 |
| 413 | 3300006852 | Ga0075433_10029785 | Ga0075433_100297852 | 226 |
| 414 | 3300006852 | Ga0075433_10163150 | Ga0075433_101631502 | 226 |
| 415 | 3300006871 | Ga0075434_100044322 | Ga0075434_1000443222 | 226 |
| 416 | 3300006880 | Ga0075429_100068229 | Ga0075429_1000682292 | 226 |
| 417 | 3300006931 | Ga0097620_100008723 | Ga0097620_1000087234 | 226 |
| 418 | 3300006931 | Ga0097620_100048082 | Ga0097620_1000480822 | 226 |
| 419 | 3300006931 | Ga0097620_100155545 | Ga0097620_1001555452 | 226 |
| 420 | 3300006931 | Ga0097620_100357828 | Ga0097620_1003578282 | 226 |
| 421 | 3300006931 | Ga0097620_100391461 | Ga0097620_1003914612 | 226 |
| 422 | 3300006931 | Ga0097620_100858139 | Ga0097620_1008581391 | 226 |
| 423 | 3300007076 | Ga0075435_100178641 | Ga0075435_1001786412 | 226 |
| 424 | 3300009093 | Ga0105240_10080187 | Ga0105240_100801872 | 226 |
| 425 | 3300009094 | Ga0111539_10007731 | Ga0111539_100077319 | 226 |
| 426 | 3300009094 | Ga0111539_10418210 | Ga0111539_104182102 | 226 |
| 427 | 3300009101 | Ga0105247_10086185 | Ga0105247_100861853 | 226 |
| 428 | 3300009147 | Ga0114129_10116828 | Ga0114129_101168282 | 226 |
| 429 | 3300009147 | Ga0114129_10412598 | Ga0114129_104125982 | 226 |
| 430 | 3300009174 | Ga0105241_10382176 | Ga0105241_103821762 | 226 |
| 431 | 3300009174 | Ga0105241_10534338 | Ga0105241_105343382 | 226 |
| 432 | 3300009176 | Ga0105242_10458701 | Ga0105242_104587011 | 226 |
| 433 | 3300009177 | Ga0105248_10002076 | Ga0105248_100020766 | 226 |
| 434 | 3300009177 | Ga0105248_10465440 | Ga0105248_104654403 | 226 |
| 435 | 3300009545 | Ga0105237_10178454 | Ga0105237_101784542 | 226 |
| 436 | 3300013100 | Ga0157373_10045912 | Ga0157373_100459122 | 226 |
| 437 | 3300013307 | Ga0157372_10233928 | Ga0157372_102339282 | 226 |
| 438 | 3300014325 | Ga0163163_10000241 | Ga0163163_100002412 | 226 |
| 439 | 3300014325 | Ga0163163_10007667 | Ga0163163_100076674 | 226 |
| 440 | 3300014325 | Ga0163163_11145764 | Ga0163163_111457641 | 226 |
| 441 | 3300014326 | Ga0157380_10903834 | Ga0157380_109038341 | 226 |
| 442 | 3300014745 | Ga0157377_10043397 | Ga0157377_100433972 | 226 |
| 443 | 3300014968 | Ga0157379_10193245 | Ga0157379_101932453 | 226 |
| 444 | 3300025315 | Ga0207697_10057503 | Ga0207697_100575032 | 226 |
| 445 | 3300025321 | Ga0207656_10163700 | Ga0207656_101637002 | 226 |
| 446 | 3300025885 | Ga0207653_10008427 | Ga0207653_100084272 | 226 |
| 447 | 3300025899 | Ga0207642_10091307 | Ga0207642_100913072 | 226 |
| 448 | 3300025900 | Ga0207710_10000529 | Ga0207710_1000052913 | 226 |
| 449 | 3300025908 | Ga0207643_10010832 | Ga0207643_100108323 | 226 |
| 450 | 3300025908 | Ga0207643_10246273 | Ga0207643_102462732 | 226 |
| 451 | 3300025910 | Ga0207684_10000520 | Ga0207684_1000052019 | 226 |
