F461201
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 540 | 231 | 527 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10190159|Ga0070658_101901592 |
| Length | 126 |
| Sequence | LPRRPTRSSNAFGERAMVSVSFTTDDGQKVRRDAPVGARLLEVGQAAGLPLEGTCEGQMACSTCHVIVAAEWFDRLVPASEEEEDMLDLAAGVARTSRLSCQIVLSDELDGIEVHVPGEARDMQRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 4 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 5 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 6 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 7 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 8 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 9 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 10 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 11 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 12 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 13 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 124 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 144 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 182 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 186 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 187 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 188 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 189 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 192 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 196 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 206 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 207 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 208 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 209 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 212 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 213 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 214 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 215 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 216 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 217 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 218 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 219 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 220 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 222 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 224 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 225 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 226 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 227 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 228 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 229 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 231 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0 |
| Isolates | 2.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.74 |
| Nodule | 1.11 |
| Rhizoplane | 6.67 |
| Rhizosphere | 70.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1044026 | 2162886007 | Bacteria | 2083 |
| 2 | SwRhRL2b_contig_196785 | 2162886007 | Bacteria | 1407 |
| 3 | SwRhRL2b_contig_878851 | 2162886007 | Bacteria | 43540 |
| 4 | JGI24748J21848_1001818 | 3300002074 | Bacteria | 2366 |
| 5 | JGI24034J26672_10069818 | 3300002239 | Bacteria | 628 |
| 6 | JGI24751J29686_10000080 | 3300002459 | Bacteria | 54264 |
| 7 | Ga0055530_10007261 | 3300003791 | Bacteria | 4708 |
| 8 | Ga0065704_10070424 | 3300005289 | Bacteria | 25504 |
| 9 | Ga0065704_10099696 | 3300005289 | Bacteria | 2297 |
| 10 | Ga0065704_10791785 | 3300005289 | Bacteria | 528 |
| 11 | Ga0065707_10163979 | 3300005295 | Bacteria | 1539 |
| 12 | Ga0070658_10000371 | 3300005327 | Bacteria | 39178 |
| 13 | Ga0070658_10008372 | 3300005327 | Bacteria | 8314 |
| 14 | Ga0070658_10190159 | 3300005327 | Bacteria | 1730 |
| 15 | Ga0070658_10421638 | 3300005327 | Bacteria | 1148 |
| 16 | Ga0070683_100094068 | 3300005329 | Bacteria | 2816 |
| 17 | Ga0070683_100120426 | 3300005329 | Bacteria | 2479 |
| 18 | Ga0070683_101700807 | 3300005329 | Bacteria | 607 |
| 19 | Ga0070690_100066155 | 3300005330 | Bacteria | 2339 |
