F461358

General Info

Members Datasets Scaffolds Average Seq Length
541 193 1082 207

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10010263|Ga0105243_100102637
Length 239
Sequence LRFHCPLSTQNAKPVAPLDCFATLATTMRRASLLALSLALSACSAMNPGGAVIQSPVRDWRQIATPDDRERLRDWRDAFVSALQSARRAGHAAEIIREGALLEPDAALGGGPIPNGDYRCRVIKLGAKSPGMLDYVGYPAFTCRIGPEAGGPEAGLQSFAKLTGSQRQVGVIFPGDAMRQVFLGTVVLGDERRAMQYGRDEERDVAGFVERIGPGRWRMLMPRPHFESQIDVLELIPSG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
162 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 4.44
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10010263 3300009148 Bacteria 7116
2 MBSR1b_contig_11995805 2162886012 Bacteria 1571
3 JGI24752J21851_1005752 3300001976 Bacteria 1619
4 JGI24740J21852_10008606 3300001979 Bacteria 4054
5 JGI24740J21852_10080269 3300001979 Unclassified 856
6 JGI24739J22299_10004570 3300001989 Bacteria 5291
7 JGI24737J22298_10049506 3300001990 Bacteria 1278
8 JGI24738J21930_10005981 3300002075 Bacteria 2888
9 rootL2_10019461 3300003322 Bacteria 1716
10 rootL2_10131988 3300003322 Bacteria 1226
11 Ga0065712_10069297 3300005290 Bacteria 7578
12 Ga0065712_10148980 3300005290 Bacteria 1383
13 Ga0065715_10010203 3300005293 Bacteria 2191
14 Ga0065715_10100415 3300005293 Bacteria 3306
15 Ga0070658_10116949 3300005327 Bacteria 2213
16 Ga0070658_10482841 3300005327 Bacteria 1069
17 Ga0070658_10581179 3300005327 Unclassified 970
18 Ga0070676_10016051 3300005328 Bacteria 4136
19 Ga0070676_10043234 3300005328 Bacteria 2618
20 Ga0070676_10268193 3300005328 Bacteria 1145
21 Ga0070676_10386293 3300005328 Bacteria 971
22 Ga0070676_10548005 3300005328 Unclassified 827
23 Ga0070690_100012770 3300005330 Bacteria 4947
24 Ga0070670_100003993 3300005331 Bacteria 12312
25 Ga0070670_100016505 3300005331 Bacteria 6339
26 Ga0070670_100025677 3300005331 Bacteria 5068
27 Ga0070670_100106155 3300005331 Bacteria 2420
28 Ga0070670_100155137 3300005331 Bacteria 1983
29 Ga0070670_100300424 3300005331 Bacteria 1404
30 Ga0070670_100804165 3300005331 Bacteria 849
31 Ga0070677_10000547 3300005333 Bacteria 12846
32 Ga0070677_10039073 3300005333 Bacteria 1860
33 Ga0070677_10051945 3300005333 Bacteria 1661
34 Ga0070666_10009895 3300005335 Bacteria 5952
35 Ga0070666_10011710 3300005335 Bacteria 5515
36 Ga0068868_100019472 3300005338 Bacteria 5085
37 Ga0068868_100080894 3300005338 Bacteria 2604
38 Ga0068868_100678067 3300005338 Bacteria 920
39 Ga0070660_100067580 3300005339 Bacteria 2785
40 Ga0070660_100074562 3300005339 Bacteria 2655
41 Ga0070660_100235708 3300005339 Bacteria 1489
42 Ga0070660_100593247 3300005339 Bacteria 926
43 Ga0070689_100468346 3300005340 Unclassified 1075
44 Ga0070687_100053013 3300005343 Bacteria 2108
45 Ga0070661_100034844 3300005344 Bacteria 3652
46 Ga0070661_100110310 3300005344 Bacteria 2054
47 Ga0070661_100112693 3300005344 Bacteria 2032
48 Ga0070661_100163717 3300005344 Bacteria 1685
49 Ga0070668_100092773 3300005347 Bacteria 2382
50 Ga0070668_100137506 3300005347 Bacteria 1966
51 Ga0070668_100193750 3300005347 Bacteria 1666
52 Ga0070668_100234052 3300005347 Bacteria 1519
53 Ga0070668_100421236 3300005347 Bacteria 1143
54 Ga0070668_100634231 3300005347 Bacteria 938
55 Ga0070668_100996030 3300005347 Bacteria 753
56 Ga0070669_100015137 3300005353 Bacteria 5495
57 Ga0070669_100017151 3300005353 Bacteria 5167
58 Ga0070669_100072065 3300005353 Bacteria 2557
59 Ga0070669_100188452 3300005353 Bacteria 1617
60 Ga0070669_100248479 3300005353 Bacteria 1416
61 Ga0070675_100000380 3300005354 Bacteria 30037
62 Ga0070675_100333059 3300005354 Bacteria 1343
63 Ga0070675_100431998 3300005354 Bacteria 1179
64 Ga0070671_100000337 3300005355 Bacteria 32248
65 Ga0070671_100000924 3300005355 Bacteria 21451
66 Ga0070671_100002491 3300005355 Bacteria 14250
67 Ga0070671_100016461 3300005355 Bacteria 5979
68 Ga0070671_100049644 3300005355 Bacteria 3491
69 Ga0070671_100198041 3300005355 Bacteria 1703
70 Ga0070671_100236847 3300005355 Bacteria 1549
71 Ga0070674_100045175 3300005356 Bacteria 3009
72 Ga0070674_100132533 3300005356 Bacteria 1860
73 Ga0070674_100256481 3300005356 Bacteria 1376
74 Ga0070674_100512550 3300005356 Bacteria 1001
75 Ga0070673_100003514 3300005364 Bacteria 9767
76 Ga0070673_100007608 3300005364 Bacteria 7167
77 Ga0070673_100015148 3300005364 Bacteria 5403
78 Ga0070673_100186438 3300005364 Bacteria 1779
79 Ga0070659_100001999 3300005366 Bacteria 14575
80 Ga0070659_100023194 3300005366 Bacteria 4746
81 Ga0070659_100368724 3300005366 Bacteria 1208
82 Ga0070667_100003386 3300005367 Bacteria 13598
83 Ga0070667_100038001 3300005367 Bacteria 4037
84 Ga0070667_100184998 3300005367 Bacteria 1843
85 Ga0070705_100854057 3300005440 Bacteria 728
86 Ga0070663_100160179 3300005455 Bacteria 1732
87 Ga0070663_100717399 3300005455 Bacteria 851
88 Ga0070678_100000602 3300005456 Bacteria 17695
89 Ga0070678_100002620 3300005456 Bacteria 9894
90 Ga0070678_100186129 3300005456 Bacteria 1704
91 Ga0070678_101012216 3300005456 Bacteria 764
92 Ga0070678_101113651 3300005456 Unclassified 729
93 Ga0070662_100002702 3300005457 Bacteria 10946
94 Ga0070662_100007890 3300005457 Bacteria 6919
95 Ga0070662_100015544 3300005457 Bacteria 5101
96 Ga0070662_100037849 3300005457 Bacteria 3423
97 Ga0070662_100044477 3300005457 Bacteria 3181
98 Ga0070662_100054840 3300005457 Bacteria 2889
99 Ga0070662_100056939 3300005457 Bacteria 2839
100 Ga0070662_100109772 3300005457 Bacteria 2100
101 Ga0070662_100614361 3300005457 Bacteria 915
102 Ga0070681_10282638 3300005458 Bacteria 1570
103 Ga0068867_100037690 3300005459 Bacteria 3515
104 Ga0068867_100145734 3300005459 Bacteria 1855
105 Ga0068867_100154266 3300005459 Bacteria 1806
106 Ga0068867_100155278 3300005459 Bacteria 1801
107 Ga0068867_100917574 3300005459 Bacteria 789
108 Ga0070706_100295316 3300005467 Bacteria 1512
109 Ga0070679_100816792 3300005530 Bacteria 875
110 Ga0070684_100819572 3300005535 Bacteria 870
111 Ga0068853_100029331 3300005539 Bacteria 4637
112 Ga0068853_100034237 3300005539 Bacteria 4311
113 Ga0070672_100010262 3300005543 Bacteria 6491
114 Ga0070672_100023499 3300005543 Bacteria 4545
115 Ga0070672_100045198 3300005543 Bacteria 3405
116 Ga0070672_100061989 3300005543 Bacteria 2950
117 Ga0070672_100228028 3300005543 Bacteria 1564
118 Ga0070686_100962449 3300005544 Bacteria 698
119 Ga0070695_100194667 3300005545 Bacteria 1445
120 Ga0070696_100010639 3300005546 Bacteria 6161
121 Ga0070696_100025528 3300005546 Bacteria 4018
122 Ga0070693_100051098 3300005547 Bacteria 2366
123 Ga0070693_100084135 3300005547 Bacteria 1903
124 Ga0070693_100352914 3300005547 Bacteria 1007
125 Ga0070665_100003808 3300005548 Bacteria 15970
126 Ga0070665_100008011 3300005548 Bacteria 10703
127 Ga0070665_100089815 3300005548 Bacteria 3078
128 Ga0070704_100103039 3300005549 Bacteria 2155
129 Ga0068855_100041950 3300005563 Bacteria 5422
130 Ga0070664_100001285 3300005564 Bacteria 20077
131 Ga0070664_100015197 3300005564 Bacteria 6289
132 Ga0070664_100016859 3300005564 Bacteria 5996
133 Ga0070664_100028030 3300005564 Bacteria 4684
134 Ga0070664_100171641 3300005564 Bacteria 1924
135 Ga0070664_100311524 3300005564 Bacteria 1424
136 Ga0070664_100405381 3300005564 Bacteria 1247
137 Ga0070664_100551611 3300005564 Bacteria 1066
138 Ga0068857_100037231 3300005577 Bacteria 4309
139 Ga0068854_100038293 3300005578 Bacteria 3372
140 Ga0068854_100123696 3300005578 Bacteria 1967
141 Ga0068856_100786747 3300005614 Bacteria 971
142 Ga0070702_100277438 3300005615 Unclassified 1149
143 Ga0068852_100076939 3300005616 Bacteria 2948
144 Ga0068852_100081599 3300005616 Bacteria 2871
145 Ga0068852_100189717 3300005616 Bacteria 1938
146 Ga0068852_100258250 3300005616 Bacteria 1672
147 Ga0068859_100218510 3300005617 Bacteria 1993
148 Ga0068859_100382750 3300005617 Bacteria 1502
149 Ga0068864_100009524 3300005618 Bacteria 8015
150 Ga0068864_100012243 3300005618 Bacteria 7089
151 Ga0068864_100029428 3300005618 Bacteria 4652
152 Ga0068866_10269159 3300005718 Bacteria 1051
153 Ga0068861_100066310 3300005719 Bacteria 2783
154 Ga0068861_100151195 3300005719 Bacteria 1905
155 Ga0068861_100442896 3300005719 Bacteria 1162
156 Ga0068851_10004398 3300005834 Bacteria 6351
157 Ga0068851_10055221 3300005834 Bacteria 2023
158 Ga0068863_100022325 3300005841 Bacteria 6042
159 Ga0068863_100104498 3300005841 Bacteria 2694
160 Ga0068863_100171142 3300005841 Bacteria 2083
161 Ga0068863_100275414 3300005841 Bacteria 1629
162 Ga0068858_100006526 3300005842 Bacteria 11350
163 Ga0068858_100006611 3300005842 Bacteria 11281
164 Ga0068858_100018408 3300005842 Bacteria 6538
165 Ga0068860_100022737 3300005843 Bacteria 6061
166 Ga0068860_100121270 3300005843 Bacteria 2503
167 Ga0068860_100641102 3300005843 Bacteria 1070
168 Ga0068860_101090321 3300005843 Bacteria 818
169 Ga0068862_100021857 3300005844 Bacteria 5349
170 Ga0068862_100042274 3300005844 Bacteria 3882
171 Ga0081539_10005679 3300005985 Bacteria 12518
172 Ga0097621_100010994 3300006237 Bacteria 6649
173 Ga0097621_100033482 3300006237 Bacteria 4093
174 Ga0068871_100004932 3300006358 Bacteria 9322
175 Ga0068871_100378319 3300006358 Bacteria 1257
176 Ga0068871_100726845 3300006358 Bacteria 911
177 Ga0075428_100360550 3300006844 Bacteria 1559
178 Ga0068865_100046675 3300006881 Bacteria 2973
179 Ga0097620_100218496 3300006931 Bacteria 1993
180 Ga0097620_100382754 3300006931 Bacteria 1502
181 Ga0075435_100420011 3300007076 Bacteria 1152
182 Ga0111539_10014044 3300009094 Bacteria 10007
183 Ga0111539_10282307 3300009094 Bacteria 1932
184 Ga0105245_10574488 3300009098 Bacteria 1151
185 Ga0105243_10169907 3300009148 Bacteria 1887
186 Ga0105241_10398205 3300009174 Bacteria 1207
187 Ga0105242_10313313 3300009176 Bacteria 1437
188 Ga0105242_10363749 3300009176 Bacteria 1339
189 Ga0105248_10000521 3300009177 Bacteria 43703
190 Ga0105248_10008414 3300009177 Bacteria 11324
191 Ga0105248_10079091 3300009177 Bacteria 3695
192 Ga0105248_10081362 3300009177 Bacteria 3640
193 Ga0105248_10116266 3300009177 Bacteria 3017
194 Ga0105248_10131855 3300009177 Bacteria 2820
195 Ga0105238_10581586 3300009551 Bacteria 1126
196 Ga0105249_10118804 3300009553 Bacteria 2510
197 Ga0105246_10026293 3300011119 Bacteria 3800
198 Ga0157373_10036605 3300013100 Bacteria 3521
199 Ga0157373_10047184 3300013100 Bacteria 3073
200 Ga0157373_10369488 3300013100 Bacteria 1025
201 Ga0157371_10091340 3300013102 Bacteria 2157
202 Ga0157371_10223673 3300013102 Bacteria 1352
203 Ga0157370_10146056 3300013104 Bacteria 2202
204 Ga0157374_10002120 3300013296 Bacteria 16700
205 Ga0157378_10034922 3300013297 Bacteria 4445
206 Ga0163162_10023149 3300013306 Bacteria 6127
207 Ga0163162_10025975 3300013306 Bacteria 5788
208 Ga0157372_10161617 3300013307 Bacteria 2589
209 Ga0157375_10002884 3300013308 Bacteria 14913
210 Ga0157375_10029509 3300013308 Bacteria 5159
211 Ga0157375_10370826 3300013308 Bacteria 1598
212 Ga0163163_10006365 3300014325 Bacteria 10309
213 Ga0163163_10205111 3300014325 Bacteria 2020
214 Ga0163163_10395831 3300014325 Bacteria 1439
215 Ga0157380_10004226 3300014326 Bacteria 9934
216 Ga0157380_10010391 3300014326 Bacteria 6696
217 Ga0157380_10893293 3300014326 Bacteria 914
218 Ga0157377_10094545 3300014745 Bacteria 1770
219 Ga0163161_10024622 3300017792 Bacteria 4253
220 Ga0163161_10146780 3300017792 Bacteria 1790
221 Ga0207697_10004536 3300025315 Bacteria 6618
222 Ga0207656_10012570 3300025321 Bacteria 3222
223 Ga0207656_10056216 3300025321 Bacteria 1715
224 Ga0207656_10099114 3300025321 Bacteria 1334
225 Ga0207682_10001617 3300025893 Bacteria 10343
226 Ga0207682_10117212 3300025893 Bacteria 1178
227 Ga0207682_10138597 3300025893 Bacteria 1090
228 Ga0207642_10157153 3300025899 Bacteria 1217
229 Ga0207688_10013296 3300025901 Bacteria 4472
230 Ga0207680_10026678 3300025903 Bacteria 3205
231 Ga0207680_10214869 3300025903 Bacteria 1316
232 Ga0207647_10000239 3300025904 Bacteria 44964
233 Ga0207645_10021609 3300025907 Bacteria 4195
234 Ga0207645_10054724 3300025907 Bacteria 2548
235 Ga0207645_10206974 3300025907 Unclassified 1292
236 Ga0207645_10316438 3300025907 Bacteria 1041
237 Ga0207705_10003772 3300025909 Bacteria 11543
238 Ga0207705_10016801 3300025909 Bacteria 5240
239 Ga0207705_10028470 3300025909 Bacteria 3983
240 Ga0207654_10353492 3300025911 Bacteria 1012
241 Ga0207707_10300121 3300025912 Bacteria 1389
242 Ga0207662_10140201 3300025918 Bacteria 1531
243 Ga0207657_10001311 3300025919 Bacteria 26393
244 Ga0207657_10023676 3300025919 Bacteria 5712
245 Ga0207657_10244946 3300025919 Bacteria 1430
246 Ga0207657_10310382 3300025919 Bacteria 1248
247 Ga0207649_10015318 3300025920 Bacteria 4309
248 Ga0207649_10173032 3300025920 Bacteria 1506
249 Ga0207649_10174409 3300025920 Bacteria 1500
250 Ga0207649_10199139 3300025920 Bacteria 1414
251 Ga0207652_10279036 3300025921 Bacteria 1507
252 Ga0207681_10055271 3300025923 Bacteria 2703
253 Ga0207681_10061590 3300025923 Bacteria 2580
254 Ga0207681_10062096 3300025923 Bacteria 2571
255 Ga0207681_10405476 3300025923 Bacteria 1102
256 Ga0207681_10579822 3300025923 Bacteria 925
257 Ga0207650_10008457 3300025925 Bacteria 7027
258 Ga0207650_10009234 3300025925 Bacteria 6738
259 Ga0207650_10029208 3300025925 Bacteria 3961
260 Ga0207650_10037078 3300025925 Bacteria 3551
261 Ga0207650_10062509 3300025925 Bacteria 2782
262 Ga0207650_10083111 3300025925 Bacteria 2432
263 Ga0207659_10003335 3300025926 Bacteria 9629
264 Ga0207659_10045296 3300025926 Bacteria 3100
265 Ga0207659_10373847 3300025926 Bacteria 1187
266 Ga0207659_10619763 3300025926 Unclassified 923
267 Ga0207687_10021683 3300025927 Bacteria 4270
268 Ga0207644_10001594 3300025931 Bacteria 14641
269 Ga0207644_10004312 3300025931 Bacteria 9228
270 Ga0207644_10004544 3300025931 Bacteria 9017
271 Ga0207644_10029307 3300025931 Bacteria 3818
272 Ga0207644_10039800 3300025931 Bacteria 3320
273 Ga0207644_10066376 3300025931 Bacteria 2627
274 Ga0207644_10235074 3300025931 Bacteria 1457
275 Ga0207690_10016776 3300025932 Bacteria 4463
276 Ga0207690_10031426 3300025932 Bacteria 3396
277 Ga0207690_10414911 3300025932 Bacteria 1076
278 Ga0207690_10458567 3300025932 Bacteria 1025
279 Ga0207690_10508887 3300025932 Bacteria 975
280 Ga0207706_10015230 3300025933 Bacteria 6956
281 Ga0207706_10015632 3300025933 Bacteria 6857
282 Ga0207706_10025436 3300025933 Bacteria 5304
283 Ga0207706_10028498 3300025933 Bacteria 4988
284 Ga0207706_10041020 3300025933 Bacteria 4103
285 Ga0207706_10044258 3300025933 Bacteria 3946
286 Ga0207706_10062755 3300025933 Bacteria 3272
287 Ga0207706_10105898 3300025933 Bacteria 2474
288 Ga0207706_10197795 3300025933 Bacteria 1763
289 Ga0207706_10259641 3300025933 Bacteria 1517
290 Ga0207709_10005704 3300025935 Bacteria 7032
291 Ga0207709_10118349 3300025935 Bacteria 1784
292 Ga0207669_10033818 3300025937 Bacteria 2890
293 Ga0207669_10045206 3300025937 Bacteria 2593
294 Ga0207669_10201759 3300025937 Bacteria 1444
295 Ga0207669_10246735 3300025937 Bacteria 1327
296 Ga0207704_10227056 3300025938 Bacteria 1386
297 Ga0207691_10003178 3300025940 Bacteria 16057
298 Ga0207691_10019432 3300025940 Bacteria 6428
299 Ga0207691_10022289 3300025940 Bacteria 5975
300 Ga0207691_10061444 3300025940 Bacteria 3412
301 Ga0207691_10524447 3300025940 Bacteria 1005
302 Ga0207711_10005655 3300025941 Bacteria 10562
303 Ga0207711_10008901 3300025941 Bacteria 8393
304 Ga0207711_10014021 3300025941 Bacteria 6659
305 Ga0207711_10041116 3300025941 Bacteria 3936
306 Ga0207711_10265888 3300025941 Bacteria 1577
307 Ga0207689_10020781 3300025942 Bacteria 5521
308 Ga0207679_10077337 3300025945 Bacteria 2531
309 Ga0207679_10134992 3300025945 Bacteria 1986
310 Ga0207679_10143353 3300025945 Bacteria 1934
311 Ga0207679_10189346 3300025945 Bacteria 1709
312 Ga0207679_10755021 3300025945 Unclassified 885
313 Ga0207667_10631363 3300025949 Bacteria 1078
314 Ga0207651_10001262 3300025960 Bacteria 11395
315 Ga0207651_10004130 3300025960 Bacteria 7256
316 Ga0207651_10061186 3300025960 Bacteria 2617
317 Ga0207712_10251357 3300025961 Bacteria 1429
318 Ga0207668_10011258 3300025972 Bacteria 5429
319 Ga0207668_10167440 3300025972 Bacteria 1720
320 Ga0207668_10167608 3300025972 Unclassified 1719
321 Ga0207668_10185683 3300025972 Bacteria 1644
322 Ga0207668_10277249 3300025972 Bacteria 1373
323 Ga0207668_10637957 3300025972 Bacteria 931
324 Ga0207668_10704235 3300025972 Bacteria 888
325 Ga0207640_10237654 3300025981 Bacteria 1406
326 Ga0207640_10238617 3300025981 Bacteria 1403
327 Ga0207640_10251046 3300025981 Bacteria 1373
328 Ga0207640_10257410 3300025981 Bacteria 1358
329 Ga0207658_10011302 3300025986 Bacteria 6079
330 Ga0207658_10011953 3300025986 Bacteria 5918
331 Ga0207658_10026494 3300025986 Bacteria 4065
332 Ga0207677_10020257 3300026023 Bacteria 4035
333 Ga0207703_10036014 3300026035 Bacteria 3935
334 Ga0207703_10040205 3300026035 Bacteria 3741
335 Ga0207703_10101077 3300026035 Bacteria 2444
336 Ga0207639_10040623 3300026041 Bacteria 3473
337 Ga0207678_10014598 3300026067 Bacteria 6913
338 Ga0207678_10029821 3300026067 Bacteria 4763
339 Ga0207678_10096825 3300026067 Bacteria 2522
340 Ga0207678_10422989 3300026067 Bacteria 1155
341 Ga0207702_10580703 3300026078 Bacteria 1098
342 Ga0207641_10017502 3300026088 Bacteria 5867
343 Ga0207641_10107343 3300026088 Bacteria 2469
344 Ga0207641_10275314 3300026088 Bacteria 1581
345 Ga0207648_10001018 3300026089 Bacteria 31561
346 Ga0207648_10047592 3300026089 Bacteria 3758
347 Ga0207648_10052754 3300026089 Bacteria 3556
348 Ga0207676_10005559 3300026095 Bacteria 8917
349 Ga0207676_10009599 3300026095 Bacteria 6890
350 Ga0207676_11266377 3300026095 Bacteria 732
351 Ga0207674_10003888 3300026116 Bacteria 18186
352 Ga0207674_10029229 3300026116 Bacteria 5805
353 Ga0207674_10031983 3300026116 Bacteria 5521
354 Ga0207675_100092555 3300026118 Bacteria 2843
355 Ga0207675_100185216 3300026118 Bacteria 1995
356 Ga0207675_100581721 3300026118 Bacteria 1121
357 Ga0207683_10002409 3300026121 Bacteria 16335
358 Ga0207683_10005677 3300026121 Bacteria 10699
359 Ga0207683_10192682 3300026121 Bacteria 1851
360 Ga0207683_10494891 3300026121 Bacteria 1129
361 Ga0207683_10511221 3300026121 Bacteria 1110
362 Ga0207698_10021384 3300026142 Bacteria 4473
363 Ga0207698_10043104 3300026142 Bacteria 3378
364 Ga0207698_10113679 3300026142 Bacteria 2275
365 Ga0207698_10232148 3300026142 Bacteria 1675
366 Ga0207698_10632056 3300026142 Bacteria 1058
367 Ga0209974_10014659 3300027876 Bacteria 2606
368 Ga0268266_10000135 3300028379 Bacteria 141959
369 Ga0268266_10014446 3300028379 Bacteria 6788
370 Ga0268266_10109196 3300028379 Bacteria 2449
371 Ga0268266_10154698 3300028379 Bacteria 2070
372 Ga0268265_10015055 3300028380 Bacteria 5282
373 Ga0268265_10188920 3300028380 Bacteria 1777
374 Ga0268265_10476322 3300028380 Bacteria 1171
375 Ga0268264_10014439 3300028381 Bacteria 6490
376 Ga0316182_1038888 3300030745 Bacteria 920
377 Ga0307408_100011562 3300031548 Bacteria 5833
378 Ga0307408_100114059 3300031548 Bacteria 2081
379 Ga0307408_100157372 3300031548 Bacteria 1801
380 Ga0307408_100339147 3300031548 Bacteria 1272
381 Ga0307408_100536433 3300031548 Bacteria 1030
382 Ga0307408_100560999 3300031548 Unclassified 1009
383 Ga0307405_10043386 3300031731 Bacteria 2744
384 Ga0307405_10049738 3300031731 Bacteria 2592
385 Ga0307405_10092504 3300031731 Bacteria 2006
386 Ga0307405_10189824 3300031731 Bacteria 1483
387 Ga0307405_10217481 3300031731 Bacteria 1400
388 Ga0307413_10011831 3300031824 Bacteria 4311
389 Ga0307413_10017588 3300031824 Bacteria 3728
390 Ga0307413_10159125 3300031824 Bacteria 1584
391 Ga0307413_10168665 3300031824 Bacteria 1547
392 Ga0307413_10209535 3300031824 Bacteria 1414
393 Ga0307413_10237271 3300031824 Bacteria 1344
394 Ga0307410_10007309 3300031852 Bacteria 6036
395 Ga0307410_10024761 3300031852 Bacteria 3755
396 Ga0307410_10025770 3300031852 Bacteria 3693
397 Ga0307410_10025803 3300031852 Bacteria 3691
398 Ga0307410_10042393 3300031852 Bacteria 3008
399 Ga0307410_10060921 3300031852 Bacteria 2581
400 Ga0307410_10207023 3300031852 Bacteria 1501
401 Ga0307406_10029565 3300031901 Bacteria 3319
402 Ga0307406_10046400 3300031901 Bacteria 2733
403 Ga0307406_10114545 3300031901 Bacteria 1862
404 Ga0307406_10418663 3300031901 Bacteria 1067
405 Ga0307406_10558785 3300031901 Bacteria 937
406 Ga0307407_10022945 3300031903 Bacteria 3247
407 Ga0307407_10067874 3300031903 Bacteria 2109
408 Ga0307407_10140901 3300031903 Bacteria 1555
409 Ga0307412_10013048 3300031911 Bacteria 4858
410 Ga0307412_10024803 3300031911 Bacteria 3705
411 Ga0307412_10045811 3300031911 Bacteria 2861
412 Ga0307412_10279108 3300031911 Bacteria 1311
413 Ga0307412_10368837 3300031911 Bacteria 1158
414 Ga0307409_100000503 3300031995 Bacteria 16872
415 Ga0307409_100010012 3300031995 Bacteria 5862
416 Ga0307409_100054098 3300031995 Bacteria 3089
417 Ga0307409_100061578 3300031995 Bacteria 2933
418 Ga0307409_100078247 3300031995 Bacteria 2659
419 Ga0307409_100123009 3300031995 Bacteria 2201
420 Ga0307409_100197337 3300031995 Bacteria 1797
421 Ga0307409_100208332 3300031995 Bacteria 1755
422 Ga0307409_100252853 3300031995 Bacteria 1612
423 Ga0307409_100383013 3300031995 Bacteria 1338
424 Ga0307409_100397305 3300031995 Unclassified 1315
425 Ga0307409_100567171 3300031995 Bacteria 1117
426 Ga0307409_100621474 3300031995 Bacteria 1070
427 Ga0307409_100698400 3300031995 Bacteria 1013
428 Ga0307409_100768141 3300031995 Bacteria 969
429 Ga0307409_100825067 3300031995 Bacteria 936
430 Ga0307409_100855301 3300031995 Bacteria 920
431 Ga0307416_100037845 3300032002 Bacteria 3717
432 Ga0307416_100092554 3300032002 Bacteria 2601
433 Ga0307416_100121918 3300032002 Bacteria 2325
434 Ga0307416_100153206 3300032002 Bacteria 2118
435 Ga0307416_100236736 3300032002 Bacteria 1765
436 Ga0307416_100453331 3300032002 Bacteria 1336
437 Ga0307416_100965232 3300032002 Bacteria 954
438 Ga0307416_101165116 3300032002 Bacteria 876
439 Ga0307416_101243019 3300032002 Bacteria 850
440 Ga0307416_101344218 3300032002 Bacteria 820
441 Ga0307416_101587077 3300032002 Bacteria 760
442 Ga0307414_10003092 3300032004 Bacteria 8835
443 Ga0307414_10007243 3300032004 Bacteria 6230
444 Ga0307414_10086500 3300032004 Bacteria 2313
445 Ga0307414_10115698 3300032004 Bacteria 2051
446 Ga0307414_10121065 3300032004 Bacteria 2012
447 Ga0307414_10134405 3300032004 Bacteria 1926
448 Ga0307414_10211183 3300032004 Bacteria 1586
449 Ga0307414_10362499 3300032004 Bacteria 1248
450 Ga0307411_10001596 3300032005 Bacteria 9413
451 Ga0307411_10002260 3300032005 Bacteria 8423
452 Ga0307411_10010654 3300032005 Bacteria 4914
453 Ga0307411_10017800 3300032005 Bacteria 4061
454 Ga0307411_10028195 3300032005 Bacteria 3410
455 Ga0307411_10050975 3300032005 Bacteria 2698
456 Ga0307411_10153838 3300032005 Bacteria 1713
457 Ga0307411_10236838 3300032005 Bacteria 1426
458 Ga0307411_10240583 3300032005 Bacteria 1417
459 Ga0307411_10286478 3300032005 Bacteria 1314
460 Ga0307411_10515490 3300032005 Bacteria 1014
461 Ga0307411_10818997 3300032005 Bacteria 821
462 Ga0307415_100031919 3300032126 Bacteria 3400
463 Ga0307415_100047701 3300032126 Bacteria 2884
464 Ga0307415_100104647 3300032126 Bacteria 2085
465 Ga0307415_100121859 3300032126 Bacteria 1957
466 Ga0307415_100130318 3300032126 Bacteria 1902
467 Ga0307415_100178467 3300032126 Bacteria 1663
468 Ga0307415_100529071 3300032126 Bacteria 1036
469 Ga0395899_0000162 3300037312 Bacteria 102362
470 Ga0395899_0000274 3300037312 Bacteria 67210
471 Ga0395899_0107052 3300037312 Bacteria 2013
472 Ga0395900_0000129 3300037418 Bacteria 126281
473 Ga0395900_0001146 3300037418 Bacteria 33378
474 Ga0395900_0116555 3300037418 Bacteria 2741
475 Ga0395900_0208209 3300037418 Bacteria 1976
476 Ga0395898_0000788 3300037466 Bacteria 54310
477 Ga0395898_0022547 3300037466 Bacteria 6377
478 Ga0395905_0000980 3300037471 Bacteria 36613
479 Ga0395905_0001287 3300037471 Bacteria 30898
480 Ga0395905_0085980 3300037471 Bacteria 2947
481 Ga0395905_0141418 3300037471 Bacteria 2264
482 Ga0395905_0149282 3300037471 Bacteria 2199
483 Ga0395905_0172920 3300037471 Bacteria 2029
484 Ga0395905_0203135 3300037471 Bacteria 1857
485 Ga0395901_0000111 3300038443 Bacteria 112522
486 Ga0395901_0000866 3300038443 Bacteria 33378
487 Ga0395901_0123626 3300038443 Bacteria 2719
488 Ga0439438_069208 3300041405 Bacteria 875
489 Ga0439465_0061114 3300041413 Bacteria 1249
490 Ga0450892_003842 3300042130 Bacteria 1230
491 Ga0450889_001229 3300042144 Bacteria 2668
492 Ga0439434_0149017 3300042435 Bacteria 774
493 Ga0439464_0000114 3300042439 Bacteria 12425
494 Ga0439464_0101209 3300042439 Unclassified 876
495 Ga0466970_0225852 3300044765 Bacteria 1046
496 Ga0466960_0107878 3300044901 Bacteria 1443
497 Ga0466960_0169566 3300044901 Bacteria 1177
498 Ga0466967_0064486 3300045976 Bacteria 3258
499 Ga0466967_0066740 3300045976 Bacteria 3207
500 Ga0466967_0469580 3300045976 Bacteria 1231
501 Ga0466967_1403014 3300045976 Bacteria 696
502 Ga0495585_0016914 3300046492 Bacteria 4224
503 Ga0495631_0044960 3300046518 Bacteria 1945
504 Ga0495663_0001307 3300046525 Bacteria 7894
505 Ga0495663_0129722 3300046525 Bacteria 849
506 Ga0495598_0000568 3300046537 Bacteria 6943
507 Ga0495656_0039833 3300046615 Bacteria 1955
508 Ga0495661_0166525 3300046665 Bacteria 1179
509 Ga0495669_0110716 3300046684 Bacteria 1282
510 Ga0495677_0015827 3300047445 Bacteria 2738
511 Ga0495677_0018677 3300047445 Bacteria 2513
512 Ga0496100_0032229 3300048903 Bacteria 3265
513 Ga0496101_0054452 3300048904 Bacteria 2888
514 Ga0496101_0130519 3300048904 Bacteria 1908
515 Ga0496103_0359529 3300048906 Bacteria 936
516 Ga0496107_0055272 3300048910 Bacteria 2867
517 Ga0496107_0191463 3300048910 Bacteria 1520
518 Ga0496108_0010243 3300048911 Bacteria 7611
519 Ga0496108_0184841 3300048911 Bacteria 1805
520 Ga0496109_0004212 3300048912 Bacteria 11999
521 Ga0496109_0054057 3300048912 Bacteria 3664
522 Ga0496109_0059913 3300048912 Bacteria 3478
523 Ga0496109_0159216 3300048912 Bacteria 2115
524 Ga0496109_0268101 3300048912 Bacteria 1609
525 Ga0496110_0003535 3300048913 Bacteria 11999
526 Ga0496110_0009730 3300048913 Bacteria 7785
527 Ga0496110_0107529 3300048913 Bacteria 2504
528 Ga0496110_1274832 3300048913 Unclassified 644
529 Ga0496111_0005304 3300048914 Bacteria 8234
530 Ga0496111_0033908 3300048914 Bacteria 3642
531 Ga0496112_0022378 3300048915 Bacteria 6024
532 Ga0496113_0028740 3300048916 Bacteria 4003
533 Ga0496113_0296270 3300048916 Bacteria 1295
534 Ga0496114_0091786 3300048917 Bacteria 2579
535 Ga0496115_0134893 3300048918 Bacteria 2035
536 Ga0501223_019064 3300049663 Bacteria 1348
537 Ga0501224_025253 3300049664 Unclassified 888
538 Ga0501249_019062 3300049679 Bacteria 1487
539 Ga0501268_042441 3300049765 Bacteria 860
540 nmdc:mga08y16_283042_c1 3300050511 Bacteria 1710
541 Ga0500658_0000188 3300053134 Bacteria 29351
542 Ga0105243_10010263
543 MBSR1b_contig_11995805
544 JGI24752J21851_1005752
545 JGI24740J21852_10008606
546 JGI24740J21852_10080269
547 JGI24739J22299_10004570
548 JGI24737J22298_10049506
549 JGI24738J21930_10005981
550 rootL2_10019461
551 rootL2_10131988
552 Ga0065712_10069297
553 Ga0065712_10148980
554 Ga0065715_10010203
555 Ga0065715_10100415
556 Ga0070658_10116949
557 Ga0070658_10482841
558 Ga0070658_10581179
559 Ga0070676_10016051
560 Ga0070676_10043234
561 Ga0070676_10268193
562 Ga0070676_10386293
563 Ga0070676_10548005
564 Ga0070690_100012770
565 Ga0070670_100003993
566 Ga0070670_100016505
567 Ga0070670_100025677
568 Ga0070670_100106155
569 Ga0070670_100155137
570 Ga0070670_100300424
571 Ga0070670_100804165
572 Ga0070677_10000547
573 Ga0070677_10039073
574 Ga0070677_10051945
575 Ga0070666_10009895
576 Ga0070666_10011710
577 Ga0068868_100019472
578 Ga0068868_100080894
579 Ga0068868_100678067
580 Ga0070660_100067580
581 Ga0070660_100074562
582 Ga0070660_100235708
583 Ga0070660_100593247
584 Ga0070689_100468346
585 Ga0070687_100053013
586 Ga0070661_100034844
587 Ga0070661_100110310
588 Ga0070661_100112693
589 Ga0070661_100163717
590 Ga0070668_100092773
591 Ga0070668_100137506
592 Ga0070668_100193750
593 Ga0070668_100234052
594 Ga0070668_100421236
595 Ga0070668_100634231
596 Ga0070668_100996030
597 Ga0070669_100015137
598 Ga0070669_100017151
599 Ga0070669_100072065
600 Ga0070669_100188452
601 Ga0070669_100248479
602 Ga0070675_100000380
603 Ga0070675_100333059
604 Ga0070675_100431998
605 Ga0070671_100000337
606 Ga0070671_100000924
607 Ga0070671_100002491
608 Ga0070671_100016461
609 Ga0070671_100049644
610 Ga0070671_100198041
611 Ga0070671_100236847
612 Ga0070674_100045175
613 Ga0070674_100132533
614 Ga0070674_100256481
615 Ga0070674_100512550
616 Ga0070673_100003514
617 Ga0070673_100007608
618 Ga0070673_100015148
619 Ga0070673_100186438
620 Ga0070659_100001999
621 Ga0070659_100023194
622 Ga0070659_100368724
623 Ga0070667_100003386
624 Ga0070667_100038001
625 Ga0070667_100184998
626 Ga0070705_100854057
627 Ga0070663_100160179
628 Ga0070663_100717399
629 Ga0070678_100000602
630 Ga0070678_100002620
631 Ga0070678_100186129
632 Ga0070678_101012216
633 Ga0070678_101113651
634 Ga0070662_100002702
635 Ga0070662_100007890
636 Ga0070662_100015544
637 Ga0070662_100037849
638 Ga0070662_100044477
639 Ga0070662_100054840
640 Ga0070662_100056939
641 Ga0070662_100109772
642 Ga0070662_100614361
643 Ga0070681_10282638
644 Ga0068867_100037690
645 Ga0068867_100145734
646 Ga0068867_100154266
647 Ga0068867_100155278
648 Ga0068867_100917574
649 Ga0070706_100295316
650 Ga0070679_100816792
651 Ga0070684_100819572
652 Ga0068853_100029331
653 Ga0068853_100034237
654 Ga0070672_100010262
655 Ga0070672_100023499
656 Ga0070672_100045198
657 Ga0070672_100061989
658 Ga0070672_100228028
659 Ga0070686_100962449
660 Ga0070695_100194667
661 Ga0070696_100010639
662 Ga0070696_100025528
663 Ga0070693_100051098
664 Ga0070693_100084135
665 Ga0070693_100352914
666 Ga0070665_100003808
667 Ga0070665_100008011
668 Ga0070665_100089815
669 Ga0070704_100103039
670 Ga0068855_100041950
671 Ga0070664_100001285
672 Ga0070664_100015197
673 Ga0070664_100016859
674 Ga0070664_100028030
675 Ga0070664_100171641
676 Ga0070664_100311524
677 Ga0070664_100405381
678 Ga0070664_100551611
679 Ga0068857_100037231
680 Ga0068854_100038293
681 Ga0068854_100123696
682 Ga0068856_100786747
683 Ga0070702_100277438
684 Ga0068852_100076939
685 Ga0068852_100081599
686 Ga0068852_100189717
687 Ga0068852_100258250
688 Ga0068859_100218510
689 Ga0068859_100382750
690 Ga0068864_100009524
691 Ga0068864_100012243
692 Ga0068864_100029428
693 Ga0068866_10269159
694 Ga0068861_100066310
695 Ga0068861_100151195
696 Ga0068861_100442896
697 Ga0068851_10004398
698 Ga0068851_10055221
699 Ga0068863_100022325
700 Ga0068863_100104498
701 Ga0068863_100171142
702 Ga0068863_100275414
703 Ga0068858_100006526
704 Ga0068858_100006611
705 Ga0068858_100018408
706 Ga0068860_100022737
707 Ga0068860_100121270
708 Ga0068860_100641102
709 Ga0068860_101090321
710 Ga0068862_100021857
711 Ga0068862_100042274
712 Ga0081539_10005679
713 Ga0097621_100010994
714 Ga0097621_100033482
715 Ga0068871_100004932
716 Ga0068871_100378319
717 Ga0068871_100726845
718 Ga0075428_100360550
719 Ga0068865_100046675
720 Ga0097620_100218496
721 Ga0097620_100382754
722 Ga0075435_100420011
723 Ga0111539_10014044
724 Ga0111539_10282307
725 Ga0105245_10574488
726 Ga0105243_10169907
727 Ga0105241_10398205
728 Ga0105242_10313313
729 Ga0105242_10363749
730 Ga0105248_10000521
731 Ga0105248_10008414
732 Ga0105248_10079091
733 Ga0105248_10081362
734 Ga0105248_10116266
735 Ga0105248_10131855
736 Ga0105238_10581586
737 Ga0105249_10118804
738 Ga0105246_10026293
739 Ga0157373_10036605
740 Ga0157373_10047184
741 Ga0157373_10369488
742 Ga0157371_10091340
743 Ga0157371_10223673
744 Ga0157370_10146056
745 Ga0157374_10002120
746 Ga0157378_10034922
747 Ga0163162_10023149
748 Ga0163162_10025975
749 Ga0157372_10161617
750 Ga0157375_10002884
751 Ga0157375_10029509
752 Ga0157375_10370826
753 Ga0163163_10006365
754 Ga0163163_10205111
755 Ga0163163_10395831
756 Ga0157380_10004226
757 Ga0157380_10010391
758 Ga0157380_10893293
759 Ga0157377_10094545
760 Ga0163161_10024622
761 Ga0163161_10146780
762 Ga0207697_10004536
763 Ga0207656_10012570
764 Ga0207656_10056216
765 Ga0207656_10099114
766 Ga0207682_10001617
767 Ga0207682_10117212
768 Ga0207682_10138597
769 Ga0207642_10157153
770 Ga0207688_10013296
771 Ga0207680_10026678
772 Ga0207680_10214869
773 Ga0207647_10000239
774 Ga0207645_10021609
775 Ga0207645_10054724
776 Ga0207645_10206974
777 Ga0207645_10316438
778 Ga0207705_10003772
779 Ga0207705_10016801
780 Ga0207705_10028470
781 Ga0207654_10353492
782 Ga0207707_10300121
783 Ga0207662_10140201
784 Ga0207657_10001311
785 Ga0207657_10023676
786 Ga0207657_10244946
787 Ga0207657_10310382
788 Ga0207649_10015318
789 Ga0207649_10173032
790 Ga0207649_10174409
791 Ga0207649_10199139
792 Ga0207652_10279036
793 Ga0207681_10055271
794 Ga0207681_10061590
795 Ga0207681_10062096
796 Ga0207681_10405476
797 Ga0207681_10579822
798 Ga0207650_10008457
799 Ga0207650_10009234
800 Ga0207650_10029208
801 Ga0207650_10037078
802 Ga0207650_10062509
803 Ga0207650_10083111
804 Ga0207659_10003335
805 Ga0207659_10045296
806 Ga0207659_10373847
807 Ga0207659_10619763
808 Ga0207687_10021683
809 Ga0207644_10001594
810 Ga0207644_10004312
811 Ga0207644_10004544
812 Ga0207644_10029307
813 Ga0207644_10039800
814 Ga0207644_10066376
815 Ga0207644_10235074
816 Ga0207690_10016776
817 Ga0207690_10031426
818 Ga0207690_10414911
819 Ga0207690_10458567
820 Ga0207690_10508887
821 Ga0207706_10015230
822 Ga0207706_10015632
823 Ga0207706_10025436
824 Ga0207706_10028498
825 Ga0207706_10041020
826 Ga0207706_10044258
827 Ga0207706_10062755
828 Ga0207706_10105898
829 Ga0207706_10197795
830 Ga0207706_10259641
831 Ga0207709_10005704
832 Ga0207709_10118349
833 Ga0207669_10033818
834 Ga0207669_10045206
835 Ga0207669_10201759
836 Ga0207669_10246735
837 Ga0207704_10227056
838 Ga0207691_10003178
839 Ga0207691_10019432
840 Ga0207691_10022289
841 Ga0207691_10061444
842 Ga0207691_10524447
843 Ga0207711_10005655
844 Ga0207711_10008901
845 Ga0207711_10014021
846 Ga0207711_10041116
847 Ga0207711_10265888
848 Ga0207689_10020781
849 Ga0207679_10077337
850 Ga0207679_10134992
851 Ga0207679_10143353
852 Ga0207679_10189346
853 Ga0207679_10755021
854 Ga0207667_10631363
855 Ga0207651_10001262
856 Ga0207651_10004130
857 Ga0207651_10061186
858 Ga0207712_10251357
859 Ga0207668_10011258
860 Ga0207668_10167440
861 Ga0207668_10167608
862 Ga0207668_10185683
863 Ga0207668_10277249
864 Ga0207668_10637957
865 Ga0207668_10704235
866 Ga0207640_10237654
867 Ga0207640_10238617
868 Ga0207640_10251046
869 Ga0207640_10257410
870 Ga0207658_10011302
871 Ga0207658_10011953
872 Ga0207658_10026494
873 Ga0207677_10020257
874 Ga0207703_10036014
875 Ga0207703_10040205
876 Ga0207703_10101077
877 Ga0207639_10040623
878 Ga0207678_10014598
879 Ga0207678_10029821
880 Ga0207678_10096825
881 Ga0207678_10422989
882 Ga0207702_10580703
883 Ga0207641_10017502
884 Ga0207641_10107343
885 Ga0207641_10275314
886 Ga0207648_10001018
887 Ga0207648_10047592
888 Ga0207648_10052754
889 Ga0207676_10005559
890 Ga0207676_10009599
891 Ga0207676_11266377
892 Ga0207674_10003888
893 Ga0207674_10029229
894 Ga0207674_10031983
895 Ga0207675_100092555
896 Ga0207675_100185216
897 Ga0207675_100581721
898 Ga0207683_10002409
899 Ga0207683_10005677
900 Ga0207683_10192682
901 Ga0207683_10494891
902 Ga0207683_10511221
903 Ga0207698_10021384
904 Ga0207698_10043104
905 Ga0207698_10113679
906 Ga0207698_10232148
907 Ga0207698_10632056
908 Ga0209974_10014659
909 Ga0268266_10000135
910 Ga0268266_10014446
911 Ga0268266_10109196
912 Ga0268266_10154698
913 Ga0268265_10015055
914 Ga0268265_10188920
915 Ga0268265_10476322
916 Ga0268264_10014439
917 Ga0316182_1038888
918 Ga0307408_100011562
919 Ga0307408_100114059
920 Ga0307408_100157372
921 Ga0307408_100339147
922 Ga0307408_100536433
923 Ga0307408_100560999
924 Ga0307405_10043386
925 Ga0307405_10049738
926 Ga0307405_10092504
927 Ga0307405_10189824
928 Ga0307405_10217481
929 Ga0307413_10011831
930 Ga0307413_10017588
931 Ga0307413_10159125
932 Ga0307413_10168665
933 Ga0307413_10209535
934 Ga0307413_10237271
935 Ga0307410_10007309
936 Ga0307410_10024761
937 Ga0307410_10025770
938 Ga0307410_10025803
939 Ga0307410_10042393
940 Ga0307410_10060921
941 Ga0307410_10207023
942 Ga0307406_10029565
943 Ga0307406_10046400
944 Ga0307406_10114545
945 Ga0307406_10418663
946 Ga0307406_10558785
947 Ga0307407_10022945
948 Ga0307407_10067874
949 Ga0307407_10140901
950 Ga0307412_10013048
951 Ga0307412_10024803
952 Ga0307412_10045811
953 Ga0307412_10279108
954 Ga0307412_10368837
955 Ga0307409_100000503
956 Ga0307409_100010012
957 Ga0307409_100054098
958 Ga0307409_100061578
959 Ga0307409_100078247
960 Ga0307409_100123009
961 Ga0307409_100197337
962 Ga0307409_100208332
963 Ga0307409_100252853
964 Ga0307409_100383013
965 Ga0307409_100397305
966 Ga0307409_100567171
967 Ga0307409_100621474
968 Ga0307409_100698400
969 Ga0307409_100768141
970 Ga0307409_100825067
971 Ga0307409_100855301
972 Ga0307416_100037845
973 Ga0307416_100092554
974 Ga0307416_100121918
975 Ga0307416_100153206
976 Ga0307416_100236736
977 Ga0307416_100453331
978 Ga0307416_100965232
979 Ga0307416_101165116
980 Ga0307416_101243019
981 Ga0307416_101344218
982 Ga0307416_101587077
983 Ga0307414_10003092
984 Ga0307414_10007243
985 Ga0307414_10086500
986 Ga0307414_10115698
987 Ga0307414_10121065
988 Ga0307414_10134405
989 Ga0307414_10211183
990 Ga0307414_10362499
991 Ga0307411_10001596
992 Ga0307411_10002260
993 Ga0307411_10010654
994 Ga0307411_10017800
995 Ga0307411_10028195
996 Ga0307411_10050975
997 Ga0307411_10153838
998 Ga0307411_10236838
999 Ga0307411_10240583
1000 Ga0307411_10286478
1001 Ga0307411_10515490
1002 Ga0307411_10818997
1003 Ga0307415_100031919
1004 Ga0307415_100047701
1005 Ga0307415_100104647
1006 Ga0307415_100121859
1007 Ga0307415_100130318
1008 Ga0307415_100178467
1009 Ga0307415_100529071
1010 Ga0395899_0000162
1011 Ga0395899_0000274
1012 Ga0395899_0107052
1013 Ga0395900_0000129
1014 Ga0395900_0001146
1015 Ga0395900_0116555
1016 Ga0395900_0208209
1017 Ga0395898_0000788
1018 Ga0395898_0022547
1019 Ga0395905_0000980
1020 Ga0395905_0001287
1021 Ga0395905_0085980
1022 Ga0395905_0141418
1023 Ga0395905_0149282
1024 Ga0395905_0172920
1025 Ga0395905_0203135
1026 Ga0395901_0000111
1027 Ga0395901_0000866
1028 Ga0395901_0123626
1029 Ga0439438_069208
1030 Ga0439465_0061114
1031 Ga0450892_003842
1032 Ga0450889_001229
1033 Ga0439434_0149017
1034 Ga0439464_0000114
1035 Ga0439464_0101209
1036 Ga0466970_0225852
1037 Ga0466960_0107878
1038 Ga0466960_0169566
1039 Ga0466967_0064486
1040 Ga0466967_0066740
1041 Ga0466967_0469580
1042 Ga0466967_1403014
1043 Ga0495585_0016914
1044 Ga0495631_0044960
1045 Ga0495663_0001307
1046 Ga0495663_0129722
1047 Ga0495598_0000568
1048 Ga0495656_0039833
1049 Ga0495661_0166525
1050 Ga0495669_0110716
1051 Ga0495677_0015827
1052 Ga0495677_0018677
1053 Ga0496100_0032229
1054 Ga0496101_0054452
1055 Ga0496101_0130519
1056 Ga0496103_0359529
1057 Ga0496107_0055272
1058 Ga0496107_0191463
1059 Ga0496108_0010243
1060 Ga0496108_0184841
1061 Ga0496109_0004212
1062 Ga0496109_0054057
1063 Ga0496109_0059913
1064 Ga0496109_0159216
1065 Ga0496109_0268101
1066 Ga0496110_0003535
1067 Ga0496110_0009730
1068 Ga0496110_0107529
1069 Ga0496110_1274832
1070 Ga0496111_0005304
1071 Ga0496111_0033908
1072 Ga0496112_0022378
1073 Ga0496113_0028740
1074 Ga0496113_0296270
1075 Ga0496114_0091786
1076 Ga0496115_0134893
1077 Ga0501223_019064
1078 Ga0501224_025253
1079 Ga0501249_019062
1080 Ga0501268_042441
1081 nmdc:mga08y16_283042_c1
1082 Ga0500658_0000188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16233

DUF4893

Domain of unknown function (DUF4893)

60

235

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kc5-assembly2.cif.gz_C crystal structure of the c-terminal part of rhie from burkholderia rhizoxinica 0.6555 165 199
6czh-assembly1.cif.gz_A structure of a redesigned beta barrel, mfap0, bound to dfhbi 0.6389 79 198
6czh-assembly1.cif.gz_A structure of a redesigned beta barrel, mfap0, bound to dfhbi 0.6285 79 198
6d0t-assembly2.cif.gz_B de novo design of a fluorescence-activating beta barrel - bb1 0.6214 83 199
5o1r-assembly2.cif.gz_B human fab 5h2 bound to nhba-c3 from neisseria meningitidis serogroup b 0.5768 78 198
ID Description Score Start End Superfamily
4kc5C03 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Polyketide synthase dehydratase 0.6555 165 199 3.10.129.110
1pbyA02 Mainly Beta;Beta Barrel;Lipocalin;Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 0.649 78 200 2.40.128.120
1pbyA02 Mainly Beta;Beta Barrel;Lipocalin;Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 0.6285 78 200 2.40.128.120
af_Q54BB2_1_127_2.40.128.30 Mainly Beta;Beta Barrel;Lipocalin;Avidin-like 0.6219 56 201 2.40.128.30
af_Q54BB2_1_127_2.40.128.30 Mainly Beta;Beta Barrel;Lipocalin;Avidin-like 0.6052 56 201 2.40.128.30
ID Description Score Start End GO Terms
AF-A0A0Q8XHT8-F1-model_v4 DUF4893 domain-containing protein 0.9892 29 201
AF-A0A147I0W5-F1-model_v4 DUF4893 domain-containing protein 0.9856 28 201
AF-A0A521TC32-F1-model_v4 deleted 0.9816 85 201
AF-A0A0Q5R0Z5-F1-model_v4 DUF4893 domain-containing protein 0.9793 26 201
AF-A0A7W9B4N0-F1-model_v4 DUF4893 domain-containing protein 0.9786 29 201

Map