F461266

General Info

Members Datasets Scaffolds Average Seq Length
540 365 1080 151

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0164765|Ga0466959_0164765_342_860
Length 172
Sequence MPLDQSFVGRTYPPTASYEVGREKIREFATAVRDLHPAYLDPEAAKALGHPDVIAPPTFPVIIAIPAAYQAVNDPEFGLGKSWVVHGDQKFVYQRPMRAGDRIECVVKIEAIKSIAGSDMITLASELRTVEGEPVCTAYGLFVVREDTSGSGSEDGGADATGTTGTAEAGES

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
222 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
249 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
250 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
251 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
254 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
255 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
256 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
257 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
258 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
259 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
264 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
265 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
266 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
267 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
268 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
269 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
270 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
275 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
276 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
277 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
278 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
279 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
280 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
281 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
282 2643221548 Streptomyces sp. Root55 Isolate Unclassified
283 2643221578 Streptomyces sp. Root63 Isolate Unclassified
284 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
285 2643221647 Streptomyces sp. Root369 Isolate Unclassified
286 2643221670 Streptomyces sp. Root431 Isolate Unclassified
287 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
288 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
289 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
290 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
291 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
292 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
293 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
294 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
295 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
296 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
297 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
298 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
299 2808606448 Streptomyces sp. 193411 Isolate Unclassified
300 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
301 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
302 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
303 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
304 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
305 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
306 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
307 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
308 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
309 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
310 2862574272 Streptomyces sp. AcE210 Isolate Nodule
311 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
312 2867369537 Streptomyces sp. Z26 Isolate Unclassified
313 2867428634 Streptomyces sp. RP5T Isolate Unclassified
314 2867475112 Streptomyces sp. TM32 Isolate Unclassified
315 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
316 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
317 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
318 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
319 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
320 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
321 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
322 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
323 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
324 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
325 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
326 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
327 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
328 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
329 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
330 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
331 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
332 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
333 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
334 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
335 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
336 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
337 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
338 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
339 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
340 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
341 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
342 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
343 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
344 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
345 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
346 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
347 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
348 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
349 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
350 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
351 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
352 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
353 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
354 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
355 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
356 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
357 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
358 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
359 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
360 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
361 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
362 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
363 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
364 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
365 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.3
Metatranscriptomes 1.67
Isolates 17.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0.56
Rhizoplane 0.93
Rhizosphere 80.56
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0164765 3300045049 Bacteria 1557
2 LJQas_1016423 3300000549 Bacteria 864
3 JGI25160J50197_1021265 3300003354 Bacteria 1933
4 Ga0070658_10152211 3300005327 Bacteria 1937
5 Ga0070658_10354370 3300005327 Bacteria 1256
6 Ga0070682_100667043 3300005337 Bacteria 830
7 Ga0068868_101770502 3300005338 Bacteria 583
8 Ga0070689_100219489 3300005340 Bacteria 1559
9 Ga0070674_100423950 3300005356 Bacteria 1092
10 Ga0070709_10025318 3300005434 Bacteria 3504
11 Ga0070714_100001921 3300005435 Bacteria 15173
12 Ga0070713_100058308 3300005436 Bacteria 3220
13 Ga0070713_100172255 3300005436 Bacteria 1940
14 Ga0070679_100298479 3300005530 Bacteria 1562
15 Ga0070679_100355083 3300005530 Bacteria 1413
16 Ga0070679_101874492 3300005530 Bacteria 548
17 Ga0070684_100054309 3300005535 Bacteria 3491
18 Ga0070697_100196880 3300005536 Bacteria 1712
19 Ga0070695_100675683 3300005545 Bacteria 817
20 Ga0070665_100117093 3300005548 Bacteria 2667
21 Ga0070665_101811443 3300005548 Bacteria 617
22 Ga0068855_100968059 3300005563 Bacteria 895
23 Ga0068856_100049636 3300005614 Bacteria 4136
24 Ga0068856_100169586 3300005614 Bacteria 2194
25 Ga0068856_100608415 3300005614 Bacteria 1114
26 Ga0068856_101187037 3300005614 Bacteria 780
27 Ga0068851_10138633 3300005834 Bacteria 1321
28 Ga0068863_100772173 3300005841 Bacteria 958
29 Ga0081455_10078282 3300005937 Bacteria 2717
30 Ga0081455_10451890 3300005937 Bacteria 877
31 Ga0081540_1000843 3300005983 Bacteria 27907
32 Ga0081540_1006423 3300005983 Bacteria 8557
33 Ga0070717_10123392 3300006028 Bacteria 2221
34 Ga0070717_10943321 3300006028 Bacteria 786
35 Ga0075432_10193233 3300006058 Bacteria 802
36 Ga0070712_100029137 3300006175 Bacteria 3699
37 Ga0070712_100154207 3300006175 Bacteria 1767
38 Ga0075428_100001967 3300006844 Bacteria 22115
39 Ga0075428_100611395 3300006844 Bacteria 1164
40 Ga0075428_100681020 3300006844 Bacteria 1096
41 Ga0075430_100517156 3300006846 Bacteria 985
42 Ga0075430_100867678 3300006846 Bacteria 744
43 Ga0075431_100567921 3300006847 Bacteria 1121
44 Ga0075433_10005917 3300006852 Bacteria 9635
45 Ga0075429_101597130 3300006880 Bacteria 567
46 Ga0068865_100416703 3300006881 Bacteria 1103
47 Ga0111539_10251029 3300009094 Bacteria 2060
48 Ga0105245_10269028 3300009098 Bacteria 1661
49 Ga0105245_10488224 3300009098 Bacteria 1246
50 Ga0105245_10736808 3300009098 Unclassified 1021
51 Ga0114129_10030888 3300009147 Bacteria 7576
52 Ga0114129_10170838 3300009147 Bacteria 2964
53 Ga0105243_10025061 3300009148 Bacteria 4555
54 Ga0105242_10227904 3300009176 Bacteria 1668
55 Ga0105242_10680509 3300009176 Bacteria 1004
56 Ga0105248_10118043 3300009177 Bacteria 2992
57 Ga0105249_10642107 3300009553 Bacteria 1119
58 Ga0105239_10454730 3300010375 Bacteria 1453
59 Ga0105239_10556811 3300010375 Bacteria 1306
60 Ga0105246_10204160 3300011119 Bacteria 1538
61 Ga0157370_10081130 3300013104 Bacteria 3053
62 Ga0157369_10010632 3300013105 Bacteria 10476
63 Ga0157369_10233565 3300013105 Bacteria 1922
64 Ga0157374_12703871 3300013296 Bacteria 524
65 Ga0157378_10106452 3300013297 Bacteria 2565
66 Ga0157372_11295654 3300013307 Bacteria 841
67 Ga0157372_12673976 3300013307 Bacteria 573
68 Ga0163163_10631046 3300014325 Bacteria 1135
69 Ga0157380_11200505 3300014326 Bacteria 802
70 Ga0183367_1002 3300015688 Bacteria 1101531
71 Ga0213876_10155458 3300021384 Bacteria 1216
72 Ga0224712_10007165 3300022467 Bacteria 3229
73 Ga0224712_10281924 3300022467 Bacteria 774
74 Ga0224712_10361935 3300022467 Bacteria 687
75 Ga0207426_1008834 3300025302 Bacteria 4033
76 Ga0207680_10217205 3300025903 Bacteria 1309
77 Ga0207699_10016621 3300025906 Bacteria 3853
78 Ga0207705_10044902 3300025909 Bacteria 3176
79 Ga0207663_10561005 3300025916 Bacteria 894
80 Ga0207657_10266547 3300025919 Bacteria 1362
81 Ga0207652_10410721 3300025921 Bacteria 1221
82 Ga0207652_10474973 3300025921 Bacteria 1126
83 Ga0207687_10259044 3300025927 Bacteria 1386
84 Ga0207687_10339281 3300025927 Bacteria 1221
85 Ga0207700_10061891 3300025928 Bacteria 2840
86 Ga0207700_10066590 3300025928 Bacteria 2754
87 Ga0207664_10001130 3300025929 Bacteria 17771
88 Ga0207706_10032995 3300025933 Bacteria 4608
89 Ga0207686_10217899 3300025934 Bacteria 1376
90 Ga0207686_10652851 3300025934 Bacteria 832
91 Ga0207670_10309830 3300025936 Bacteria 1239