| 20 | Ga0070670_100092329 | 3300005331 | Bacteria | 2603 |
| 21 | Ga0070670_100177418 | 3300005331 | Bacteria | 1849 |
| 22 | Ga0070666_10084446 | 3300005335 | Bacteria | 2173 |
| 23 | Ga0070666_10442376 | 3300005335 | Bacteria | 938 |
| 24 | Ga0070680_100005540 | 3300005336 | Bacteria | 9555 |
| 25 | Ga0070660_100209166 | 3300005339 | Bacteria | 1583 |
| 26 | Ga0070660_100867063 | 3300005339 | Bacteria | 761 |
| 27 | Ga0070661_100002979 | 3300005344 | Bacteria | 11671 |
| 28 | Ga0070668_100002062 | 3300005347 | Bacteria | 14707 |
| 29 | Ga0070668_100013390 | 3300005347 | Bacteria | 6121 |
| 30 | Ga0070668_100018387 | 3300005347 | Bacteria | 5247 |
| 31 | Ga0070668_100086994 | 3300005347 | Bacteria | 2459 |
| 32 | Ga0070669_100002274 | 3300005353 | Bacteria | 13933 |
| 33 | Ga0070669_100008686 | 3300005353 | Bacteria | 7247 |
| 34 | Ga0070669_100008689 | 3300005353 | Bacteria | 7246 |
| 35 | Ga0070669_101368264 | 3300005353 | Bacteria | 614 |
| 36 | Ga0070671_100000066 | 3300005355 | Bacteria | 70998 |
| 37 | Ga0070671_100000818 | 3300005355 | Bacteria | 22580 |
| 38 | Ga0070671_100012590 | 3300005355 | Bacteria | 6814 |
| 39 | Ga0070671_100031501 | 3300005355 | Bacteria | 4381 |
| 40 | Ga0070671_100797815 | 3300005355 | Bacteria | 822 |
| 41 | Ga0070671_101330014 | 3300005355 | Bacteria | 634 |
| 42 | Ga0070659_100049705 | 3300005366 | Bacteria | 3298 |
| 43 | Ga0070659_100054618 | 3300005366 | Bacteria | 3146 |
| 44 | Ga0070659_101168960 | 3300005366 | Bacteria | 680 |
| 45 | Ga0070667_100000998 | 3300005367 | Bacteria | 25961 |
| 46 | Ga0070667_100001602 | 3300005367 | Bacteria | 20248 |
| 47 | Ga0070667_100007905 | 3300005367 | Bacteria | 8823 |
| 48 | Ga0070667_100011501 | 3300005367 | Bacteria | 7319 |
| 49 | Ga0070667_100058832 | 3300005367 | Bacteria | 3250 |
| 50 | Ga0070663_100101057 | 3300005455 | Bacteria | 2152 |
| 51 | Ga0070663_101054260 | 3300005455 | Bacteria | 709 |
| 52 | Ga0070662_100001119 | 3300005457 | Bacteria | 16375 |
| 53 | Ga0070662_100118583 | 3300005457 | Bacteria | 2026 |
| 54 | Ga0070681_10002647 | 3300005458 | Bacteria | 16442 |
| 55 | Ga0070681_11770234 | 3300005458 | Bacteria | 545 |
| 56 | Ga0070707_101047625 | 3300005468 | Bacteria | 781 |
| 57 | Ga0070679_100002687 | 3300005530 | Bacteria | 16196 |
| 58 | Ga0070679_100132426 | 3300005530 | Bacteria | 2474 |
| 59 | Ga0070679_100173227 | 3300005530 | Bacteria | 2130 |
| 60 | Ga0070679_100527508 | 3300005530 | Bacteria | 1125 |
| 61 | Ga0070679_100655079 | 3300005530 | Bacteria | 993 |
| 62 | Ga0070679_101934650 | 3300005530 | Bacteria | 538 |
| 63 | Ga0070684_100189909 | 3300005535 | Bacteria | 1869 |
| 64 | Ga0070684_100478349 | 3300005535 | Bacteria | 1153 |
| 65 | Ga0068853_100047946 | 3300005539 | Bacteria | 3667 |
| 66 | Ga0068853_100949023 | 3300005539 | Bacteria | 827 |
| 67 | Ga0068853_101025056 | 3300005539 | Bacteria | 795 |
| 68 | Ga0070686_100150652 | 3300005544 | Bacteria | 1629 |
| 69 | Ga0070693_100289961 | 3300005547 | Bacteria | 1099 |
| 70 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 71 | Ga0070665_100003786 | 3300005548 | Bacteria | 16009 |
| 72 | Ga0070665_100022366 | 3300005548 | Bacteria | 6363 |
| 73 | Ga0070665_100120521 | 3300005548 | Bacteria | 2625 |
| 74 | Ga0070665_100395975 | 3300005548 | Bacteria | 1389 |
| 75 | Ga0070665_100532855 | 3300005548 | Bacteria | 1186 |
| 76 | Ga0070665_100744214 | 3300005548 | Bacteria | 993 |
| 77 | Ga0068855_100014772 | 3300005563 | Bacteria | 9406 |
| 78 | Ga0068855_100019897 | 3300005563 | Bacteria | 8061 |
| 79 | Ga0068855_100034858 | 3300005563 | Bacteria | 5997 |
| 80 | Ga0068855_100058595 | 3300005563 | Bacteria | 4509 |
| 81 | Ga0068855_100859043 | 3300005563 | Bacteria | 961 |
| 82 | Ga0070664_100011134 | 3300005564 | Bacteria | 7294 |
| 83 | Ga0070664_100167840 | 3300005564 | Bacteria | 1945 |
| 84 | Ga0070664_100816556 | 3300005564 | Bacteria | 872 |
| 85 | Ga0070664_101277729 | 3300005564 | