F461201

General Info

Members Datasets Scaffolds Average Seq Length
540 231 527 111

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10190159|Ga0070658_101901592
Length 126
Sequence LPRRPTRSSNAFGERAMVSVSFTTDDGQKVRRDAPVGARLLEVGQAAGLPLEGTCEGQMACSTCHVIVAAEWFDRLVPASEEEEDMLDLAAGVARTSRLSCQIVLSDELDGIEVHVPGEARDMQRR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
4 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
5 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
6 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
7 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
8 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
9 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
10 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
11 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
12 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
13 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
218 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
219 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
229 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 1.11
Rhizoplane 6.67
Rhizosphere 70.74
Stem 0
Stem Tuber 0
Unclassified 10.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1044026 2162886007 Bacteria 2083
2 SwRhRL2b_contig_196785 2162886007 Bacteria 1407
3 SwRhRL2b_contig_878851 2162886007 Bacteria 43540
4 JGI24748J21848_1001818 3300002074 Bacteria 2366
5 JGI24034J26672_10069818 3300002239 Bacteria 628
6 JGI24751J29686_10000080 3300002459 Bacteria 54264
7 Ga0055530_10007261 3300003791 Bacteria 4708
8 Ga0065704_10070424 3300005289 Bacteria 25504
9 Ga0065704_10099696 3300005289 Bacteria 2297
10 Ga0065704_10791785 3300005289 Bacteria 528
11 Ga0065707_10163979 3300005295 Bacteria 1539
12 Ga0070658_10000371 3300005327 Bacteria 39178
13 Ga0070658_10008372 3300005327 Bacteria 8314
14 Ga0070658_10190159 3300005327 Bacteria 1730
15 Ga0070658_10421638 3300005327 Bacteria 1148
16 Ga0070683_100094068 3300005329 Bacteria 2816
17 Ga0070683_100120426 3300005329 Bacteria 2479
18 Ga0070683_101700807 3300005329 Bacteria 607
19 Ga0070690_100066155 3300005330 Bacteria 2339
20 Ga0070670_100092329 3300005331 Bacteria 2603
21 Ga0070670_100177418 3300005331 Bacteria 1849
22 Ga0070666_10084446 3300005335 Bacteria 2173
23 Ga0070666_10442376 3300005335 Bacteria 938
24 Ga0070680_100005540 3300005336 Bacteria 9555
25 Ga0070660_100209166 3300005339 Bacteria 1583
26 Ga0070660_100867063 3300005339 Bacteria 761
27 Ga0070661_100002979 3300005344 Bacteria 11671
28 Ga0070668_100002062 3300005347 Bacteria 14707
29 Ga0070668_100013390 3300005347 Bacteria 6121
30 Ga0070668_100018387 3300005347 Bacteria 5247
31 Ga0070668_100086994 3300005347 Bacteria 2459
32 Ga0070669_100002274 3300005353 Bacteria 13933
33 Ga0070669_100008686 3300005353 Bacteria 7247
34 Ga0070669_100008689 3300005353 Bacteria 7246
35 Ga0070669_101368264 3300005353 Bacteria 614
36 Ga0070671_100000066 3300005355 Bacteria 70998
37 Ga0070671_100000818 3300005355 Bacteria 22580
38 Ga0070671_100012590 3300005355 Bacteria 6814
39 Ga0070671_100031501 3300005355 Bacteria 4381
40 Ga0070671_100797815 3300005355 Bacteria 822
41 Ga0070671_101330014 3300005355 Bacteria 634
42 Ga0070659_100049705 3300005366 Bacteria 3298
43 Ga0070659_100054618 3300005366 Bacteria 3146
44 Ga0070659_101168960 3300005366 Bacteria 680
45 Ga0070667_100000998 3300005367 Bacteria 25961
46 Ga0070667_100001602 3300005367 Bacteria 20248
47 Ga0070667_100007905 3300005367 Bacteria 8823
48 Ga0070667_100011501 3300005367 Bacteria 7319
49 Ga0070667_100058832 3300005367 Bacteria 3250
50 Ga0070663_100101057 3300005455 Bacteria 2152
51 Ga0070663_101054260 3300005455 Bacteria 709
52 Ga0070662_100001119 3300005457 Bacteria 16375
53 Ga0070662_100118583 3300005457 Bacteria 2026
54 Ga0070681_10002647 3300005458 Bacteria 16442
55 Ga0070681_11770234 3300005458 Bacteria 545
56 Ga0070707_101047625 3300005468 Bacteria 781
57 Ga0070679_100002687 3300005530 Bacteria 16196
58 Ga0070679_100132426 3300005530 Bacteria 2474
59 Ga0070679_100173227 3300005530 Bacteria 2130
60 Ga0070679_100527508 3300005530 Bacteria 1125
61 Ga0070679_100655079 3300005530 Bacteria 993
62 Ga0070679_101934650 3300005530 Bacteria 538
63 Ga0070684_100189909 3300005535 Bacteria 1869
64 Ga0070684_100478349 3300005535 Bacteria 1153
65 Ga0068853_100047946 3300005539 Bacteria 3667
66 Ga0068853_100949023 3300005539 Bacteria 827
67 Ga0068853_101025056 3300005539 Bacteria 795
68 Ga0070686_100150652 3300005544 Bacteria 1629
69 Ga0070693_100289961 3300005547 Bacteria 1099
70 Ga0070665_100000107 3300005548 Bacteria 156048
71 Ga0070665_100003786 3300005548 Bacteria 16009
72 Ga0070665_100022366 3300005548 Bacteria 6363
73 Ga0070665_100120521 3300005548 Bacteria 2625
74 Ga0070665_100395975 3300005548 Bacteria 1389
75 Ga0070665_100532855 3300005548 Bacteria 1186
76 Ga0070665_100744214 3300005548 Bacteria 993
77 Ga0068855_100014772 3300005563 Bacteria 9406
78 Ga0068855_100019897 3300005563 Bacteria 8061
79 Ga0068855_100034858 3300005563 Bacteria 5997
80 Ga0068855_100058595 3300005563 Bacteria 4509
81 Ga0068855_100859043 3300005563 Bacteria 961
82 Ga0070664_100011134 3300005564 Bacteria 7294
83 Ga0070664_100167840 3300005564 Bacteria 1945
84 Ga0070664_100816556 3300005564 Bacteria 872
85 Ga0070664_101277729 3300005564 Bacteria 693
86 Ga0068857_100026635 3300005577 Bacteria 5096
87 Ga0068857_100406941 3300005577 Bacteria 1267
88 Ga0068857_100453743 3300005577 Bacteria 1199
89 Ga0068857_100909489 3300005577 Bacteria 844
90 Ga0068857_101303113 3300005577 Bacteria 705
91 Ga0068854_100014393 3300005578 Bacteria 5215
92 Ga0068854_100026074 3300005578 Bacteria 4014
93 Ga0068854_100311268 3300005578 Bacteria 1277
94 Ga0068854_100808194 3300005578 Bacteria 818
95 Ga0068854_102221752 3300005578 Bacteria 508
96 Ga0068856_100010899 3300005614 Bacteria 8824
97 Ga0068856_100034245 3300005614 Bacteria 4975
98 Ga0068852_100000758 3300005616 Bacteria 21259
99 Ga0068852_100051241 3300005616 Bacteria 3542
100 Ga0068852_100105092 3300005616 Bacteria 2557
101 Ga0068852_100105713 3300005616 Bacteria 2551
102 Ga0068852_100256336 3300005616 Bacteria 1678
103 Ga0068852_100416092 3300005616 Bacteria 1325
104 Ga0068852_100818601 3300005616 Bacteria 946
105 Ga0068852_101558697 3300005616 Bacteria 683
106 Ga0068859_100037781 3300005617 Bacteria 4845
107 Ga0068859_100132339 3300005617 Bacteria 2566
108 Ga0068859_101229877 3300005617 Bacteria 825
109 Ga0068864_100008944 3300005618 Bacteria 8255
110 Ga0068864_100045762 3300005618 Bacteria 3754
111 Ga0068864_100105839 3300005618 Bacteria 2501
112 Ga0068851_10729550 3300005834 Bacteria 612
113 Ga0068863_100000063 3300005841 Bacteria 118269
114 Ga0068863_100008940 3300005841 Bacteria 9780
115 Ga0068863_100060815 3300005841 Bacteria 3572
116 Ga0068863_100309527 3300005841 Bacteria 1533
117 Ga0068863_101963737 3300005841 Bacteria 595
118 Ga0068858_100004469 3300005842 Bacteria 13713
119 Ga0068858_100021273 3300005842 Bacteria 6059
120 Ga0068858_100028113 3300005842 Bacteria 5225
121 Ga0068858_100085584 3300005842 Bacteria 2933
122 Ga0068860_100000008 3300005843 Bacteria 427367
123 Ga0068860_100012277 3300005843 Bacteria 8442
124 Ga0068860_100318836 3300005843 Bacteria 1525
125 Ga0068862_100003802 3300005844 Bacteria 12860
126 Ga0068862_100006131 3300005844 Bacteria 10007
127 Ga0068862_100114139 3300005844 Bacteria 2374
128 Ga0068862_100580905 3300005844 Bacteria 1073
129 Ga0068862_100794163 3300005844 Bacteria 924
130 Ga0075364_10003609 3300006051 Bacteria 8818
131 Ga0075364_10061160 3300006051 Bacteria 2470
132 Ga0075362_10000224 3300006177 Bacteria 15734
133 Ga0075362_10001562 3300006177 Bacteria 7399
134 Ga0075362_10626854 3300006177 Bacteria 557
135 Ga0075367_10457094 3300006178 Bacteria 809
136 Ga0075367_10745492 3300006178 Bacteria 623
137 Ga0075369_10000603 3300006186 Bacteria 11416
138 Ga0075369_10099578 3300006186 Bacteria 1303
139 Ga0075366_10000165 3300006195 Bacteria 28155
140 Ga0075366_10024496 3300006195 Bacteria 3520
141 Ga0097621_101802140 3300006237 Bacteria 583
142 Ga0075370_10000055 3300006353 Bacteria 33979
143 Ga0075370_10109389 3300006353 Bacteria 1604
144 Ga0075370_10114286 3300006353 Bacteria 1569
145 Ga0075370_10395206 3300006353 Bacteria 829
146 Ga0075370_10958928 3300006353 Bacteria 524
147 Ga0068871_101491322 3300006358 Bacteria 639
148 Ga0068865_101363913 3300006881 Bacteria 632
149 Ga0097620_100037781 3300006931 Bacteria 4845
150 Ga0097620_100132345 3300006931 Bacteria 2566
151 Ga0097620_101230097 3300006931 Bacteria 825
152 Ga0079104_1017488 3300006946 Bacteria 2060
153 Ga0079104_1042513 3300006946 Bacteria 1052
154 Ga0079104_1053935 3300006946 Bacteria 886
155 Ga0079104_1063071 3300006946 Bacteria 794
156 Ga0075435_100360923 3300007076 Bacteria 1246
157 Ga0105251_10005734 3300009011 Bacteria 8055
158 Ga0105250_10030137 3300009092 Bacteria 2181
159 Ga0105240_11252464 3300009093 Bacteria 784
160 Ga0105247_10435273 3300009101 Bacteria 942
161 Ga0105247_10671701 3300009101 Bacteria 776
162 Ga0105248_10062723 3300009177 Bacteria 4173
163 Ga0105248_10116332 3300009177 Bacteria 3016
164 Ga0105248_10119186 3300009177 Bacteria 2977
165 Ga0105248_10158753 3300009177 Bacteria 2551
166 Ga0105248_10253309 3300009177 Bacteria 1981
167 Ga0105248_10254717 3300009177 Bacteria 1976
168 Ga0105248_10537137 3300009177 Bacteria 1319
169 Ga0105237_11308184 3300009545 Bacteria 731
170 Ga0105238_10157731 3300009551 Bacteria 2244
171 Ga0105238_10977955 3300009551 Bacteria 867
172 Ga0105249_10193944 3300009553 Bacteria 1984
173 Ga0105249_10378964 3300009553 Bacteria 1440
174 Ga0105249_10922752 3300009553 Bacteria 941
175 Ga0105239_10296219 3300010375 Bacteria 1822
176 Ga0105239_10993643 3300010375 Bacteria 965
177 Ga0105239_11809824 3300010375 Bacteria 708
178 Ga0157373_10082545 3300013100 Bacteria 2265
179 Ga0157373_10578562 3300013100 Bacteria 816
180 Ga0157371_10002809 3300013102 Bacteria 16324
181 Ga0157371_10036220 3300013102 Bacteria 3534
182 Ga0157371_10153097 3300013102 Bacteria 1645
183 Ga0157370_10010951 3300013104 Bacteria 9517
184 Ga0157370_11537248 3300013104 Bacteria 598
185 Ga0157370_12049128 3300013104 Bacteria 513
186 Ga0157369_10031565 3300013105 Bacteria 5832
187 Ga0157369_10839832 3300013105 Bacteria 943
188 Ga0157374_11626225 3300013296 Bacteria 670
189 Ga0163162_10014475 3300013306 Bacteria 7708
190 Ga0163162_10167894 3300013306 Bacteria 2318
191 Ga0163162_10197192 3300013306 Bacteria 2142
192 Ga0157372_10146911 3300013307 Bacteria 2719
193 Ga0157372_10218382 3300013307 Bacteria 2210
194 Ga0157372_10277271 3300013307 Bacteria 1949
195 Ga0157372_10984604 3300013307 Bacteria 977
196 Ga0157372_12154564 3300013307 Bacteria 640
197 Ga0157380_12381425 3300014326 Bacteria 594
198 Ga0209050_1001431 3300025298 Bacteria 25715
199 Ga0207697_10023094 3300025315 Bacteria 2547
200 Ga0207697_10458502 3300025315 Bacteria 565
201 Ga0207696_1002800 3300025711 Bacteria 8275
202 Ga0207713_1001941 3300025735 Bacteria 15635
203 Ga0207680_10381077 3300025903 Bacteria 994
204 Ga0207680_10422650 3300025903 Bacteria 944
205 Ga0207647_10166053 3300025904 Bacteria 1286
206 Ga0207647_10724915 3300025904 Bacteria 540
207 Ga0207705_10000004 3300025909 Bacteria 705756
208 Ga0207705_10013543 3300025909 Bacteria 5886
209 Ga0207705_10160089 3300025909 Bacteria 1691
210 Ga0207705_10247778 3300025909 Bacteria 1358
211 Ga0207705_10252728 3300025909 Bacteria 1344
212 Ga0207705_10544885 3300025909 Bacteria 902
213 Ga0207707_11054439 3300025912 Bacteria 665
214 Ga0207695_10007818 3300025913 Bacteria 13529
215 Ga0207671_11379547 3300025914 Bacteria 547
216 Ga0207660_10081512 3300025917 Bacteria 2378
217 Ga0207657_10001019 3300025919 Bacteria 29733
218 Ga0207649_10011737 3300025920 Bacteria 4843
219 Ga0207649_10258227 3300025920 Bacteria 1258
220 Ga0207649_10770472 3300025920 Bacteria 750
221 Ga0207652_10003055 3300025921 Bacteria 13969
222 Ga0207652_10037112 3300025921 Bacteria 4124
223 Ga0207652_10238908 3300025921 Bacteria 1637
224 Ga0207652_10386966 3300025921 Bacteria 1262
225 Ga0207652_10524322 3300025921 Bacteria 1066
226 Ga0207681_10002566 3300025923 Bacteria 11526
227 Ga0207681_10006548 3300025923 Bacteria 7146
228 Ga0207681_10016888 3300025923 Bacteria 4576
229 Ga0207681_10956275 3300025923 Bacteria 718
230 Ga0207681_11111162 3300025923 Bacteria 664
231 Ga0207694_10137682 3300025924 Bacteria 1962
232 Ga0207650_10147954 3300025925 Bacteria 1851
233 Ga0207650_10229638 3300025925 Bacteria 1496
234 Ga0207659_10385227 3300025926 Bacteria 1170
235 Ga0207664_10704950 3300025929 Bacteria 908
236 Ga0207644_10000087 3300025931 Bacteria 67315
237 Ga0207644_10000340 3300025931 Bacteria 30290
238 Ga0207644_10003273 3300025931 Bacteria 10467
239 Ga0207644_10021473 3300025931 Bacteria 4399
240 Ga0207644_10503965 3300025931 Bacteria 999
241 Ga0207644_11078784 3300025931 Bacteria 675
242 Ga0207690_10008564 3300025932 Bacteria 6070
243 Ga0207690_10504006 3300025932 Bacteria 979
244 Ga0207706_10003993 3300025933 Bacteria 13976
245 Ga0207706_10308999 3300025933 Bacteria 1377
246 Ga0207711_10051707 3300025941 Bacteria 3519
247 Ga0207711_10127685 3300025941 Bacteria 2276
248 Ga0207711_10190382 3300025941 Bacteria 1869
249 Ga0207711_10546457 3300025941 Bacteria 1080
250 Ga0207711_10727738 3300025941 Bacteria 925
251 Ga0207711_10766123 3300025941 Bacteria 899
252 Ga0207661_10180176 3300025944 Bacteria 1845
253 Ga0207661_11962162 3300025944 Bacteria 531
254 Ga0207679_10053825 3300025945 Bacteria 2960
255 Ga0207679_10061000 3300025945 Bacteria 2805
256 Ga0207667_10005918 3300025949 Bacteria 14893
257 Ga0207667_10017546 3300025949 Bacteria 8051
258 Ga0207667_10044625 3300025949 Bacteria 4696
259 Ga0207667_10056281 3300025949 Bacteria 4131
260 Ga0207667_10351442 3300025949 Bacteria 1503
261 Ga0207667_10403406 3300025949 Bacteria 1392
262 Ga0207667_10422971 3300025949 Bacteria 1355
263 Ga0207712_10948067 3300025961 Bacteria 762
264 Ga0207668_10002561 3300025972 Bacteria 10621
265 Ga0207668_10016806 3300025972 Bacteria 4575
266 Ga0207668_10037776 3300025972 Bacteria 3235
267 Ga0207668_10101665 3300025972 Bacteria 2137
268 Ga0207668_10552993 3300025972 Bacteria 997
269 Ga0207640_10000601 3300025981 Bacteria 21426
270 Ga0207640_10011203 3300025981 Bacteria 5070
271 Ga0207640_10045815 3300025981 Bacteria 2811
272 Ga0207640_10285345 3300025981 Bacteria 1299
273 Ga0207658_10001020 3300025986 Bacteria 22790
274 Ga0207658_10004335 3300025986 Bacteria 9876
275 Ga0207658_10013921 3300025986 Bacteria 5504
276 Ga0207658_10016803 3300025986 Bacteria 5035
277 Ga0207658_10136685 3300025986 Bacteria 1978
278 Ga0207658_10176195 3300025986 Bacteria 1766
279 Ga0207703_10005483 3300026035 Bacteria 10198
280 Ga0207703_10006539 3300026035 Bacteria 9298
281 Ga0207703_10069601 3300026035 Bacteria 2903
282 Ga0207703_10233091 3300026035 Bacteria 1651
283 Ga0207639_10029260 3300026041 Bacteria 4031
284 Ga0207639_10074689 3300026041 Bacteria 2663
285 Ga0207639_10335995 3300026041 Bacteria 1346
286 Ga0207678_10153702 3300026067 Bacteria 1965
287 Ga0207678_10953663 3300026067 Bacteria 759
288 Ga0207702_10003311 3300026078 Bacteria 14824
289 Ga0207702_10052951 3300026078 Bacteria 3435
290 Ga0207641_10000081 3300026088 Bacteria 139770
291 Ga0207641_10048636 3300026088 Bacteria 3580
292 Ga0207641_10075846 3300026088 Bacteria 2905
293 Ga0207641_10247505 3300026088 Bacteria 1663
294 Ga0207641_11208578 3300026088 Bacteria 756
295 Ga0207676_10016348 3300026095 Bacteria 5372
296 Ga0207676_10374769 3300026095 Bacteria 1323
297 Ga0207676_10562782 3300026095 Bacteria 1090
298 Ga0207674_10043371 3300026116 Bacteria 4638
299 Ga0207674_10090330 3300026116 Bacteria 3054
300 Ga0207674_10174678 3300026116 Bacteria 2101
301 Ga0207674_10385007 3300026116 Bacteria 1356
302 Ga0207674_10455305 3300026116 Bacteria 1237
303 Ga0207698_10000459 3300026142 Bacteria 23673
304 Ga0207698_10051714 3300026142 Bacteria 3142
305 Ga0207698_10085474 3300026142 Bacteria 2562
306 Ga0207698_10128022 3300026142 Bacteria 2164
307 Ga0207698_10223869 3300026142 Bacteria 1702
308 Ga0207698_10533081 3300026142 Bacteria 1148
309 Ga0207698_10726917 3300026142 Bacteria 990
310 Ga0207698_11760381 3300026142 Bacteria 635
311 Ga0209281_1010906 3300027111 Bacteria 2055
312 Ga0209281_1033098 3300027111 Bacteria 910
313 Ga0209974_10007859 3300027876 Bacteria 3659
314 Ga0209974_10022724 3300027876 Bacteria 2077
315 Ga0207428_10080863 3300027907 Bacteria 2538
316 Ga0268266_10000462 3300028379 Bacteria 59105
317 Ga0268266_10008187 3300028379 Bacteria 9328
318 Ga0268266_10844423 3300028379 Bacteria 885
319 Ga0268266_10873220 3300028379 Bacteria 869
320 Ga0268265_10008470 3300028380 Bacteria 6947
321 Ga0268265_10029620 3300028380 Bacteria 3932
322 Ga0268265_10089395 3300028380 Bacteria 2456
323 Ga0268265_10430316 3300028380 Bacteria 1228
324 Ga0268264_10000018 3300028381 Bacteria 495324
325 Ga0268264_10019317 3300028381 Bacteria 5570
326 Ga0268264_11006057 3300028381 Bacteria 840
327 Ga0265331_10022653 3300031250 Bacteria 3203
328 Ga0265327_10349454 3300031251 Bacteria 646
329 Ga0307508_10028060 3300031616 Bacteria 5093
330 Ga0307405_10020044 3300031731 Bacteria 3728
331 Ga0307405_10915136 3300031731 Bacteria 743
332 Ga0307413_10055522 3300031824 Bacteria 2410
333 Ga0307413_10636587 3300031824 Bacteria 878
334 Ga0307413_11660536 3300031824 Bacteria 569
335 Ga0307413_11714780 3300031824 Bacteria 560
336 Ga0307413_12160986 3300031824 Bacteria 504
337 Ga0307410_10793359 3300031852 Bacteria 805
338 Ga0307407_10209976 3300031903 Bacteria 1310
339 Ga0307412_10013998 3300031911 Bacteria 4722
340 Ga0307409_100186857 3300031995 Bacteria 1840
341 Ga0307409_100659868 3300031995 Bacteria 1041
342 Ga0307409_101468269 3300031995 Bacteria 709
343 Ga0307409_101988086 3300031995 Bacteria 611
344 Ga0307409_102415654 3300031995 Bacteria 555
345 Ga0307416_101329263 3300032002 Bacteria 825
346 Ga0307414_10597986 3300032004 Bacteria 989
347 Ga0307414_11179300 3300032004 Bacteria 709
348 Ga0307411_10061273 3300032005 Bacteria 2504
349 Ga0307411_10087411 3300032005 Bacteria 2165
350 Ga0307415_100131927 3300032126 Bacteria 1893
351 Ga0373932_0250651 3300035112 Bacteria 646
352 Ga0373939_0309411 3300035114 Bacteria 632
353 Ga0316574_0652228 3300035398 Bacteria 648
354 Ga0373935_0468988 3300035692 Bacteria 911
355 Ga0316584_0159681 3300036712 Bacteria 1675
356 Ga0451576_0000007 3300045051 Bacteria 782228
357 Ga0495627_000217 3300046453 Bacteria 62536
358 Ga0495650_0000559 3300046471 Bacteria 52755
359 Ga0495639_0363466 3300046475 Bacteria 728
360 Ga0495596_0000233 3300046500 Bacteria 37690
361 Ga0495596_0007814 3300046500 Bacteria 4797
362 Ga0495607_0025544 3300046501 Bacteria 3673
363 Ga0495583_0168886 3300046506 Bacteria 899
364 Ga0495606_0029863 3300046507 Bacteria 3820
365 Ga0495610_0000030 3300046512 Bacteria 265950
366 Ga0495610_0000743 3300046512 Bacteria 30950
367 Ga0495610_0002541 3300046512 Bacteria 15200
368 Ga0495620_0023302 3300046515 Bacteria 2963
369 Ga0495632_0005692 3300046519 Bacteria 8181
370 Ga0495632_0061761 3300046519 Bacteria 1818
371 Ga0495643_0000110 3300046522 Bacteria 135600
372 Ga0495643_0010124 3300046522 Bacteria 5815
373 Ga0495643_0016156 3300046522 Bacteria 4392
374 Ga0495643_0026681 3300046522 Bacteria 3255
375 Ga0495663_0321605 3300046525 Bacteria 560
376 Ga0495652_1081901 3300046529 Bacteria 521
377 Ga0495654_0178469 3300046530 Bacteria 921
378 Ga0495654_0275725 3300046530 Bacteria 693
379 Ga0495587_0439863 3300046536 Bacteria 723
380 Ga0495668_0072941 3300046616 Bacteria 1886
381 Ga0495668_0073421 3300046616 Bacteria 1879
382 Ga0495668_0402879 3300046616 Bacteria 752
383 Ga0495625_0008300 3300046660 Bacteria 8875
384 Ga0495625_0360826 3300046660 Bacteria 916
385 Ga0495661_0093611 3300046665 Bacteria 1705
386 Ga0495681_0000011 3300047470 Bacteria 201843
387 Ga0495686_0249834 3300047472 Bacteria 997
388 Ga0495686_0365195 3300047472 Bacteria 782
389 Ga0495615_0000025 3300048090 Bacteria 49753
390 Ga0495626_0004061 3300048091 Bacteria 9120
391 Ga0496100_0005027 3300048903 Bacteria 7076
392 Ga0496100_0053361 3300048903 Bacteria 2632
393 Ga0496101_0052143 3300048904 Bacteria 2949
394 Ga0496101_0071618 3300048904 Bacteria 2542
395 Ga0496101_0437837 3300048904 Bacteria 1031
396 Ga0496101_0523329 3300048904 Bacteria 937
397 Ga0496102_0000998 3300048905 Bacteria 26613
398 Ga0496102_0053745 3300048905 Bacteria 3671
399 Ga0496102_0848525 3300048905 Bacteria 836
400 Ga0496102_1942457 3300048905 Bacteria 505
401 Ga0496103_0000201 3300048906 Bacteria 59837
402 Ga0496103_0019567 3300048906 Bacteria 4065
403 Ga0496103_0292193 3300048906 Bacteria 1048
404 Ga0496104_0000078 3300048907 Bacteria 100203
405 Ga0496104_0219714 3300048907 Bacteria 1812
406 Ga0496105_0004202 3300048908 Bacteria 10816
407 Ga0496105_0059223 3300048908 Bacteria 3160
408 Ga0496105_0563877 3300048908 Bacteria 887
409 Ga0496105_0611034 3300048908 Bacteria 845
410 Ga0496106_0002700 3300048909 Bacteria 13158
411 Ga0496106_0613235 3300048909 Bacteria 871
412 Ga0496107_0006277 3300048910 Bacteria 8171
413 Ga0496108_0211764 3300048911 Bacteria 1682
414 Ga0496108_0261278 3300048911 Bacteria 1507
415 Ga0496109_0008938 3300048912 Bacteria 8536
416 Ga0496109_0034178 3300048912 Bacteria 4577
417 Ga0496110_0050983 3300048913 Bacteria 3636
418 Ga0496110_0111736 3300048913 Bacteria 2456
419 Ga0496110_1512883 3300048913 Bacteria 581
420 Ga0496111_0023891 3300048914 Bacteria 4296
421 Ga0496112_0172573 3300048915 Bacteria 2127
422 Ga0496112_1046145 3300048915 Bacteria 735
423 Ga0496113_0003327 3300048916 Bacteria 9598
424 Ga0496113_0005353 3300048916 Bacteria 7997
425 Ga0496114_0046711 3300048917 Bacteria 3599
426 Ga0496114_0304975 3300048917 Bacteria 1406
427 Ga0496116_0000028 3300048919 Bacteria 424086
428 Ga0496116_0074998 3300048919 Bacteria 2125
429 Ga0496116_0127484 3300048919 Bacteria 1458
430 Ga0496116_0160607 3300048919 Bacteria 1233
431 Ga0496117_0098938 3300048920 Bacteria 1852
432 Ga0496117_0265331 3300048920 Bacteria 928
433 Ga0496118_0044905 3300048921 Bacteria 3455
434 Ga0496118_0087280 3300048921 Bacteria 2164
435 Ga0496118_0150407 3300048921 Bacteria 1458
436 Ga0496118_0436684 3300048921 Bacteria 669
437 Ga0496119_0000114 3300048922 Bacteria 114495
438 Ga0496119_0391750 3300048922 Bacteria 664
439 Ga0496120_0000266 3300048923 Bacteria 87412
440 Ga0496120_0106705 3300048923 Bacteria 1470
441 Ga0496120_0310592 3300048923 Bacteria 719
442 Ga0496121_0000021 3300048924 Bacteria 478544
443 Ga0496121_0000520 3300048924 Bacteria 73411
444 Ga0496121_0002014 3300048924 Bacteria 32249
445 Ga0496121_0010367 3300048924 Bacteria 10526
446 Ga0496121_0041974 3300048924 Bacteria 3987
447 Ga0496122_0008602 3300048925 Bacteria 10961
448 Ga0496122_0012616 3300048925 Bacteria 8385
449 Ga0496122_0042142 3300048925 Bacteria 3595
450 Ga0496122_0102140 3300048925 Bacteria 1913
451 Ga0496122_0284079 3300048925 Bacteria 902
452 Ga0496122_0329468 3300048925 Bacteria 807
453 Ga0496122_0578838 3300048925 Bacteria 529
454 Ga0496123_0001658 3300048926 Bacteria 29886
455 Ga0496123_0001678 3300048926 Bacteria 29639
456 Ga0496123_0100614 3300048926 Bacteria 1683
457 Ga0496123_0147097 3300048926 Bacteria 1277
458 Ga0496123_0192765 3300048926 Bacteria 1052
459 Ga0496124_0003121 3300048927 Bacteria 20560
460 Ga0496124_0003580 3300048927 Bacteria 18883
461 Ga0496124_0004225 3300048927 Bacteria 16906
462 Ga0496124_0040943 3300048927 Bacteria 4002
463 Ga0496124_0059973 3300048927 Bacteria 3194
464 Ga0496124_0213779 3300048927 Bacteria 1457
465 Ga0496125_0013528 3300048928 Bacteria 8017
466 Ga0496125_0022629 3300048928 Bacteria 5830
467 Ga0496125_0031114 3300048928 Bacteria 4762
468 Ga0496125_0081513 3300048928 Bacteria 2471
469 Ga0496125_0413899 3300048928 Bacteria 784
470 Ga0496126_0000079 3300048929 Bacteria 222463
471 Ga0496126_0000173 3300048929 Bacteria 146490
472 Ga0496126_0005189 3300048929 Bacteria 15051
473 Ga0496126_0094396 3300048929 Bacteria 2625
474 Ga0496126_0429614 3300048929 Bacteria 1066
475 Ga0495682_0295026 3300049460 Bacteria 572
476 Ga0501031_0301097 3300049568 Bacteria 1039
477 Ga0501033_0330928 3300049570 Bacteria 1069
478 Ga0501033_0650644 3300049570 Bacteria 720
479 Ga0501034_0597955 3300049571 Bacteria 1009
480 Ga0501036_1476949 3300049572 Bacteria 550
481 Ga0501037_0921657 3300049573 Bacteria 572
482 Ga0501047_0388150 3300049581 Bacteria 1230
483 Ga0501035_0750341 3300049822 Bacteria 783
484 Ga0501044_0001951 3300049823 Bacteria 23856
485 Ga0501044_0591689 3300049823 Bacteria 1003
486 Ga0501044_1427294 3300049823 Bacteria 558
487 nmdc:mga03683_209906_c1 3300050489 Bacteria 896
488 nmdc:mga03683_906_c1 3300050489 Bacteria 8520
489 nmdc:mga03n38_291_c1 3300050490 Bacteria 12010
490 nmdc:mga00v17_178182_c1 3300050491 Bacteria 1371
491 nmdc:mga00v17_18971_c1 3300050491 Bacteria 3917
492 nmdc:mga0k408_561372_c1 3300050493 Bacteria 674
493 nmdc:mga0k408_7997_c1 3300050493 Bacteria 5669
494 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
495 nmdc:mga07m45_2156_c1 3300050496 Bacteria 9166
496 nmdc:mga07m45_64983_c1 3300050496 Bacteria 2071
497 nmdc:mga07m45_82669_c1 3300050496 Bacteria 1834
498 nmdc:mga07m45_83984_c1 3300050496 Bacteria 1820
499 nmdc:mga0rr50_399162_c1 3300050513 Bacteria 1161
500 nmdc:mga0sz30_256747_c1 3300050516 Bacteria 778
501 nmdc:mga0sz30_56372_c1 3300050516 Bacteria 1673
502 Ga0500643_000001 3300053087 Bacteria 1440111
503 Ga0500643_008523 3300053087 Bacteria 4023
504 Ga0500643_109956 3300053087 Bacteria 745
505 Ga0500566_0159358 3300053094 Bacteria 1178
506 Ga0500562_188695 3300053108 Bacteria 559
507 Ga0500572_297339 3300053111 Bacteria 520
508 Ga0500595_018192 3300053119 Bacteria 2575
509 Ga0500607_000354 3300053121 Bacteria 43487
510 Ga0500607_004167 3300053121 Bacteria 10087
511 Ga0500608_000156 3300053122 Bacteria 28195
512 Ga0500614_088638 3300053123 Bacteria 876
513 Ga0500559_0001842 3300053136 Bacteria 11561
514 Ga0500559_0012360 3300053136 Bacteria 3632
515 Ga0500564_059241 3300053138 Bacteria 1739
516 Ga0500568_0248485 3300053139 Bacteria 648
517 Ga0500590_002875 3300053148 Bacteria 7797
518 Ga0500590_224027 3300053148 Bacteria 772
519 Ga0500604_0155323 3300053151 Bacteria 778
520 Ga0500616_0000893 3300053153 Bacteria 32769
521 Ga0500622_0000145 3300053156 Bacteria 75417
522 Ga0500637_0027500 3300053178 Bacteria 3140
523 Ga0500567_004902 3300053723 Bacteria 6143
524 Ga0500625_000021 3300053729 Bacteria 83503
525 Ga0500625_258391 3300053729 Bacteria 510
526 Ga0500645_005657 3300053730 Bacteria 4565
527 Ga0500645_018923 3300053730 Bacteria 2146

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2895880812 2895884274 102
2 3300049573 Ga0501037_0921657 Ga0501037_0921657_112_492 103
3 3300046512 Ga0495610_0002541 Ga0495610_0002541_9588_9902 104
4 3300046660 Ga0495625_0360826 Ga0495625_0360826_72_452 104
5 3300047472 Ga0495686_0365195 Ga0495686_0365195_74_454 104
6 3300048091 Ga0495626_0004061 Ga0495626_0004061_5177_5491 104
7 3300053087 Ga0500643_008523 Ga0500643_008523_2517_2897 104
8 3300046530 Ga0495654_0178469 Ga0495654_0178469_267_599 105
9 3300053730 Ga0500645_018923 Ga0500645_018923_774_1106 105
10 iso_pu_bacteria 2738541301 2738849996 106
11 iso_pu_bacteria 2738541304 2738865725 106
12 iso_pu_bacteria 2738543022 2739298243 106
13 iso_pu_bacteria 2738543033 2739359921 106
14 iso_pu_bacteria 2739367664 2739649143 106
15 iso_pu_bacteria 2739367865 2740027616 106
16 iso_pu_bacteria 2818991438 2819553065 106
17 iso_pu_bacteria 2928100450 2928104189 106
18 iso_pu_bacteria 2928959182 2928961654 106
19 iso_pu_bacteria 8054302542 8054305899 106
20 iso_pu_bacteria 2882806704 2882807359 107
21 3300046529 Ga0495652_1081901 Ga0495652_1081901_49_375 108
22 3300048913 Ga0496110_1512883 Ga0496110_1512883_243_569 108
23 3300053148 Ga0500590_002875 Ga0500590_002875_2062_2388 108
24 iso_pu_bacteria 2510917021 2511125719 108
25 3300005295 Ga0065707_10163979 Ga0065707_101639792 109
26 3300005331 Ga0070670_100092329 Ga0070670_1000923292 109
27 3300005335 Ga0070666_10084446 Ga0070666_100844462 109
28 3300005353 Ga0070669_100008686 Ga0070669_1000086863 109
29 3300005353 Ga0070669_101368264 Ga0070669_1013682641 109
30 3300005355 Ga0070671_100000818 Ga0070671_1000008182 109
31 3300005367 Ga0070667_100011501 Ga0070667_1000115018 109
32 3300005468 Ga0070707_101047625 Ga0070707_1010476252 109
33 3300005548 Ga0070665_100000107 Ga0070665_10000010779 109
34 3300005548 Ga0070665_100744214 Ga0070665_1007442142 109
35 3300005841 Ga0068863_100008940 Ga0068863_1000089402 109
36 3300005841 Ga0068863_101963737 Ga0068863_1019637372 109
37 3300005843 Ga0068860_100318836 Ga0068860_1003188362 109
38 3300005844 Ga0068862_100003802 Ga0068862_1000038024 109
39 3300005844 Ga0068862_100006131 Ga0068862_1000061313 109
40 3300009177 Ga0105248_10253309 Ga0105248_102533093 109
41 3300009553 Ga0105249_10378964 Ga0105249_103789642 109
42 3300025315 Ga0207697_10458502 Ga0207697_104585021 109
43 3300025735 Ga0207713_1001941 Ga0207713_10019414 109
44 3300025923 Ga0207681_10016888 Ga0207681_100168882 109
45 3300025923 Ga0207681_10956275 Ga0207681_109562752 109
46 3300025925 Ga0207650_10229638 Ga0207650_102296381 109
47 3300025931 Ga0207644_10000340 Ga0207644_1000034016 109
48 3300025941 Ga0207711_10190382 Ga0207711_101903822 109
49 3300025961 Ga0207712_10948067 Ga0207712_109480671 109
50 3300025972 Ga0207668_10002561 Ga0207668_100025616 109
51 3300025986 Ga0207658_10013921 Ga0207658_100139216 109
52 3300026088 Ga0207641_10247505 Ga0207641_102475052 109
53 3300026088 Ga0207641_11208578 Ga0207641_112085782 109
54 3300028379 Ga0268266_10000462 Ga0268266_1000046252 109
55 3300028380 Ga0268265_10008470 Ga0268265_100084702 109
56 3300028380 Ga0268265_10029620 Ga0268265_100296202 109
57 3300028381 Ga0268264_10019317 Ga0268264_100193175 109
58 3300031824 Ga0307413_10055522 Ga0307413_100555222 109
59 3300031852 Ga0307410_10793359 Ga0307410_107933592 109
60 3300031995 Ga0307409_100659868 Ga0307409_1006598681 109
61 3300032005 Ga0307411_10087411 Ga0307411_100874114 109
62 3300045051 Ga0451576_0000007 Ga0451576_0000007_741337_741666 109
63 3300048929 Ga0496126_0429614 Ga0496126_0429614_708_1037 109
64 3300050493 nmdc:mga0k408_561372_c1 nmdc:mga0k408_561372_c1_302_631 109
65 3300053153 Ga0500616_0000893 Ga0500616_0000893_28936_29265 109
66 2162886007 SwRhRL2b_contig_1044026 SwRhRL2b_0451.00003340 110
67 2162886007 SwRhRL2b_contig_196785 SwRhRL2b_0777.00001830 110
68 2162886007 SwRhRL2b_contig_878851 SwRhRL2b_0744.00004040 110