92 Ga0207704_10221279 3300025938 Bacteria 1401
93 Ga0207704_10518256 3300025938 Bacteria 964
94 Ga0207711_10351479 3300025941 Bacteria 1365
95 Ga0207661_10782052 3300025944 Bacteria 879
96 Ga0207679_10834225 3300025945 Bacteria 841
97 Ga0207667_10453799 3300025949 Bacteria 1302
98 Ga0207712_10433582 3300025961 Bacteria 1111
99 Ga0207658_10478897 3300025986 Bacteria 1106
100 Ga0207658_10612851 3300025986 Bacteria 979
101 Ga0207708_10022093 3300026075 Bacteria 4805
102 Ga0207702_10035944 3300026078 Bacteria 4142
103 Ga0207702_10151705 3300026078 Bacteria 2108
104 Ga0207702_10469545 3300026078 Bacteria 1223
105 Ga0207641_10630693 3300026088 Bacteria 1051
106 Ga0207675_100673499 3300026118 Bacteria 1042
107 Ga0207428_10223110 3300027907 Bacteria 1412
108 Ga0268266_10248408 3300028379 Bacteria 1645
109 Ga0268266_11518112 3300028379 Bacteria 645
110 Ga0307517_10055288 3300028786 Bacteria 3900
111 Ga0307511_10029702 3300030521 Bacteria 4926
112 Ga0307511_10100508 3300030521 Bacteria 1902
113 Ga0316180_1148161 3300030736 Bacteria 772
114 Ga0307513_10120509 3300031456 Bacteria 2592
115 Ga0307509_10031570 3300031507 Bacteria 5849
116 Ga0307408_100658281 3300031548 Bacteria 937
117 Ga0307508_10056397 3300031616 Bacteria 3479
118 Ga0307508_10252286 3300031616 Bacteria 1360
119 Ga0307508_10252934 3300031616 Bacteria 1357
120 Ga0307508_10743874 3300031616 Bacteria 593
121 Ga0307514_10203509 3300031649 Bacteria 1240
122 Ga0307514_10264889 3300031649 Bacteria 1001
123 Ga0307516_10012278 3300031730 Bacteria 9240
124 Ga0307516_10056363 3300031730 Bacteria 3832
125 Ga0307413_10006127 3300031824 Bacteria 5458
126 Ga0307518_10443329 3300031838 Bacteria 699
127 Ga0307410_10514217 3300031852 Bacteria 987
128 Ga0307406_10405324 3300031901 Bacteria 1082
129 Ga0307409_100604439 3300031995 Bacteria 1084
130 Ga0307416_100420954 3300032002 Bacteria 1380
131 Ga0307416_101914846 3300032002 Bacteria 696
132 Ga0307507_10000482 3300033179 Bacteria 83990
133 Ga0307507_10097040 3300033179 Bacteria 2488
134 Ga0307510_10225196 3300033180 Bacteria 1383
135 Ga0307510_10316364 3300033180 Bacteria 1019
136 Ga0373951_0187901 3300035091 Bacteria 596
137 Ga0373955_0816767 3300035172 Bacteria 573
138 Ga0373931_0064798 3300035691 Bacteria 1979
139 Ga0373931_0110855 3300035691 Bacteria 1557
140 Ga0373925_0184564 3300037068 Bacteria 1653
141 Ga0395900_0522751 3300037418 Bacteria 1134
142 Ga0395898_0034465 3300037466 Bacteria 5045
143 Ga0395898_0092765 3300037466 Bacteria 2903
144 Ga0395905_0270188 3300037471 Bacteria 1586
145 Ga0395905_0517463 3300037471 Bacteria 1094
146 Ga0436364_0081467 3300037853 Bacteria 22951
147 Ga0395901_0274627 3300038443 Bacteria 1752
148 Ga0395901_0718853 3300038443 Bacteria 995
149 Ga0242420_035143 3300038996 Bacteria 942
150 Ga0436365_0702779 3300039437 Bacteria 7368
151 Ga0436363_0769974 3300039450 Bacteria 895
152 Ga0436362_0295725 3300039453 Bacteria 12012
153 Ga0439436_0000987 3300041404 Bacteria 7903
154 Ga0439436_0004595 3300041404 Bacteria 4232
155 Ga0439439_0036403 3300041406 Bacteria 1266
156 Ga0451837_1021945 3300041494 Bacteria 3962
157 Ga0451849_0665405 3300041505 Bacteria 1184
158 Ga0451853_0701526 3300041512 Bacteria 2720
159 Ga0439433_0004643 3300041999 Bacteria 2951
160 Ga0439442_006134 3300042002 Bacteria 2411
161 Ga0439448_0137579 3300042005 Bacteria 844
162 Ga0439457_005142 3300042014 Bacteria 3327
163 Ga0439462_0006886 3300042015 Bacteria 2835
164 Ga0439458_0124074 3300042157 Bacteria 681
165 Ga0439440_0071742 3300042993 Bacteria 902
166 Ga0466969_0002072 3300044656 Bacteria 10712
167 Ga0466969_0008070 3300044656 Bacteria 5592
168 Ga0466969_0020351 3300044656 Bacteria 3437
169 Ga0466969_0042539 3300044656 Bacteria 2267
170 Ga0466966_0006505 3300044684 Bacteria 7728
171 Ga0466966_0034075 3300044684 Bacteria 3295
172 Ga0466966_0036476 3300044684 Bacteria 3174
173 Ga0466966_0102575 3300044684 Bacteria 1768
174 Ga0466966_0181198 3300044684 Bacteria 1278
175 Ga0466966_0424871 3300044684 Bacteria 799
176 Ga0466961_0000420 3300044693 Bacteria 27093
177 Ga0466961_0002163 3300044693 Bacteria 12225
178 Ga0466961_0016815 3300044693 Bacteria 4703
179 Ga0466961_0233174 3300044693 Bacteria 1132
180 Ga0466963_0088645 3300044694 Bacteria 2105
181 Ga0466963_0754047 3300044694 Bacteria 687
182 Ga0466964_0200148 3300044706 Bacteria 958
183 Ga0466971_0002552 3300044719 Bacteria 7693
184 Ga0466971_0006100 3300044719 Bacteria 5242
185 Ga0466971_0045109 3300044719 Bacteria 1980
186 Ga0466971_0058661 3300044719 Bacteria 1737
187 Ga0466971_0115977 3300044719 Bacteria 1238
188 Ga0466970_0042781 3300044765 Bacteria 2409
189 Ga0466970_0078050 3300044765 Bacteria 1786
190 Ga0466970_0210875 3300044765 Bacteria 1082
191 Ga0466957_0047527 3300044842 Bacteria 2608
192 Ga0466957_0185358 3300044842 Bacteria 1361
193 Ga0466957_0203920 3300044842 Bacteria 1300
194 Ga0466957_0442300 3300044842 Bacteria 895
195 Ga0466960_0771344 3300044901 Bacteria 581
196 Ga0466959_0011166 3300045049 Bacteria 6445
197 Ga0466959_0014427 3300045049 Bacteria 5740
198 Ga0466959_0019179 3300045049 Bacteria 5028
199 Ga0466959_0075510 3300045049 Bacteria 2435
200 Ga0466959_0195302 3300045049 Bacteria 1411
201 Ga0466959_0636208 3300045049 Bacteria 717
202 Ga0466958_0026459 3300045836 Bacteria 3429
203 Ga0466958_0032245 3300045836 Bacteria 3116
204 Ga0466958_0147770 3300045836 Bacteria 1482
205 Ga0466958_0336493 3300045836 Bacteria 971
206 Ga0466967_0207505 3300045976 Bacteria 1857
207 Ga0466967_0403700 3300045976 Bacteria 1330
208 Ga0466967_0795419 3300045976 Bacteria 939
209 Ga0466967_1280226 3300045976 Bacteria 730
210 Ga0495627_056349 3300046453 Bacteria 1172
211 Ga0495592_0049991 3300046454 Bacteria 3107
212 Ga0495603_0000669 3300046455 Bacteria 19408
213 Ga0495603_0026568 3300046455 Bacteria 3496
214 Ga0495603_0029171 3300046455 Bacteria 3327
215 Ga0495603_0040921 3300046455 Bacteria 2772
216 Ga0495590_0040122 3300046457 Bacteria 1633
217 Ga0495629_0008159 3300046459 Bacteria 7702
218 Ga0495629_0055400 3300046459 Bacteria 2772
219 Ga0495629_0068290 3300046459 Bacteria 2480
220 Ga0495629_0079118 3300046459 Bacteria 2295
221 Ga0495638_0032430 3300046460 Bacteria 3349
222 Ga0495638_0140368 3300046460 Bacteria 1411
223 Ga0495651_0000937 3300046462 Bacteria 22597
224 Ga0495582_0138486 3300046473 Bacteria 1378
225 Ga0495605_0303130 3300046474 Bacteria 675
226 Ga0495664_0019455 3300046477 Bacteria 3904
227 Ga0495585_0027126 3300046492 Bacteria 3270
228 Ga0495585_0234812 3300046492 Bacteria 920
229 Ga0495585_0244141 3300046492 Bacteria 898
230 Ga0495594_0002244 3300046499 Bacteria 10060
231 Ga0495594_0053773 3300046499 Bacteria 2218
232 Ga0495594_0063501 3300046499 Bacteria 2046
233 Ga0495607_0036715 3300046501 Bacteria 2950
234 Ga0495607_0055495 3300046501 Bacteria 2279
235 Ga0495618_0061843 3300046514 Bacteria 2375
236 Ga0495618_0067905 3300046514 Bacteria 2267
237 Ga0495620_0048386 3300046515 Bacteria 1825
238 Ga0495628_0054632 3300046516 Bacteria 3147
239 Ga0495631_0125151 3300046518 Bacteria 1105
240 Ga0495631_0134743 3300046518 Bacteria 1061
241 Ga0495632_0163984 3300046519 Bacteria 1022
242 Ga0495643_0018377 3300046522 Bacteria 4064
243 Ga0495644_0301317 3300046523 Bacteria 627
244 Ga0495648_0203585 3300046524 Bacteria 989
245 Ga0495642_0435732 3300046528 Bacteria 579
246 Ga0495652_0019700 3300046529 Bacteria 6004
247 Ga0495640_0125880 3300046533 Bacteria 1662
248 Ga0495587_0060988 3300046536 Bacteria 2210
249 Ga0495609_0167235 3300046538 Bacteria 930
250 Ga0495622_0017272 3300046557 Bacteria 3359
251 Ga0495622_0132698 3300046557 Bacteria 1133
252 Ga0495633_0072369 3300046558 Bacteria 1607
253 Ga0495667_0177662 3300046559 Bacteria 1367
254 Ga0495668_0178693 3300046616 Bacteria 1163
255 Ga0495634_0001063 3300046642 Bacteria 25743
256 Ga0495634_0134217 3300046642 Bacteria 1575
257 Ga0495611_0066209 3300046648 Bacteria 1647
258 Ga0495611_0122645 3300046648 Bacteria 1212
259 Ga0495611_0161673 3300046648 Bacteria 1046
260 Ga0495611_0240056 3300046648 Bacteria 841
261 Ga0495625_0490834 3300046660 Bacteria 752
262 Ga0495635_0004318 3300046663 Bacteria 9841
263 Ga0495635_0016482 3300046663 Bacteria 5161
264 Ga0495635_0609952 3300046663 Bacteria 712
265 Ga0495661_0157420 3300046665 Bacteria 1222
266 Ga0495657_0001831 3300046675 Bacteria 18169
267 Ga0495623_0008165 3300046679 Bacteria 6806
268 Ga0495658_0010152 3300046683 Bacteria 4705
269 Ga0495613_0005563 3300046689 Bacteria 9461
270 Ga0495624_0126690 3300046690 Bacteria 1567
271 Ga0495624_0457948 3300046690 Bacteria 764
272 Ga0495670_0006503 3300046691 Bacteria 5743
273 Ga0495670_0656926 3300046691 Bacteria 571
274 Ga0495671_0179328 3300046692 Bacteria 1029
275 Ga0495589_0007062 3300046794 Bacteria 5887
276 Ga0495589_0058500 3300046794 Bacteria 1895
277 Ga0495589_0115155 3300046794 Bacteria 1296
278 Ga0495589_0118180 3300046794 Bacteria 1277
279 Ga0495660_0014771 3300046810 Bacteria 4516
280 Ga0495581_0205189 3300047315 Bacteria 1153
281 Ga0495581_0335285 3300047315 Bacteria 883
282 Ga0495581_0562172 3300047315 Bacteria 662
283 Ga0495604_0000692 3300047317 Bacteria 28601
284 Ga0495636_0144692 3300047318 Bacteria 1063
285 Ga0495636_0331860 3300047318 Bacteria 715
286 Ga0495674_0600532 3300047319 Bacteria 872
287 Ga0495676_0010050 3300047321 Bacteria 8593
288 Ga0495676_0011550 3300047321 Bacteria 7966
289 Ga0495676_0016531 3300047321 Bacteria 6543
290 Ga0495676_0180731 3300047321 Bacteria 1478
291 Ga0495683_0047980 3300047323 Bacteria 2142
292 Ga0495687_022503 3300047443 Bacteria 3024
293 Ga0495687_167139 3300047443 Bacteria 733
294 Ga0495677_0153257 3300047445 Bacteria 888
295 Ga0495685_000833 3300047447 Bacteria 9405
296 Ga0495685_001527 3300047447 Bacteria 7093
297 Ga0495685_120146 3300047447 Bacteria 863
298 Ga0495681_0018422 3300047470 Bacteria 3847
299 Ga0495686_0036187 3300047472 Bacteria 3169
300 Ga0495593_0009210 3300047673 Bacteria 5725
301 Ga0495614_0012307 3300048089 Bacteria 3757
302 Ga0495626_0250643 3300048091 Bacteria 710
303 Ga0496106_0577103 3300048909 Bacteria 901
304 Ga0496108_0246149 3300048911 Bacteria 1555
305 Ga0496111_1234100 3300048914 Bacteria 529
306 Ga0496115_0109689 3300048918 Bacteria 2266
307 Ga0501306_060664 3300049127 Bacteria 623
308 Ga0501313_063460 3300049529 Bacteria 526
309 Ga0501320_021981 3300049536 Bacteria 745
310 Ga0501323_005585 3300049539 Bacteria 1382
311 Ga0501323_017505 3300049539 Bacteria 921
312 Ga0501324_025528 3300049540 Bacteria 624
313 Ga0501031_0111829 3300049568 Bacteria 1783
314 Ga0501031_0223959 3300049568 Bacteria 1224
315 Ga0501032_0006325 3300049569 Bacteria 8727
316 Ga0501032_0077246 3300049569 Bacteria 2217
317 Ga0501032_0170071 3300049569 Bacteria 1429
318 Ga0501033_0025358 3300049570 Bacteria 4465
319 Ga0501033_0028515 3300049570 Bacteria 4193
320 Ga0501033_0429130 3300049570 Bacteria 920
321 Ga0501034_0173272 3300049571 Bacteria 2124
322 Ga0501034_0247234 3300049571 Bacteria 1728
323 Ga0501034_0358160 3300049571 Bacteria 1386
324 Ga0501034_1552923 3300049571 Bacteria 535
325 Ga0501036_0195528 3300049572 Bacteria 1701
326 Ga0501036_0198721 3300049572 Bacteria 1686
327 Ga0501037_0013207 3300049573 Bacteria 6087
328 Ga0501037_0017411 3300049573 Bacteria 5292
329 Ga0501037_0131120 3300049573 Bacteria 1797
330 Ga0501038_0017683 3300049574 Bacteria 6444
331 Ga0501038_0030413 3300049574 Bacteria 4779
332 Ga0501038_1130162 3300049574 Bacteria 571
333 Ga0501039_0049155 3300049575 Bacteria 3260
334 Ga0501039_0363935 3300049575 Bacteria 1136
335 Ga0501039_0491525 3300049575 Bacteria 963
336 Ga0501039_0948004 3300049575 Bacteria 669
337 Ga0501040_0012893 3300049576 Bacteria 5491
338 Ga0501042_0267414 3300049578 Bacteria 1234
339 Ga0501042_0612697 3300049578 Bacteria 791
340 Ga0501043_0040127 3300049579 Bacteria 3679
341 Ga0501043_0483098 3300049579 Bacteria 927
342 Ga0501043_0525538 3300049579 Bacteria 881
343 Ga0501043_0544952 3300049579 Bacteria 862
344 Ga0501046_0021332 3300049580 Bacteria 5345
345 Ga0501046_0050635 3300049580 Bacteria 3280
346 Ga0501047_0000582 3300049581 Bacteria 38847
347 Ga0501047_0082776 3300049581 Bacteria 3084
348 Ga0501047_0254546 3300049581 Bacteria 1604
349 Ga0501047_0341343 3300049581 Bacteria 1335
350 Ga0501048_0039041 3300049582 Bacteria 3406
351 Ga0501048_0114382 3300049582 Bacteria 1906
352 Ga0501067_0005472 3300049583 Bacteria 7045
353 Ga0501068_0056388 3300049584 Bacteria 2382
354 Ga0501069_0019490 3300049585 Bacteria 3669
355 Ga0501069_0403394 3300049585 Bacteria 809
356 Ga0501069_0717734 3300049585 Bacteria 603
357 Ga0501070_0001208 3300049586 Bacteria 23077
358 Ga0501070_0031714 3300049586 Bacteria 4427
359 Ga0501070_0049709 3300049586 Bacteria 3482
360 Ga0501070_0281679 3300049586 Bacteria 1356
361 Ga0501071_0007769 3300049587 Bacteria 7072
362 Ga0501072_0002701 3300049588 Bacteria 13305
363 Ga0501073_0028776 3300049589 Bacteria 3970
364 Ga0501073_0279551 3300049589 Bacteria 1152
365 Ga0501074_0001833 3300049590 Bacteria 14562
366 Ga0501074_0011815 3300049590 Bacteria 6346
367 Ga0501076_0039584 3300049592 Bacteria 3701
368 Ga0501077_0084022 3300049593 Bacteria 2018
369 Ga0501217_087430 3300049661 Bacteria 871
370 Ga0501217_149234 3300049661 Bacteria 698
371 Ga0501253_094494 3300049683 Bacteria 692
372 Ga0501257_053250 3300049686 Bacteria 1012
373 Ga0501079_0004886 3300049741 Bacteria 9937
374 Ga0501080_0001014 3300049742 Bacteria 23076
375 Ga0501080_0022322 3300049742 Bacteria 5862
376 Ga0501080_0045465 3300049742 Bacteria 4087
377 Ga0501080_0132033 3300049742 Bacteria 2312
378 Ga0501083_0017409 3300049744 Bacteria 5009
379 Ga0501282_003550 3300049778 Bacteria 1683
380 Ga0501035_0081350 3300049822 Bacteria 2858
381 Ga0501035_0082738 3300049822 Bacteria 2832
382 Ga0501035_0195954 3300049822 Bacteria 1735
383 Ga0501044_0000806 3300049823 Bacteria 37759
384 Ga0501044_0053276 3300049823 Bacteria 4163
385 Ga0501044_0166076 3300049823 Bacteria 2181
386 Ga0501044_0251459 3300049823 Bacteria 1708
387 Ga0501044_0380694 3300049823 Bacteria 1326
388 Ga0501044_0392463 3300049823 Bacteria 1301
389 Ga0501044_0935608 3300049823 Bacteria 740
390 Ga0501044_0940900 3300049823 Bacteria 737
391 Ga0501044_0963494 3300049823 Bacteria 726
392 Ga0501045_0015945 3300049824 Bacteria 5330
393 Ga0501045_0523300 3300049824 Bacteria 880
394 nmdc:mga05p37_127039_c1 3300050507 Bacteria 1933
395 nmdc:mga0qj67_446193_c1 3300050509 Bacteria 1042
396 nmdc:mga0qj67_576976_c1 3300050509 Bacteria 901
397 nmdc:mga06r32_1147736_c1 3300050510 Bacteria 725
398 nmdc:mga06r32_262955_c1 3300050510 Bacteria 1713
399 nmdc:mga06r32_893253_c1 3300050510 Bacteria 845
400 nmdc:mga08y16_228436_c1 3300050511 Bacteria 1925
401 nmdc:mga0n895_109127_c1 3300050512 Bacteria 2783
402 nmdc:mga0rr50_64018_c1 3300050513 Bacteria 2780
403 nmdc:mga08x19_97392_c1 3300050514 Bacteria 1948
404 nmdc:mga0a205_35541_c1 3300050515 Bacteria 4785
405 Ga0495601_0076633 3300053077 Bacteria 2141
406 Ga0495612_0002469 3300053078 Bacteria 7623
407 Ga0495612_0141575 3300053078 Bacteria 1043
408 Ga0495655_0026429 3300053083 Bacteria 1367
409 Ga0495619_0020589 3300053085 Bacteria 4204
410 Ga0500578_0029071 3300053086 Bacteria 3549
411 Ga0500644_0090792 3300053088 Bacteria 1143
412 Ga0500583_0053881 3300053092 Bacteria 1877
413 Ga0500651_0267236 3300053093 Bacteria 990
414 Ga0500566_0077344 3300053094 Bacteria 1858
415 Ga0500654_024300 3300053099 Bacteria 3800
416 Ga0500660_254372 3300053100 Bacteria 537
417 Ga0500558_145787 3300053106 Bacteria 886
418 Ga0500560_011472 3300053107 Bacteria 2262
419 Ga0500562_021852 3300053108 Bacteria 1667
420 Ga0500569_073632 3300053109 Bacteria 1079
421 Ga0500572_071639 3300053111 Bacteria 1072
422 Ga0500580_118073 3300053113 Bacteria 1014
423 Ga0500594_0030933 3300053118 Bacteria 1409
424 Ga0500614_017119 3300053123 Bacteria 1634
425 Ga0500621_151955 3300053126 Bacteria 867
426 Ga0500628_001267 3300053129 Bacteria 4369
427 Ga0500652_021040 3300053131 Bacteria 2450
428 Ga0500658_0010246 3300053134 Bacteria 3454
429 Ga0500559_0009593 3300053136 Bacteria 4181
430 Ga0500559_0118222 3300053136 Bacteria 1232
431 Ga0500573_0036731 3300053140 Bacteria 2829
432 Ga0500573_0205131 3300053140 Bacteria 1043
433 Ga0500579_151925 3300053143 Bacteria 1006
434 Ga0500600_0021675 3300053149 Bacteria 3848
435 Ga0500633_0010565 3300053160 Bacteria 2476
436 Ga0500634_0017070 3300053161 Bacteria 3882
437 Ga0500634_0219032 3300053161 Bacteria 819
438 Ga0500656_000760 3300053732 Bacteria 2535
439 Ga0500565_020995 3300053734 Bacteria 786
440 Ga0500587_002141 3300053739 Bacteria 2817
441 Ga0501084_0004705 3300054114 Bacteria 11147
442 Ga0501084_0262171 3300054114 Bacteria 1459
443 Ga0501082_0011656 3300060353 Bacteria 7558
444 Ga0466962_0001665 3300061719 Bacteria 10420
445 Ga0466962_0001793 3300061719 Bacteria 10099
446 Ga0466962_0143422 3300061719 Bacteria 1157
447 Ga0466962_0214352 3300061719 Bacteria 942
448 Ga0466962_0403019 3300061719 Bacteria 685
449 2547409988 2547132111 Bacteria 8013147
450 2554256840 2554235005 Bacteria 6457341
451 2558913594 2558860112 Bacteria 9931328
452 2585295881 2582581312 Bacteria 7308206
453 2585308125 2582581313 Bacteria 10042643
454 2585319562 2582581314 Bacteria 11452267
455 2616696831 2616644814 Bacteria 11555299
456 2616901966 2616644941 Bacteria 8510691
457 2643764803 2643221548 Bacteria 8053412
458 2643902899 2643221578 Bacteria 9213798
459 2643942024 2643221587 Bacteria 7586415
460 2644261628 2643221647 Bacteria 10741251
461 2644389672 2643221670 Bacteria 6497041
462 2644404591 2643221673 Bacteria 9196637
463 2644429107 2643221677 Bacteria 7584031
464 2644439289 2643221678 Bacteria 9540101
465 2644462188 2643221682 Bacteria 6743283
466 2676476424 2675903058 Bacteria 6822861
467 2784589683 2784132148 Bacteria 8627943
468 2785341911 2784746763 Bacteria 9783172
469 2785370744 2784746768 Bacteria 10036182
470 2786671925 2786546132 Bacteria 10419719
471 2793976306 2791355406 Bacteria 11364898
472 2804845576 2802429296 Bacteria 7227771
473 2808912898 2808606375 Bacteria 9466072
474 2809233357 2808606448 Bacteria 8656184
475 2811845127 2808606982 Bacteria 7791042
476 2812356742 2811994879 Bacteria 9313447
477 2812479454 2811994917 Bacteria 7761064
478 2819695258 2818991463 Bacteria 7948711
479 2827632232 2827628540 Bacteria 6858585
480 2852640371 2852635781 Bacteria 8251373
481 2862185371 2862178590 Bacteria 8583590
482 2862286819 2862281513 Bacteria 9621493
483 2862386014 2862382967 Bacteria 10317375
484 2862516821 2862507626 Bacteria 9425308
485 2862578215 2862574272 Bacteria 10567477
486 2863411599 2863404153 Bacteria 9672205
487 2867373189 2867369537 Bacteria 6501581
488 2867429345 2867428634 Bacteria 9590268
489 2867481038 2867475112 Bacteria 6909112
490 2870783313 2870782633 Bacteria 9624083
491 2873154729 2873151551 Bacteria 8625867
492 2875395992 2875391855 Bacteria 7600475
493 2877679845 2877676314 Bacteria 9512378
494 2912718488 2912715099 Bacteria 9460473
495 2912730820 2912723979 Bacteria 8557534
496 2912762083 2912757875 Bacteria 7940295
497 2918505779 2918501144 Bacteria 8668083
498 2919470189 2919468124 Bacteria 9133025
499 2946048620 2946045630 Bacteria 8527308
500 2946069127 2946064051 Bacteria 8957905
501 2947227814 2947224130 Bacteria 9938529
502 2954003083 2954002825 Bacteria 9173742
503 2954384766 2954380949 Bacteria 10050426
504 2954678197 2954673503 Bacteria 9685905
505 2954685960 2954682443 Bacteria 9862841
506 2954695609 2954691527 Bacteria 10720516
507 2954710802 2954701450 Bacteria 10834262
508 2954715037 2954711539 Bacteria 10867210
509 2954724979 2954721474 Bacteria 10456478
510 2954736839 2954731030 Bacteria 10243860
511 2954743912 2954740390 Bacteria 10229294
512 2954755687 2954749733 Bacteria 10366972
513 2954762853 2954759201 Bacteria 9358192
514 2990062270 2990059506 Bacteria 9321252
515 2990093143 2990088156 Bacteria 6657676
516 2997458197 2997451912 Bacteria 8492419
517 2997606122 2997600082 Bacteria 9896405
518 3006326592 3006321560 Bacteria 8247479
519 3006398737 3006393351 Bacteria 6615579
520 3006427269 3006425503 Bacteria 6491253
521 3006494692 3006493962 Bacteria 8825450
522 8003861986 8003856774 Bacteria 7675274
523 8008566522 8008558824 Bacteria 10610750
524 8008577838 8008574985 Bacteria 7815457
525 8023629383 8023623736 Bacteria 8593882
526 8025415196 8025413630 Bacteria 7014048
527 8025483265 8025478263 Bacteria 8209203
528 8025532368 8025530807 Bacteria 8495698
529 8033690318 8033684223 Bacteria 6906479
530 8047717820 8047710418 Bacteria 11023148
531 8047897005 8047893842 Bacteria 11723082
532 8048132549 8048127548 Bacteria 11053136
533 8048361947 8048356638 Bacteria 11044339
534 8048373990 8048369669 Bacteria 11666822
535 8048384237 8048379754 Bacteria 11877923
536 8048413870 8048406513 Bacteria 8936924
537 8054160768 8054160619 Bacteria 7783213
538 8056453717 8056447290 Bacteria 7680491
539 8056673300 8056667051 Bacteria 6953971
540 8056837653 8056829672 Bacteria 9045328
541 Ga0466959_0164765
542 LJQas_1016423
543 JGI25160J50197_1021265
544 Ga0070658_10152211
545 Ga0070658_10354370
546 Ga0070682_100667043
547 Ga0068868_101770502
548 Ga0070689_100219489
549 Ga0070674_100423950
550 Ga0070709_10025318
551 Ga0070714_100001921
552 Ga0070713_100058308
553 Ga0070713_100172255
554 Ga0070679_100298479
555 Ga0070679_100355083
556 Ga0070679_101874492
557 Ga0070684_100054309
558 Ga0070697_100196880
559 Ga0070695_100675683
560 Ga0070665_100117093
561 Ga0070665_101811443
562 Ga0068855_100968059
563 Ga0068856_100049636
564 Ga0068856_100169586
565 Ga0068856_100608415
566 Ga0068856_101187037
567 Ga0068851_10138633
568 Ga0068863_100772173
569 Ga0081455_10078282
570 Ga0081455_10451890
571 Ga0081540_1000843
572 Ga0081540_1006423
573 Ga0070717_10123392
574 Ga0070717_10943321
575 Ga0075432_10193233
576 Ga0070712_100029137
577 Ga0070712_100154207
578 Ga0075428_100001967
579 Ga0075428_100611395
580 Ga0075428_100681020
581 Ga0075430_100517156
582 Ga0075430_100867678
583 Ga0075431_100567921
584 Ga0075433_10005917
585 Ga0075429_101597130
586 Ga0068865_100416703
587 Ga0111539_10251029
588 Ga0105245_10269028
589 Ga0105245_10488224
590 Ga0105245_10736808
591 Ga0114129_10030888
592 Ga0114129_10170838
593 Ga0105243_10025061
594 Ga0105242_10227904
595 Ga0105242_10680509
596 Ga0105248_10118043
597 Ga0105249_10642107
598 Ga0105239_10454730
599 Ga0105239_10556811
600 Ga0105246_10204160
601 Ga0157370_10081130
602 Ga0157369_10010632
603 Ga0157369_10233565
604 Ga0157374_12703871
605 Ga0157378_10106452
606 Ga0157372_11295654
607 Ga0157372_12673976
608 Ga0163163_10631046
609 Ga0157380_11200505
610 Ga0183367_1002
611 Ga0213876_10155458
612 Ga0224712_10007165
613 Ga0224712_10281924
614 Ga0224712_10361935
615 Ga0207426_1008834
616 Ga0207680_10217205
617 Ga0207699_10016621
618 Ga0207705_10044902
619 Ga0207663_10561005
620 Ga0207657_10266547
621 Ga0207652_10410721
622 Ga0207652_10474973
623 Ga0207687_10259044
624 Ga0207687_10339281
625 Ga0207700_10061891
626 Ga0207700_10066590
627 Ga0207664_10001130
628 Ga0207706_10032995
629 Ga0207686_10217899
630 Ga0207686_10652851
631 Ga0207670_10309830
632 Ga0207704_10221279
633 Ga0207704_10518256
634 Ga0207711_10351479
635 Ga0207661_10782052
636 Ga0207679_10834225
637 Ga0207667_10453799
638 Ga0207712_10433582
639 Ga0207658_10478897
640 Ga0207658_10612851
641 Ga0207708_10022093
642 Ga0207702_10035944
643 Ga0207702_10151705
644 Ga0207702_10469545
645 Ga0207641_10630693
646 Ga0207675_100673499
647 Ga0207428_10223110
648 Ga0268266_10248408
649 Ga0268266_11518112
650 Ga0307517_10055288
651 Ga0307511_10029702
652 Ga0307511_10100508
653 Ga0316180_1148161
654 Ga0307513_10120509
655 Ga0307509_10031570
656 Ga0307408_100658281
657 Ga0307508_10056397
658 Ga0307508_10252286
659 Ga0307508_10252934
660 Ga0307508_10743874
661 Ga0307514_10203509
662 Ga0307514_10264889
663 Ga0307516_10012278
664 Ga0307516_10056363
665 Ga0307413_10006127
666 Ga0307518_10443329
667 Ga0307410_10514217
668 Ga0307406_10405324
669 Ga0307409_100604439
670 Ga0307416_100420954
671 Ga0307416_101914846
672 Ga0307507_10000482
673 Ga0307507_10097040
674 Ga0307510_10225196
675 Ga0307510_10316364
676 Ga0373951_0187901
677 Ga0373955_0816767
678 Ga0373931_0064798
679 Ga0373931_0110855
680 Ga0373925_0184564
681 Ga0395900_0522751
682 Ga0395898_0034465
683 Ga0395898_0092765
684 Ga0395905_0270188
685 Ga0395905_0517463
686 Ga0436364_0081467
687 Ga0395901_0274627
688 Ga0395901_0718853
689 Ga0242420_035143
690 Ga0436365_0702779
691 Ga0436363_0769974
692 Ga0436362_0295725
693 Ga0439436_0000987
694 Ga0439436_0004595
695 Ga0439439_0036403
696 Ga0451837_1021945
697 Ga0451849_0665405
698 Ga0451853_0701526
699 Ga0439433_0004643
700 Ga0439442_006134
701 Ga0439448_0137579
702 Ga0439457_005142
703 Ga0439462_0006886
704 Ga0439458_0124074
705 Ga0439440_0071742
706 Ga0466969_0002072
707 Ga0466969_0008070
708 Ga0466969_0020351
709 Ga0466969_0042539
710 Ga0466966_0006505
711 Ga0466966_0034075
712 Ga0466966_0036476
713 Ga0466966_0102575
714 Ga0466966_0181198
715 Ga0466966_0424871
716 Ga0466961_0000420
717 Ga0466961_0002163
718 Ga0466961_0016815
719 Ga0466961_0233174
720 Ga0466963_0088645
721 Ga0466963_0754047
722 Ga0466964_0200148
723 Ga0466971_0002552
724 Ga0466971_0006100
725 Ga0466971_0045109
726 Ga0466971_0058661
727 Ga0466971_0115977
728 Ga0466970_0042781
729 Ga0466970_0078050
730 Ga0466970_0210875
731 Ga0466957_0047527
732 Ga0466957_0185358
733 Ga0466957_0203920
734 Ga0466957_0442300
735 Ga0466960_0771344
736 Ga0466959_0011166
737 Ga0466959_0014427
738 Ga0466959_0019179
739 Ga0466959_0075510
740 Ga0466959_0195302
741 Ga0466959_0636208
742 Ga0466958_0026459
743 Ga0466958_0032245
744 Ga0466958_0147770
745 Ga0466958_0336493
746 Ga0466967_0207505
747 Ga0466967_0403700
748 Ga0466967_0795419
749 Ga0466967_1280226
750 Ga0495627_056349
751 Ga0495592_0049991
752 Ga0495603_0000669
753 Ga0495603_0026568
754 Ga0495603_0029171
755 Ga0495603_0040921
756 Ga0495590_0040122
757 Ga0495629_0008159
758 Ga0495629_0055400
759 Ga0495629_0068290
760 Ga0495629_0079118
761 Ga0495638_0032430
762 Ga0495638_0140368
763 Ga0495651_0000937
764 Ga0495582_0138486
765 Ga0495605_0303130
766 Ga0495664_0019455
767 Ga0495585_0027126
768 Ga0495585_0234812
769 Ga0495585_0244141
770 Ga0495594_0002244
771 Ga0495594_0053773
772 Ga0495594_0063501
773 Ga0495607_0036715
774 Ga0495607_0055495
775 Ga0495618_0061843
776 Ga0495618_0067905
777 Ga0495620_0048386
778 Ga0495628_0054632
779 Ga0495631_0125151
780 Ga0495631_0134743
781 Ga0495632_0163984
782 Ga0495643_0018377
783 Ga0495644_0301317
784 Ga0495648_0203585
785 Ga0495642_0435732
786 Ga0495652_0019700
787 Ga0495640_0125880
788 Ga0495587_0060988
789 Ga0495609_0167235
790 Ga0495622_0017272
791 Ga0495622_0132698
792 Ga0495633_0072369
793 Ga0495667_0177662
794 Ga0495668_0178693
795 Ga0495634_0001063
796 Ga0495634_0134217
797 Ga0495611_0066209
798 Ga0495611_0122645
799 Ga0495611_0161673
800 Ga0495611_0240056
801 Ga0495625_0490834
802 Ga0495635_0004318
803 Ga0495635_0016482
804 Ga0495635_0609952
805 Ga0495661_0157420
806 Ga0495657_0001831
807 Ga0495623_0008165
808 Ga0495658_0010152
809 Ga0495613_0005563
810 Ga0495624_0126690
811 Ga0495624_0457948
812 Ga0495670_0006503
813 Ga0495670_0656926
814 Ga0495671_0179328
815 Ga0495589_0007062
816 Ga0495589_0058500
817 Ga0495589_0115155
818 Ga0495589_0118180
819 Ga0495660_0014771
820 Ga0495581_0205189
821 Ga0495581_0335285
822 Ga0495581_0562172
823 Ga0495604_0000692
824 Ga0495636_0144692
825 Ga0495636_0331860
826 Ga0495674_0600532
827 Ga0495676_0010050
828 Ga0495676_0011550
829 Ga0495676_0016531
830 Ga0495676_0180731
831 Ga0495683_0047980
832 Ga0495687_022503
833 Ga0495687_167139
834 Ga0495677_0153257
835 Ga0495685_000833
836 Ga0495685_001527
837 Ga0495685_120146
838 Ga0495681_0018422
839 Ga0495686_0036187
840 Ga0495593_0009210
841 Ga0495614_0012307
842 Ga0495626_0250643
843 Ga0496106_0577103
844 Ga0496108_0246149
845 Ga0496111_1234100
846 Ga0496115_0109689
847 Ga0501306_060664
848 Ga0501313_063460
849 Ga0501320_021981
850 Ga0501323_005585
851 Ga0501323_017505
852 Ga0501324_025528
853 Ga0501031_0111829
854 Ga0501031_0223959
855 Ga0501032_0006325
856 Ga0501032_0077246
857 Ga0501032_0170071
858 Ga0501033_0025358
859 Ga0501033_0028515
860 Ga0501033_0429130
861 Ga0501034_0173272
862 Ga0501034_0247234
863 Ga0501034_0358160
864 Ga0501034_1552923
865 Ga0501036_0195528
866 Ga0501036_0198721
867 Ga0501037_0013207
868 Ga0501037_0017411
869 Ga0501037_0131120
870 Ga0501038_0017683
871 Ga0501038_0030413
872 Ga0501038_1130162
873 Ga0501039_0049155
874 Ga0501039_0363935
875 Ga0501039_0491525
876 Ga0501039_0948004
877 Ga0501040_0012893
878 Ga0501042_0267414
879 Ga0501042_0612697
880 Ga0501043_0040127
881 Ga0501043_0483098
882 Ga0501043_0525538
883 Ga0501043_0544952
884 Ga0501046_0021332
885 Ga0501046_0050635
886 Ga0501047_0000582
887 Ga0501047_0082776
888 Ga0501047_0254546
889 Ga0501047_0341343
890 Ga0501048_0039041
891 Ga0501048_0114382
892 Ga0501067_0005472
893 Ga0501068_0056388
894 Ga0501069_0019490
895 Ga0501069_0403394
896 Ga0501069_0717734
897 Ga0501070_0001208
898 Ga0501070_0031714
899 Ga0501070_0049709
900 Ga0501070_0281679
901 Ga0501071_0007769
902 Ga0501072_0002701
903 Ga0501073_0028776
904 Ga0501073_0279551
905 Ga0501074_0001833
906 Ga0501074_0011815
907 Ga0501076_0039584
908 Ga0501077_0084022
909 Ga0501217_087430
910 Ga0501217_149234
911 Ga0501253_094494
912 Ga0501257_053250
913 Ga0501079_0004886
914 Ga0501080_0001014
915 Ga0501080_0022322
916 Ga0501080_0045465
917 Ga0501080_0132033
918 Ga0501083_0017409
919 Ga0501282_003550
920 Ga0501035_0081350
921 Ga0501035_0082738
922 Ga0501035_0195954
923 Ga0501044_0000806
924 Ga0501044_0053276
925 Ga0501044_0166076
926 Ga0501044_0251459
927 Ga0501044_0380694
928 Ga0501044_0392463
929 Ga0501044_0935608
930 Ga0501044_0940900
931 Ga0501044_0963494
932 Ga0501045_0015945
933 Ga0501045_0523300
934 nmdc:mga05p37_127039_c1
935 nmdc:mga0qj67_446193_c1
936 nmdc:mga0qj67_576976_c1
937 nmdc:mga06r32_1147736_c1
938 nmdc:mga06r32_262955_c1
939 nmdc:mga06r32_893253_c1
940 nmdc:mga08y16_228436_c1
941 nmdc:mga0n895_109127_c1
942 nmdc:mga0rr50_64018_c1
943 nmdc:mga08x19_97392_c1
944 nmdc:mga0a205_35541_c1
945 Ga0495601_0076633
946 Ga0495612_0002469
947 Ga0495612_0141575
948 Ga0495655_0026429
949 Ga0495619_0020589
950 Ga0500578_0029071
951 Ga0500644_0090792
952 Ga0500583_0053881
953 Ga0500651_0267236
954 Ga0500566_0077344
955 Ga0500654_024300
956 Ga0500660_254372
957 Ga0500558_145787
958 Ga0500560_011472
959 Ga0500562_021852
960 Ga0500569_073632
961 Ga0500572_071639
962 Ga0500580_118073
963 Ga0500594_0030933
964 Ga0500614_017119
965 Ga0500621_151955
966 Ga0500628_001267
967 Ga0500652_021040
968 Ga0500658_0010246
969 Ga0500559_0009593
970 Ga0500559_0118222
971 Ga0500573_0036731
972 Ga0500573_0205131
973 Ga0500579_151925
974 Ga0500600_0021675
975 Ga0500633_0010565
976 Ga0500634_0017070
977 Ga0500634_0219032
978 Ga0500656_000760
979 Ga0500565_020995
980 Ga0500587_002141
981 Ga0501084_0004705
982 Ga0501084_0262171
983 Ga0501082_0011656
984 Ga0466962_0001665
985 Ga0466962_0001793
986 Ga0466962_0143422
987 Ga0466962_0214352
988 Ga0466962_0403019
989 2547409988
990 2554256840
991 2558913594
992 2585295881
993 2585308125
994 2585319562
995 2616696831
996 2616901966
997 2643764803
998 2643902899
999 2643942024
1000 2644261628
1001 2644389672
1002 2644404591
1003 2644429107
1004 2644439289
1005 2644462188
1006 2676476424
1007 2784589683
1008 2785341911
1009 2785370744
1010 2786671925
1011 2793976306
1012 2804845576
1013 2808912898
1014 2809233357
1015 2811845127
1016 2812356742
1017 2812479454
1018 2819695258
1019 2827632232
1020 2852640371
1021 2862185371
1022 2862286819
1023 2862386014
1024 2862516821
1025 2862578215
1026 2863411599
1027 2867373189
1028 2867429345
1029 2867481038
1030 2870783313
1031 2873154729
1032 2875395992
1033 2877679845
1034 2912718488
1035 2912730820
1036 2912762083
1037 2918505779
1038 2919470189
1039 2946048620
1040 2946069127
1041 2947227814
1042 2954003083
1043 2954384766
1044 2954678197
1045 2954685960
1046 2954695609
1047 2954710802
1048 2954715037
1049 2954724979
1050 2954736839
1051 2954743912
1052 2954755687
1053 2954762853
1054 2990062270
1055 2990093143
1056 2997458197
1057 2997606122
1058 3006326592
1059 3006398737
1060 3006427269
1061 3006494692
1062 8003861986
1063 8008566522
1064 8008577838
1065 8023629383
1066 8025415196
1067 8025483265
1068 8025532368
1069 8033690318
1070 8047717820
1071 8047897005
1072 8048132549
1073 8048361947
1074 8048373990
1075 8048384237
1076 8048413870
1077 8054160768
1078 8056453717
1079 8056673300
1080 8056837653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

6

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.9516 7 144
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.9476 7 147
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9439 1 143
5zy8-assembly1.cif.gz_A crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9372 1 142
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9352 3 146
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9508 6 146 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9282 1 145 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9237 8 142 3.10.129.10
af_P9WFJ9_1_152_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9121 1 147 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9044 1 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7U3UVA0-F1-model_v4 UPF0336 protein RVR_6171 0.9901 1 147 GO:0006633
GO:0019171
AF-A0A7K0LSX3-F1-model_v4 MaoC family dehydratase 0.9885 36 147
AF-A0A0S1UQ82-F1-model_v4 deleted 0.9878 1 147
AF-A0A1H6BTV0-F1-model_v4 UPF0336 protein SAMN05216223_107223 0.9875 1 147 GO:0006633
GO:0019171
AF-A0A4R6SME2-F1-model_v4 Acyl dehydratase 0.9873 12 148 GO:0006633
GO:0019171

Map