| 452 | 3300025911 | Ga0207654_10307832 | Ga0207654_103078323 | 226 |
| 453 | 3300025912 | Ga0207707_10445018 | Ga0207707_104450181 | 226 |
| 454 | 3300025914 | Ga0207671_10043832 | Ga0207671_100438322 | 226 |
| 455 | 3300025914 | Ga0207671_10177904 | Ga0207671_101779042 | 226 |
| 456 | 3300025917 | Ga0207660_10431747 | Ga0207660_104317472 | 226 |
| 457 | 3300025918 | Ga0207662_10349483 | Ga0207662_103494831 | 226 |
| 458 | 3300025921 | Ga0207652_10405109 | Ga0207652_104051092 | 226 |
| 459 | 3300025922 | Ga0207646_10000128 | Ga0207646_1000012890 | 226 |
| 460 | 3300025922 | Ga0207646_10034005 | Ga0207646_100340053 | 226 |
| 461 | 3300025922 | Ga0207646_10166838 | Ga0207646_101668382 | 226 |
| 462 | 3300025923 | Ga0207681_10068631 | Ga0207681_100686312 | 226 |
| 463 | 3300025924 | Ga0207694_10004008 | Ga0207694_1000400812 | 226 |
| 464 | 3300025925 | Ga0207650_10000009 | Ga0207650_10000009151 | 226 |
| 465 | 3300025936 | Ga0207670_10026612 | Ga0207670_100266123 | 226 |
| 466 | 3300025936 | Ga0207670_10587736 | Ga0207670_105877362 | 226 |
| 467 | 3300025941 | Ga0207711_10008113 | Ga0207711_100081137 | 226 |
| 468 | 3300025941 | Ga0207711_10322617 | Ga0207711_103226172 | 226 |
| 469 | 3300025942 | Ga0207689_10187235 | Ga0207689_101872352 | 226 |
| 470 | 3300025942 | Ga0207689_10265424 | Ga0207689_102654242 | 226 |
| 471 | 3300025960 | Ga0207651_10145476 | Ga0207651_101454762 | 226 |
| 472 | 3300025981 | Ga0207640_10016956 | Ga0207640_100169562 | 226 |
| 473 | 3300025981 | Ga0207640_10135703 | Ga0207640_101357033 | 226 |
| 474 | 3300025986 | Ga0207658_10106351 | Ga0207658_101063512 | 226 |
| 475 | 3300026035 | Ga0207703_10196591 | Ga0207703_101965913 | 226 |
| 476 | 3300026041 | Ga0207639_10577705 | Ga0207639_105777052 | 226 |
| 477 | 3300026075 | Ga0207708_10000017 | Ga0207708_10000017111 | 226 |
| 478 | 3300026088 | Ga0207641_10125889 | Ga0207641_101258892 | 226 |
| 479 | 3300026088 | Ga0207641_10426174 | Ga0207641_104261742 | 226 |
| 480 | 3300026088 | Ga0207641_10521749 | Ga0207641_105217493 | 226 |
| 481 | 3300026089 | Ga0207648_10249173 | Ga0207648_102491732 | 226 |
| 482 | 3300026089 | Ga0207648_10290497 | Ga0207648_102904972 | 226 |
| 483 | 3300026095 | Ga0207676_10058419 | Ga0207676_100584193 | 226 |
| 484 | 3300026095 | Ga0207676_10107655 | Ga0207676_101076552 | 226 |
| 485 | 3300026095 | Ga0207676_10137077 | Ga0207676_101370772 | 226 |
| 486 | 3300026095 | Ga0207676_10595471 | Ga0207676_105954712 | 226 |
| 487 | 3300026095 | Ga0207676_10597252 | Ga0207676_105972522 | 226 |
| 488 | 3300026095 | Ga0207676_10698862 | Ga0207676_106988621 | 226 |
| 489 | 3300026118 | Ga0207675_100004402 | Ga0207675_1000044022 | 226 |
| 490 | 3300026142 | Ga0207698_10071353 | Ga0207698_100713534 | 226 |
| 491 | 3300026142 | Ga0207698_10360396 | Ga0207698_103603962 | 226 |