69 3300002074 JGI24748J21848_1001818 JGI24748J21848_10018183 110
70 3300002239 JGI24034J26672_10069818 JGI24034J26672_100698182 110
71 3300002459 JGI24751J29686_10000080 JGI24751J29686_1000008014 110
72 3300003791 Ga0055530_10007261 Ga0055530_100072613 110
73 3300005289 Ga0065704_10070424 Ga0065704_100704245 110
74 3300005289 Ga0065704_10099696 Ga0065704_100996962 110
75 3300005289 Ga0065704_10791785 Ga0065704_107917851 110
76 3300005327 Ga0070658_10000371 Ga0070658_1000037132 110
77 3300005327 Ga0070658_10008372 Ga0070658_100083726 110
78 3300005327 Ga0070658_10190159 Ga0070658_101901592 110
79 3300005327 Ga0070658_10421638 Ga0070658_104216382 110
80 3300005329 Ga0070683_100094068 Ga0070683_1000940683 110
81 3300005329 Ga0070683_100120426 Ga0070683_1001204262 110
82 3300005329 Ga0070683_101700807 Ga0070683_1017008072 110
83 3300005330 Ga0070690_100066155 Ga0070690_1000661552 110
84 3300005331 Ga0070670_100177418 Ga0070670_1001774183 110
85 3300005335 Ga0070666_10442376 Ga0070666_104423761 110
86 3300005336 Ga0070680_100005540 Ga0070680_1000055404 110
87 3300005339 Ga0070660_100209166 Ga0070660_1002091661 110
88 3300005339 Ga0070660_100867063 Ga0070660_1008670632 110
89 3300005344 Ga0070661_100002979 Ga0070661_1000029792 110
90 3300005347 Ga0070668_100002062 Ga0070668_10000206217 110
91 3300005347 Ga0070668_100013390 Ga0070668_1000133904 110
92 3300005347 Ga0070668_100018387 Ga0070668_1000183872 110
93 3300005347 Ga0070668_100086994 Ga0070668_1000869943 110
94 3300005353 Ga0070669_100002274 Ga0070669_1000022749 110
95 3300005353 Ga0070669_100008689 Ga0070669_1000086894 110
96 3300005355 Ga0070671_100000066 Ga0070671_10000006638 110
97 3300005355 Ga0070671_100012590 Ga0070671_1000125908 110
98 3300005355 Ga0070671_100031501 Ga0070671_1000315013 110
99 3300005355 Ga0070671_100797815 Ga0070671_1007978152 110
100 3300005355 Ga0070671_101330014 Ga0070671_1013300142 110
101 3300005366 Ga0070659_100049705 Ga0070659_1000497053 110
102 3300005366 Ga0070659_100054618 Ga0070659_1000546183 110
103 3300005366 Ga0070659_101168960 Ga0070659_1011689601 110
104 3300005367 Ga0070667_100000998 Ga0070667_1000009989 110
105 3300005367 Ga0070667_100001602 Ga0070667_1000016022 110
106 3300005367 Ga0070667_100007905 Ga0070667_1000079053 110
107 3300005367 Ga0070667_100058832 Ga0070667_1000588323 110
108 3300005455 Ga0070663_100101057 Ga0070663_1001010573 110
109 3300005455 Ga0070663_101054260 Ga0070663_1010542602 110
110 3300005457 Ga0070662_100001119 Ga0070662_10000111917 110
111 3300005457 Ga0070662_100118583 Ga0070662_1001185832 110
112 3300005458 Ga0070681_10002647 Ga0070681_100026472 110
113 3300005458 Ga0070681_11770234 Ga0070681_117702342 110
114 3300005530 Ga0070679_100002687 Ga0070679_1000026875 110
115 3300005530 Ga0070679_100132426 Ga0070679_1001324263 110
116 3300005530 Ga0070679_100173227 Ga0070679_1001732272 110
117 3300005530 Ga0070679_100527508 Ga0070679_1005275081 110
118 3300005530 Ga0070679_100655079 Ga0070679_1006550792 110
119 3300005530 Ga0070679_101934650 Ga0070679_1019346501 110
120 3300005535 Ga0070684_100189909 Ga0070684_1001899091 110
121 3300005535 Ga0070684_100478349 Ga0070684_1004783492 110
122 3300005539 Ga0068853_100047946 Ga0068853_1000479464 110
123 3300005539 Ga0068853_100949023 Ga0068853_1009490231 110
124 3300005539 Ga0068853_101025056 Ga0068853_1010250562 110
125 3300005544 Ga0070686_100150652 Ga0070686_1001506522 110
126 3300005547 Ga0070693_100289961 Ga0070693_1002899612 110
127 3300005548 Ga0070665_100003786 Ga0070665_1000037864 110
128 3300005548 Ga0070665_100022366 Ga0070665_1000223667 110
129 3300005548 Ga0070665_100120521 Ga0070665_1001205212 110
130 3300005548 Ga0070665_100395975 Ga0070665_1003959753 110
131 3300005548 Ga0070665_100532855 Ga0070665_1005328552 110
132 3300005563 Ga0068855_100014772 Ga0068855_1000147723 110
133 3300005563 Ga0068855_100019897 Ga0068855_1000198977 110
134 3300005563 Ga0068855_100034858 Ga0068855_1000348587 110
135 3300005563 Ga0068855_100058595 Ga0068855_1000585955 110
136 3300005563 Ga0068855_100859043 Ga0068855_1008590431 110
137 3300005564 Ga0070664_100011134 Ga0070664_1000111347 110
138 3300005564 Ga0070664_100167840 Ga0070664_1001678402 110
139 3300005564 Ga0070664_100816556 Ga0070664_1008165562 110
140 3300005564 Ga0070664_101277729 Ga0070664_1012777292 110
141 3300005577 Ga0068857_100026635 Ga0068857_1000266354 110
142 3300005577 Ga0068857_100406941 Ga0068857_1004069412 110
143 3300005577 Ga0068857_100453743 Ga0068857_1004537432 110
144 3300005577 Ga0068857_100909489 Ga0068857_1009094892 110
145 3300005577 Ga0068857_101303113 Ga0068857_1013031132 110
146 3300005578 Ga0068854_100014393 Ga0068854_1000143935 110
147 3300005578 Ga0068854_100026074 Ga0068854_1000260742 110
148 3300005578 Ga0068854_100311268 Ga0068854_1003112682 110
149 3300005578 Ga0068854_100808194 Ga0068854_1008081942 110
150 3300005578 Ga0068854_102221752 Ga0068854_1022217522 110
151 3300005614 Ga0068856_100010899 Ga0068856_1000108999 110
152 3300005614 Ga0068856_100034245 Ga0068856_1000342455 110
153 3300005616 Ga0068852_100000758 Ga0068852_10000075822 110
154 3300005616 Ga0068852_100051241 Ga0068852_1000512415 110
155 3300005616 Ga0068852_100105092 Ga0068852_1001050924 110
156 3300005616 Ga0068852_100105713 Ga0068852_1001057132 110
157 3300005616 Ga0068852_100256336 Ga0068852_1002563362 110
158 3300005616 Ga0068852_100416092 Ga0068852_1004160922 110
159 3300005616 Ga0068852_100818601 Ga0068852_1008186012 110
160 3300005616 Ga0068852_101558697 Ga0068852_1015586972 110
161 3300005617 Ga0068859_100037781 Ga0068859_1000377814 110
162 3300005617 Ga0068859_100132339 Ga0068859_1001323392 110
163 3300005617 Ga0068859_101229877 Ga0068859_1012298771 110
164 3300005618 Ga0068864_100008944 Ga0068864_1000089444 110
165 3300005618 Ga0068864_100045762 Ga0068864_1000457623 110
166 3300005618 Ga0068864_100105839 Ga0068864_1001058393 110
167 3300005834 Ga0068851_10729550 Ga0068851_107295501 110
168 3300005841 Ga0068863_100000063 Ga0068863_10000006355 110
169 3300005841 Ga0068863_100060815 Ga0068863_1000608153 110
170 3300005841 Ga0068863_100309527 Ga0068863_1003095272 110
171 3300005842 Ga0068858_100004469 Ga0068858_10000446910 110
172 3300005842 Ga0068858_100021273 Ga0068858_1000212738 110
173 3300005842 Ga0068858_100028113 Ga0068858_1000281135 110
174 3300005842 Ga0068858_100085584 Ga0068858_1000855843 110
175 3300005843 Ga0068860_100000008 Ga0068860_100000008295 110
176 3300005843 Ga0068860_100012277 Ga0068860_1000122774 110
177 3300005844 Ga0068862_100114139 Ga0068862_1001141392 110
178 3300005844 Ga0068862_100580905 Ga0068862_1005809052 110
179 3300005844 Ga0068862_100794163 Ga0068862_1007941632 110
180 3300006051 Ga0075364_10003609 Ga0075364_100036096 110
181 3300006051 Ga0075364_10061160 Ga0075364_100611602 110
182 3300006177 Ga0075362_10000224 Ga0075362_100002244 110
183 3300006177 Ga0075362_10001562 Ga0075362_100015622 110
184 3300006177 Ga0075362_10626854 Ga0075362_106268542 110
185 3300006178 Ga0075367_10457094 Ga0075367_104570942 110
186 3300006178 Ga0075367_10745492 Ga0075367_107454922 110
187 3300006186 Ga0075369_10000603 Ga0075369_100006038 110
188 3300006186 Ga0075369_10099578 Ga0075369_100995782 110
189 3300006195 Ga0075366_10000165 Ga0075366_100001659 110
190 3300006195 Ga0075366_10024496 Ga0075366_100244962 110
191 3300006237 Ga0097621_101802140 Ga0097621_1018021402 110
192 3300006353 Ga0075370_10000055 Ga0075370_1000005516 110
193 3300006353 Ga0075370_10109389 Ga0075370_101093893 110
194 3300006353 Ga0075370_10114286 Ga0075370_101142862 110
195 3300006353 Ga0075370_10395206 Ga0075370_103952062 110
196 3300006353 Ga0075370_10958928 Ga0075370_109589282 110
197 3300006358 Ga0068871_101491322 Ga0068871_1014913221 110
198 3300006881 Ga0068865_101363913 Ga0068865_1013639132 110
199 3300006931 Ga0097620_100037781 Ga0097620_1000377814 110
200 3300006931 Ga0097620_100132345 Ga0097620_1001323452 110
201 3300006931 Ga0097620_101230097 Ga0097620_1012300972 110
202 3300006946 Ga0079104_1017488 Ga0079104_10174883 110
203 3300006946 Ga0079104_1042513 Ga0079104_10425132 110
204 3300006946 Ga0079104_1053935 Ga0079104_10539351 110
205 3300006946 Ga0079104_1063071 Ga0079104_10630712 110
206 3300007076 Ga0075435_100360923 Ga0075435_1003609232 110
207 3300009011 Ga0105251_10005734 Ga0105251_100057348 110
208 3300009092 Ga0105250_10030137 Ga0105250_100301371 110
209 3300009093 Ga0105240_11252464 Ga0105240_112524642 110
210 3300009101 Ga0105247_10435273 Ga0105247_104352732 110
211 3300009101 Ga0105247_10671701 Ga0105247_106717012 110
212 3300009177 Ga0105248_10062723 Ga0105248_100627234 110
213 3300009177 Ga0105248_10116332 Ga0105248_101163322 110
214 3300009177 Ga0105248_10119186 Ga0105248_101191863 110
215 3300009177 Ga0105248_10158753 Ga0105248_101587533 110
216 3300009177 Ga0105248_10254717 Ga0105248_102547173 110
217 3300009177 Ga0105248_10537137 Ga0105248_105371372 110
218 3300009545 Ga0105237_11308184 Ga0105237_113081842 110
219 3300009551 Ga0105238_10157731 Ga0105238_101577313 110
220 3300009551 Ga0105238_10977955 Ga0105238_109779552 110
221 3300009553 Ga0105249_10193944 Ga0105249_101939441 110
222 3300009553 Ga0105249_10922752 Ga0105249_109227522 110
223 3300010375 Ga0105239_10296219 Ga0105239_102962192 110
224 3300010375 Ga0105239_10993643 Ga0105239_109936432 110
225 3300010375 Ga0105239_11809824 Ga0105239_118098242 110
226 3300013100 Ga0157373_10082545 Ga0157373_100825453 110
227 3300013100 Ga0157373_10578562 Ga0157373_105785622 110
228 3300013102 Ga0157371_10002809 Ga0157371_100028095 110
229 3300013102 Ga0157371_10036220 Ga0157371_100362202 110
230 3300013102 Ga0157371_10153097 Ga0157371_101530974 110
231 3300013104 Ga0157370_10010951 Ga0157370_100109516 110
232 3300013104 Ga0157370_11537248 Ga0157370_115372481 110
233 3300013104 Ga0157370_12049128 Ga0157370_120491281 110
234 3300013105 Ga0157369_10031565 Ga0157369_100315654 110
235 3300013105 Ga0157369_10839832 Ga0157369_108398322 110
236 3300013296 Ga0157374_11626225 Ga0157374_116262252 110
237 3300013306 Ga0163162_10014475 Ga0163162_100144758 110
238 3300013306 Ga0163162_10167894 Ga0163162_101678942 110
239 3300013306 Ga0163162_10197192 Ga0163162_101971923 110
240 3300013307 Ga0157372_10146911 Ga0157372_101469114 110
241 3300013307 Ga0157372_10218382 Ga0157372_102183823 110
242 3300013307 Ga0157372_10277271 Ga0157372_102772712 110
243 3300013307 Ga0157372_10984604 Ga0157372_109846041 110
244 3300013307 Ga0157372_12154564 Ga0157372_121545642 110
245 3300014326 Ga0157380_12381425 Ga0157380_123814251 110
246 3300025298 Ga0209050_1001431 Ga0209050_10014318 110
247 3300025315 Ga0207697_10023094 Ga0207697_100230943 110
248 3300025711 Ga0207696_1002800 Ga0207696_10028008 110
249 3300025903 Ga0207680_10381077 Ga0207680_103810772 110
250 3300025903 Ga0207680_10422650 Ga0207680_104226502 110
251 3300025904 Ga0207647_10166053 Ga0207647_101660532 110
252 3300025904 Ga0207647_10724915 Ga0207647_107249151 110
253 3300025909 Ga0207705_10000004 Ga0207705_1000000494 110
254 3300025909 Ga0207705_10013543 Ga0207705_100135434 110
255 3300025909 Ga0207705_10160089 Ga0207705_101600892 110
256 3300025909 Ga0207705_10247778 Ga0207705_102477782 110
257 3300025909 Ga0207705_10252728 Ga0207705_102527282 110
258 3300025909 Ga0207705_10544885 Ga0207705_105448852 110
259 3300025912 Ga0207707_11054439 Ga0207707_110544392 110
260 3300025913 Ga0207695_10007818 Ga0207695_1000781811 110
261 3300025914 Ga0207671_11379547 Ga0207671_113795471 110
262 3300025917 Ga0207660_10081512 Ga0207660_100815123 110
263 3300025919 Ga0207657_10001019 Ga0207657_1000101918 110
264 3300025920 Ga0207649_10011737 Ga0207649_100117374 110
265 3300025920 Ga0207649_10258227 Ga0207649_102582272 110
266 3300025920 Ga0207649_10770472 Ga0207649_107704721 110
267 3300025921 Ga0207652_10003055 Ga0207652_100030555 110
268 3300025921 Ga0207652_10037112 Ga0207652_100371122 110
269 3300025921 Ga0207652_10238908 Ga0207652_102389082 110
270 3300025921 Ga0207652_10386966 Ga0207652_103869662 110
271 3300025921 Ga0207652_10524322 Ga0207652_105243221 110
272 3300025923 Ga0207681_10002566 Ga0207681_100025665 110
273 3300025923 Ga0207681_10006548 Ga0207681_100065485 110
274 3300025923 Ga0207681_11111162 Ga0207681_111111622 110
275 3300025924 Ga0207694_10137682 Ga0207694_101376823 110
276 3300025925 Ga0207650_10147954 Ga0207650_101479542 110
277 3300025926 Ga0207659_10385227 Ga0207659_103852272 110
278 3300025929 Ga0207664_10704950 Ga0207664_107049502 110
279 3300025931 Ga0207644_10000087 Ga0207644_1000008738 110
280 3300025931 Ga0207644_10003273 Ga0207644_1000327312 110
281 3300025931 Ga0207644_10021473 Ga0207644_100214733 110
282 3300025931 Ga0207644_10503965 Ga0207644_105039652 110
283 3300025931 Ga0207644_11078784 Ga0207644_110787842 110
284 3300025932 Ga0207690_10008564 Ga0207690_100085642 110
285 3300025932 Ga0207690_10504006 Ga0207690_105040062 110
286 3300025933 Ga0207706_10003993 Ga0207706_100039933 110
287 3300025933 Ga0207706_10308999 Ga0207706_103089992 110
288 3300025941 Ga0207711_10051707 Ga0207711_100517073 110
289 3300025941 Ga0207711_10127685 Ga0207711_101276851 110
290 3300025941 Ga0207711_10546457 Ga0207711_105464572 110
291 3300025941 Ga0207711_10727738 Ga0207711_107277382 110
292 3300025941 Ga0207711_10766123 Ga0207711_107661231 110
293 3300025944 Ga0207661_10180176 Ga0207661_101801762 110
294 3300025944 Ga0207661_11962162 Ga0207661_119621622 110
295 3300025945 Ga0207679_10053825 Ga0207679_100538253 110
296 3300025945 Ga0207679_10061000 Ga0207679_100610003 110
297 3300025949 Ga0207667_10005918 Ga0207667_1000591817 110
298 3300025949 Ga0207667_10017546 Ga0207667_100175467 110
299 3300025949 Ga0207667_10044625 Ga0207667_100446255 110
300 3300025949 Ga0207667_10056281 Ga0207667_100562811 110
301 3300025949 Ga0207667_10351442 Ga0207667_103514422 110
302 3300025949 Ga0207667_10403406 Ga0207667_104034062 110
303 3300025949 Ga0207667_10422971 Ga0207667_104229711 110
304 3300025972 Ga0207668_10016806 Ga0207668_100168062 110
305 3300025972 Ga0207668_10037776 Ga0207668_100377763 110
306 3300025972 Ga0207668_10101665 Ga0207668_101016652 110
307 3300025972 Ga0207668_10552993 Ga0207668_105529932 110
308 3300025981 Ga0207640_10000601 Ga0207640_100006017 110
309 3300025981 Ga0207640_10011203 Ga0207640_100112032 110
310 3300025981 Ga0207640_10045815 Ga0207640_100458152 110
311 3300025981 Ga0207640_10285345 Ga0207640_102853452 110
312 3300025986 Ga0207658_10001020 Ga0207658_1000102023 110
313 3300025986 Ga0207658_10004335 Ga0207658_100043353 110
314 3300025986 Ga0207658_10016803 Ga0207658_100168034 110
315 3300025986 Ga0207658_10136685 Ga0207658_101366853 110
316 3300025986 Ga0207658_10176195 Ga0207658_101761952 110
317 3300026035 Ga0207703_10005483 Ga0207703_100054835 110
318 3300026035 Ga0207703_10006539 Ga0207703_100065395 110
319 3300026035 Ga0207703_10069601 Ga0207703_100696012 110
320 3300026035 Ga0207703_10233091 Ga0207703_102330912 110
321 3300026041 Ga0207639_10029260 Ga0207639_100292604 110
322 3300026041 Ga0207639_10074689 Ga0207639_100746892 110
323 3300026041 Ga0207639_10335995 Ga0207639_103359952 110
324 3300026067 Ga0207678_10153702 Ga0207678_101537022 110
325 3300026067 Ga0207678_10953663 Ga0207678_109536632 110
326 3300026078 Ga0207702_10003311 Ga0207702_1000331112 110
327 3300026078 Ga0207702_10052951 Ga0207702_100529512 110
328 3300026088 Ga0207641_10000081 Ga0207641_1000008174 110
329 3300026088 Ga0207641_10048636 Ga0207641_100486363 110
330 3300026088 Ga0207641_10075846 Ga0207641_100758462 110
331 3300026095 Ga0207676_10016348 Ga0207676_100163483 110
332 3300026095 Ga0207676_10374769 Ga0207676_103747691 110
333 3300026095 Ga0207676_10562782 Ga0207676_105627822 110
334 3300026116 Ga0207674_10043371 Ga0207674_100433712 110
335 3300026116 Ga0207674_10090330 Ga0207674_100903302 110
336 3300026116 Ga0207674_10174678 Ga0207674_101746783 110
337 3300026116 Ga0207674_10385007 Ga0207674_103850072 110
338 3300026116 Ga0207674_10455305 Ga0207674_104553052 110
339 3300026142 Ga0207698_10000459 Ga0207698_1000045924 110
340 3300026142 Ga0207698_10051714 Ga0207698_100517143 110
341 3300026142 Ga0207698_10085474 Ga0207698_100854742 110
342 3300026142 Ga0207698_10128022 Ga0207698_101280222 110
343 3300026142 Ga0207698_10223869 Ga0207698_102238692 110
344 3300026142 Ga0207698_10533081 Ga0207698_105330812 110
345 3300026142 Ga0207698_10726917 Ga0207698_107269172 110
346 3300026142 Ga0207698_11760381 Ga0207698_117603812 110
347 3300027111 Ga0209281_1010906 Ga0209281_10109062 110
348 3300027111 Ga0209281_1033098 Ga0209281_10330982 110
349 3300027876 Ga0209974_10007859 Ga0209974_100078594 110
350 3300027876 Ga0209974_10022724 Ga0209974_100227242 110
351 3300027907 Ga0207428_10080863 Ga0207428_100808632 110
352 3300028379 Ga0268266_10008187 Ga0268266_100081878 110
353 3300028379 Ga0268266_10844423 Ga0268266_108444232 110
354 3300028379 Ga0268266_10873220 Ga0268266_108732202 110
355 3300028380 Ga0268265_10089395 Ga0268265_100893953 110
356 3300028380 Ga0268265_10430316 Ga0268265_104303162 110
357 3300028381 Ga0268264_10000018 Ga0268264_10000018239 110
358 3300028381 Ga0268264_11006057 Ga0268264_110060572 110
359 3300031250 Ga0265331_10022653 Ga0265331_100226534 110
360 3300031251 Ga0265327_10349454 Ga0265327_103494541 110
361 3300031616 Ga0307508_10028060 Ga0307508_100280602 110
362 3300031731 Ga0307405_10020044 Ga0307405_100200444 110
363 3300031731 Ga0307405_10915136 Ga0307405_109151362 110
364 3300031824 Ga0307413_10636587 Ga0307413_106365872 110
365 3300031824 Ga0307413_11660536 Ga0307413_116605361 110
366 3300031824 Ga0307413_11714780 Ga0307413_117147802 110
367 3300031824 Ga0307413_12160986 Ga0307413_121609861 110
368 3300031903 Ga0307407_10209976 Ga0307407_102099762 110
369 3300031911 Ga0307412_10013998 Ga0307412_100139981 110
370 3300031995 Ga0307409_100186857 Ga0307409_1001868572 110
371 3300031995 Ga0307409_101468269 Ga0307409_1014682691 110
372 3300031995 Ga0307409_101988086 Ga0307409_1019880862 110
373 3300031995 Ga0307409_102415654 Ga0307409_1024156542 110
374 3300032002 Ga0307416_101329263 Ga0307416_1013292632 110
375 3300032004 Ga0307414_10597986 Ga0307414_105979862 110
376 3300032004 Ga0307414_11179300 Ga0307414_111793002 110
377 3300032005 Ga0307411_10061273 Ga0307411_100612732 110
378 3300032126 Ga0307415_100131927 Ga0307415_1001319272 110
379 3300035112 Ga0373932_0250651 Ga0373932_0250651_128_505 110
380 3300035114 Ga0373939_0309411 Ga0373939_0309411_188_565 110
381 3300035398 Ga0316574_0652228 Ga0316574_0652228_127_459 110
382 3300035692 Ga0373935_0468988 Ga0373935_0468988_39_371 110
383 3300036712 Ga0316584_0159681 Ga0316584_0159681_574_906 110
384 3300046453 Ga0495627_000217 Ga0495627_000217_36139_36471 110
385 3300046471 Ga0495650_0000559 Ga0495650_0000559_38199_38531 110
386 3300046475 Ga0495639_0363466 Ga0495639_0363466_60_392 110
387 3300046500 Ga0495596_0000233 Ga0495596_0000233_17712_18050 110
388 3300046500 Ga0495596_0007814 Ga0495596_0007814_3766_4098 110
389 3300046501 Ga0495607_0025544 Ga0495607_0025544_2267_2605 110
390 3300046506 Ga0495583_0168886 Ga0495583_0168886_449_787 110
391 3300046507 Ga0495606_0029863 Ga0495606_0029863_2278_2616 110
392 3300046512 Ga0495610_0000030 Ga0495610_0000030_131529_131861 110
393 3300046512 Ga0495610_0000743 Ga0495610_0000743_28037_28417 110
394 3300046515 Ga0495620_0023302 Ga0495620_0023302_2001_2333 110
395 3300046519 Ga0495632_0005692 Ga0495632_0005692_877_1209 110
396 3300046519 Ga0495632_0061761 Ga0495632_0061761_769_1107 110
397 3300046522 Ga0495643_0000110 Ga0495643_0000110_86591_86971 110
398 3300046522 Ga0495643_0010124 Ga0495643_0010124_3516_3854 110
399 3300046522 Ga0495643_0016156 Ga0495643_0016156_1037_1369 110
400 3300046522 Ga0495643_0026681 Ga0495643_0026681_338_676 110
401 3300046525 Ga0495663_0321605 Ga0495663_0321605_207_539 110
402 3300046530 Ga0495654_0275725 Ga0495654_0275725_333_665 110
403 3300046536 Ga0495587_0439863 Ga0495587_0439863_344_676 110
404 3300046616 Ga0495668_0072941 Ga0495668_0072941_466_798 110
405 3300046616 Ga0495668_0073421 Ga0495668_0073421_541_879 110
406 3300046616 Ga0495668_0402879 Ga0495668_0402879_27_359 110
407 3300046660 Ga0495625_0008300 Ga0495625_0008300_7437_7775 110
408 3300046665 Ga0495661_0093611 Ga0495661_0093611_888_1226 110
409 3300047470 Ga0495681_0000011 Ga0495681_0000011_133184_133516 110
410 3300047472 Ga0495686_0249834 Ga0495686_0249834_338_676 110
411 3300048090 Ga0495615_0000025 Ga0495615_0000025_20341_20673 110
412 3300048903 Ga0496100_0005027 Ga0496100_0005027_6064_6396 110
413 3300048903 Ga0496100_0053361 Ga0496100_0053361_2047_2379 110
414 3300048904 Ga0496101_0052143 Ga0496101_0052143_1862_2194 110
415 3300048904 Ga0496101_0071618 Ga0496101_0071618_519_851 110
416 3300048904 Ga0496101_0437837 Ga0496101_0437837_98_430 110
417 3300048904 Ga0496101_0523329 Ga0496101_0523329_497_829 110
418 3300048905 Ga0496102_0000998 Ga0496102_0000998_16874_17206 110
419 3300048905 Ga0496102_0053745 Ga0496102_0053745_3056_3388 110
420 3300048905 Ga0496102_0848525 Ga0496102_0848525_250_582 110
421 3300048905 Ga0496102_1942457 Ga0496102_1942457_134_466 110
422 3300048906 Ga0496103_0000201 Ga0496103_0000201_16743_17075 110
423 3300048906 Ga0496103_0019567 Ga0496103_0019567_108_446 110
424 3300048906 Ga0496103_0292193 Ga0496103_0292193_482_814 110
425 3300048907 Ga0496104_0000078 Ga0496104_0000078_60380_60712 110
426 3300048907 Ga0496104_0219714 Ga0496104_0219714_482_814 110
427 3300048908 Ga0496105_0004202 Ga0496105_0004202_7032_7364 110
428 3300048908 Ga0496105_0059223 Ga0496105_0059223_1327_1659 110
429 3300048908 Ga0496105_0563877 Ga0496105_0563877_270_602 110
430 3300048908 Ga0496105_0611034 Ga0496105_0611034_400_732 110
431 3300048909 Ga0496106_0002700 Ga0496106_0002700_12041_12373 110
432 3300048909 Ga0496106_0613235 Ga0496106_0613235_314_646 110
433 3300048910 Ga0496107_0006277 Ga0496107_0006277_860_1192 110
434 3300048911 Ga0496108_0211764 Ga0496108_0211764_1015_1347 110
435 3300048911 Ga0496108_0261278 Ga0496108_0261278_422_754 110
436 3300048912 Ga0496109_0008938 Ga0496109_0008938_6437_6769 110
437 3300048912 Ga0496109_0034178 Ga0496109_0034178_952_1284 110
438 3300048913 Ga0496110_0050983 Ga0496110_0050983_1830_2162 110
439 3300048913 Ga0496110_0111736 Ga0496110_0111736_933_1265 110
440 3300048914 Ga0496111_0023891 Ga0496111_0023891_1053_1385 110
441 3300048915 Ga0496112_0172573 Ga0496112_0172573_24_356 110
442 3300048915 Ga0496112_1046145 Ga0496112_1046145_193_525 110
443 3300048916 Ga0496113_0003327 Ga0496113_0003327_9013_9345 110
444 3300048916 Ga0496113_0005353 Ga0496113_0005353_4056_4388 110
445 3300048917 Ga0496114_0046711 Ga0496114_0046711_565_897 110
446 3300048917 Ga0496114_0304975 Ga0496114_0304975_448_780 110
447 3300048919 Ga0496116_0000028 Ga0496116_0000028_99791_100123 110
448 3300048919 Ga0496116_0074998 Ga0496116_0074998_1411_1749 110
449 3300048919 Ga0496116_0127484 Ga0496116_0127484_36_368 110
450 3300048919 Ga0496116_0160607 Ga0496116_0160607_866_1198 110
451 3300048920 Ga0496117_0098938 Ga0496117_0098938_637_969 110
452 3300048920 Ga0496117_0265331 Ga0496117_0265331_292_624 110
453 3300048921 Ga0496118_0044905 Ga0496118_0044905_1694_2026 110
454 3300048921 Ga0496118_0087280 Ga0496118_0087280_1360_1698 110
455 3300048921 Ga0496118_0150407 Ga0496118_0150407_1091_1423 110
456 3300048921 Ga0496118_0436684 Ga0496118_0436684_256_594 110
457 3300048922 Ga0496119_0000114 Ga0496119_0000114_60380_60712 110
458 3300048922 Ga0496119_0391750 Ga0496119_0391750_95_433 110
459 3300048923 Ga0496120_0000266 Ga0496120_0000266_38781_39113 110
460 3300048923 Ga0496120_0106705 Ga0496120_0106705_838_1176 110
461 3300048923 Ga0496120_0310592 Ga0496120_0310592_349_681 110
462 3300048924 Ga0496121_0000021 Ga0496121_0000021_380525_380869 110
463 3300048924 Ga0496121_0000520 Ga0496121_0000520_54937_55269 110
464 3300048924 Ga0496121_0002014 Ga0496121_0002014_27089_27427 110
465 3300048924 Ga0496121_0010367 Ga0496121_0010367_6166_6498 110
466 3300048924 Ga0496121_0041974 Ga0496121_0041974_711_1043 110
467 3300048925 Ga0496122_0008602 Ga0496122_0008602_7031_7363 110
468 3300048925 Ga0496122_0012616 Ga0496122_0012616_2473_2805 110
469 3300048925 Ga0496122_0042142 Ga0496122_0042142_785_1117 110
470 3300048925 Ga0496122_0102140 Ga0496122_0102140_197_535 110
471 3300048925 Ga0496122_0284079 Ga0496122_0284079_560_892 110
472 3300048925 Ga0496122_0329468 Ga0496122_0329468_408_740 110
473 3300048925 Ga0496122_0578838 Ga0496122_0578838_108_440 110
474 3300048926 Ga0496123_0001658 Ga0496123_0001658_29047_29379 110
475 3300048926 Ga0496123_0001678 Ga0496123_0001678_22037_22369 110
476 3300048926 Ga0496123_0100614 Ga0496123_0100614_577_915 110
477 3300048926 Ga0496123_0147097 Ga0496123_0147097_161_493 110
478 3300048926 Ga0496123_0192765 Ga0496123_0192765_161_493 110
479 3300048927 Ga0496124_0003121 Ga0496124_0003121_8857_9189 110
480 3300048927 Ga0496124_0003580 Ga0496124_0003580_15283_15615 110
481 3300048927 Ga0496124_0004225 Ga0496124_0004225_11749_12081 110
482 3300048927 Ga0496124_0040943 Ga0496124_0040943_771_1109 110
483 3300048927 Ga0496124_0059973 Ga0496124_0059973_1021_1353 110
484 3300048927 Ga0496124_0213779 Ga0496124_0213779_636_968 110
485 3300048928 Ga0496125_0013528 Ga0496125_0013528_1218_1556 110
486 3300048928 Ga0496125_0022629 Ga0496125_0022629_4390_4722 110
487 3300048928 Ga0496125_0031114 Ga0496125_0031114_2851_3183 110
488 3300048928 Ga0496125_0081513 Ga0496125_0081513_560_892 110
489 3300048928 Ga0496125_0413899 Ga0496125_0413899_78_410 110
490 3300048929 Ga0496126_0000079 Ga0496126_0000079_142696_143028 110
491 3300048929 Ga0496126_0000173 Ga0496126_0000173_78689_79021 110
492 3300048929 Ga0496126_0005189 Ga0496126_0005189_14535_14867 110
493 3300048929 Ga0496126_0094396 Ga0496126_0094396_136_474 110
494 3300049460 Ga0495682_0295026 Ga0495682_0295026_136_516 110
495 3300049568 Ga0501031_0301097 Ga0501031_0301097_452_784 110
496 3300049570 Ga0501033_0330928 Ga0501033_0330928_179_511 110
497 3300049570 Ga0501033_0650644 Ga0501033_0650644_185_517 110
498 3300049571 Ga0501034_0597955 Ga0501034_0597955_320_652 110
499 3300049572 Ga0501036_1476949 Ga0501036_1476949_151_483 110
500 3300049581 Ga0501047_0388150 Ga0501047_0388150_457_795 110
501 3300049822 Ga0501035_0750341 Ga0501035_0750341_258_590 110
502 3300049823 Ga0501044_0001951 Ga0501044_0001951_4534_4872 110
503 3300049823 Ga0501044_0591689 Ga0501044_0591689_41_373 110
504 3300049823 Ga0501044_1427294 Ga0501044_1427294_135_470 110
505 3300050489 nmdc:mga03683_209906_c1 nmdc:mga03683_209906_c1_86_418 110
506 3300050489 nmdc:mga03683_906_c1 nmdc:mga03683_906_c1_609_941 110
507 3300050490 nmdc:mga03n38_291_c1 nmdc:mga03n38_291_c1_11062_11439 110
508 3300050491 nmdc:mga00v17_178182_c1 nmdc:mga00v17_178182_c1_267_644 110
509 3300050491 nmdc:mga00v17_18971_c1 nmdc:mga00v17_18971_c1_3274_3606 110
510 3300050493 nmdc:mga0k408_7997_c1 nmdc:mga0k408_7997_c1_2705_3037 110
511 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_37500_37877 110
512 3300050496 nmdc:mga07m45_2156_c1 nmdc:mga07m45_2156_c1_3148_3528 110
513 3300050496 nmdc:mga07m45_64983_c1 nmdc:mga07m45_64983_c1_1428_1760 110
514 3300050496 nmdc:mga07m45_82669_c1 nmdc:mga07m45_82669_c1_67_447 110
515 3300050496 nmdc:mga07m45_83984_c1 nmdc:mga07m45_83984_c1_316_648 110
516 3300050513 nmdc:mga0rr50_399162_c1 nmdc:mga0rr50_399162_c1_98_475 110
517 3300050516 nmdc:mga0sz30_256747_c1 nmdc:mga0sz30_256747_c1_284_622 110
518 3300050516 nmdc:mga0sz30_56372_c1 nmdc:mga0sz30_56372_c1_461_793 110
519 3300053087 Ga0500643_000001 Ga0500643_000001_748733_749068 110
520 3300053087 Ga0500643_109956 Ga0500643_109956_220_555 110
521 3300053094 Ga0500566_0159358 Ga0500566_0159358_419_751 110
522 3300053108 Ga0500562_188695 Ga0500562_188695_150_530 110
523 3300053111 Ga0500572_297339 Ga0500572_297339_150_482 110
524 3300053119 Ga0500595_018192 Ga0500595_018192_377_757 110
525 3300053121 Ga0500607_000354 Ga0500607_000354_14709_15089 110
526 3300053121 Ga0500607_004167 Ga0500607_004167_2696_3034 110
527 3300053122 Ga0500608_000156 Ga0500608_000156_16191_16523 110
528 3300053123 Ga0500614_088638 Ga0500614_088638_80_412 110
529 3300053136 Ga0500559_0001842 Ga0500559_0001842_1877_2209 110
530 3300053136 Ga0500559_0012360 Ga0500559_0012360_3002_3334 110
531 3300053138 Ga0500564_059241 Ga0500564_059241_603_935 110
532 3300053139 Ga0500568_0248485 Ga0500568_0248485_184_564 110
533 3300053148 Ga0500590_224027 Ga0500590_224027_218_598 110
534 3300053151 Ga0500604_0155323 Ga0500604_0155323_257_592 110
535 3300053156 Ga0500622_0000145 Ga0500622_0000145_53423_53755 110
536 3300053178 Ga0500637_0027500 Ga0500637_0027500_918_1298 110
537 3300053723 Ga0500567_004902 Ga0500567_004902_174_506 110
538 3300053729 Ga0500625_000021 Ga0500625_000021_63083_63415 110
539 3300053729 Ga0500625_258391 Ga0500625_258391_97_477 110
540 3300053730 Ga0500645_005657 Ga0500645_005657_2928_3308 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

23

106

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9229 1 105
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9208 3 103
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.9188 1 101
3lb8-assembly1.cif.gz_C crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex 0.9176 3 101
1uwm-assembly1.cif.gz_A reduced ferredoxin 6 from rhodobacter capsulatus 0.9168 2 101
ID Description Score Start End Superfamily
af_F4I8U3_74_163_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.934 2 17 2.40.330.10
af_Q9UBI4_290_397_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.9261 2 16 3.30.1050.10
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9223 2 107 3.10.20.30
af_Q9SGR4_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9212 3 15 3.10.20.90
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9208 3 103 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1W7MGD4-F1-model_v4 Ferredoxin, 2Fe-2S 0.9519 1 108 GO:0009055
GO:0051537
GO:0140647
AF-A0A7T8AC12-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9515 1 109 GO:0009055
GO:0051537
GO:0140647
AF-A0A2A2SKV2-F1-model_v4 2Fe-2S ferredoxin 0.9511 1 101 GO:0009055
GO:0051537
GO:0140647
AF-A0A0Q4EDQ0-F1-model_v4 2Fe-2S ferredoxin 0.9492 2 101 GO:0009055
GO:0051537
GO:0140647
AF-A0A844XS28-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9485 2 108 GO:0009055
GO:0051537
GO:0140647

Feature Viewer

pLDDT pTM Quality
86.02 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map