| 492 | 3300028380 | Ga0268265_10306453 | Ga0268265_103064532 | 226 |
| 493 | 3300028381 | Ga0268264_10855332 | Ga0268264_108553322 | 226 |
| 494 | 3300031548 | Ga0307408_100006178 | Ga0307408_1000061785 | 226 |
| 495 | 3300031548 | Ga0307408_100098497 | Ga0307408_1000984972 | 226 |
| 496 | 3300031731 | Ga0307405_10004641 | Ga0307405_100046414 | 226 |
| 497 | 3300031852 | Ga0307410_10069655 | Ga0307410_100696552 | 226 |
| 498 | 3300031901 | Ga0307406_10000720 | Ga0307406_100007205 | 226 |
| 499 | 3300031903 | Ga0307407_10330832 | Ga0307407_103308321 | 226 |
| 500 | 3300031911 | Ga0307412_10012138 | Ga0307412_100121387 | 226 |
| 501 | 3300032004 | Ga0307414_10021134 | Ga0307414_100211347 | 226 |
| 502 | 3300032005 | Ga0307411_10037911 | Ga0307411_100379112 | 226 |
| 503 | 3300032126 | Ga0307415_100088855 | Ga0307415_1000888552 | 226 |
| 504 | 3300035092 | Ga0373952_0047472 | Ga0373952_0047472_205_885 | 226 |
| 505 | 3300035121 | Ga0373960_0055006 | Ga0373960_0055006_255_935 | 226 |
| 506 | 3300037418 | Ga0395900_0048967 | Ga0395900_0048967_729_1409 | 226 |
| 507 | 3300038443 | Ga0395901_0398604 | Ga0395901_0398604_267_947 | 226 |
| 508 | 3300042005 | Ga0439448_0139057 | Ga0439448_0139057_50_730 | 226 |
| 509 | 3300042144 | Ga0450889_003289 | Ga0450889_003289_354_1034 | 226 |
| 510 | 3300045976 | Ga0466967_0396115 | Ga0466967_0396115_109_789 | 226 |
| 511 | 3300048905 | Ga0496102_0018502 | Ga0496102_0018502_5234_5935 | 226 |
| 512 | 3300048907 | Ga0496104_0383001 | Ga0496104_0383001_534_1235 | 226 |
| 513 | 3300048911 | Ga0496108_0233021 | Ga0496108_0233021_32_733 | 226 |
| 514 | 3300048915 | Ga0496112_0102304 | Ga0496112_0102304_934_1614 | 226 |
| 515 | 3300049514 | Ga0501291_041944 | Ga0501291_041944_20_700 | 226 |
| 516 | 3300049649 | Ga0501198_000621 | Ga0501198_000621_1778_2458 | 226 |
| 517 | 3300049661 | Ga0501217_001210 | Ga0501217_001210_3264_3944 | 226 |
| 518 | 3300049663 | Ga0501223_000855 | Ga0501223_000855_3239_3919 | 226 |
| 519 | 3300049663 | Ga0501223_009006 | Ga0501223_009006_739_1419 | 226 |
| 520 | 3300049665 | Ga0501227_000381 | Ga0501227_000381_3160_3840 | 226 |
| 521 | 3300049667 | Ga0501230_003826 | Ga0501230_003826_1139_1819 | 226 |
| 522 | 3300049668 | Ga0501233_002731 | Ga0501233_002731_1525_2205 | 226 |
| 523 | 3300049669 | Ga0501235_000548 | Ga0501235_000548_5630_6310 | 226 |
| 524 | 3300049673 | Ga0501240_000136 | Ga0501240_000136_2008_2688 | 226 |
| 525 | 3300049680 | Ga0501250_015666 | Ga0501250_015666_20_700 | 226 |
| 526 | 3300049683 | Ga0501253_002493 | Ga0501253_002493_97_777 | 226 |
| 527 | 3300049686 | Ga0501257_004958 | Ga0501257_004958_686_1366 | 226 |
| 528 | 3300049704 | Ga0501221_004881 | Ga0501221_004881_1509_2189 | 226 |
| 529 | 3300049705 | Ga0501225_0000813 | Ga0501225_0000813_3609_4289 | 226 |
| 530 | 3300049707 | Ga0501234_000120 | Ga0501234_000120_6476_7156 | 226 |
| 531 | 3300049853 | Ga0501226_000367 | Ga0501226_000367_5766_6446 | 226 |
| 532 | 3300050507 | nmdc:mga05p37_231649_c1 | nmdc:mga05p37_231649_c1_1490_2170 | 226 |
| 533 | 3300050507 | nmdc:mga05p37_65590_c1 | nmdc:mga05p37_65590_c1_2504_3184 | 226 |
| 534 | 3300050507 | nmdc:mga05p37_806229_c1 | nmdc:mga05p37_806229_c1_110_790 | 226 |
| 535 | 3300050511 | nmdc:mga08y16_22040_c1 | nmdc:mga08y16_22040_c1_2932_3612 | 226 |
| 536 | 3300050512 | nmdc:mga0n895_299898_c1 | nmdc:mga0n895_299898_c1_60_740 | 226 |
| 537 | 3300050512 | nmdc:mga0n895_53598_c1 | nmdc:mga0n895_53598_c1_230_910 | 226 |
| 538 | 3300050515 | nmdc:mga0a205_43103_c1 | nmdc:mga0a205_43103_c1_550_1230 | 226 |
| 539 | 3300050515 | nmdc:mga0a205_48984_c1 | nmdc:mga0a205_48984_c1_3082_3762 | 226 |
| 540 | 3300050515 | nmdc:mga0a205_54423_c1 | nmdc:mga0a205_54423_c1_768_1448 | 226 |
| 541 | 3300050515 | nmdc:mga0a205_57361_c1 | nmdc:mga0a205_57361_c1_598_1278 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g3d-assembly1.cif.gz_3D | 48-nm doublet microtubule from tetrahymena thermophila strain k40r | 0.9265 | 5 | 225 |
| 8g3d-assembly1.cif.gz_3D | 48-nm doublet microtubule from tetrahymena thermophila strain k40r | 0.9029 | 5 | 225 |
| 3f67-assembly1.cif.gz_A | crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 | 0.898 | 1 | 222 |
| 4zi5-assembly1.cif.gz_B | crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries | 0.885 | 1 | 225 |
| 1zi8-assembly1.cif.gz_A | crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a | 0.8824 | 5 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XF92_3_241_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8972 | 3 | 220 | 3.40.50.1820 |
| af_A0A1P8AZN3_78_316_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8957 | 2 | 224 | 3.40.50.1820 |
| af_Q5AI87_1_234_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8833 | 16 | 224 | 3.40.50.1820 |
| 4zi5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8818 | 1 | 225 | 3.40.50.1820 |
| 3f67A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8814 | 1 | 222 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7RPM4-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9922 | 146 | 224 |
GO:0016787
|
| AF-A0A2V8PCK0-F1-model_v4 | Carboxymethylenebutenolidase | 0.9857 | 149 | 224 |
GO:0016787
|
| AF-A0A6L8GJE8-F1-model_v4 | Dienelactone hydrolase family protein | 0.984 | 92 | 224 |
GO:0016787
|
| AF-A0A2V8Q4H5-F1-model_v4 | Dienelactone hydrolase | 0.9822 | 1 | 224 |
GO:0016787
|
| AF-A0A1Q3MQA1-F1-model_v4 | Dienelactone hydrolase domain-containing protein | 0.9798 | 1 | 226 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar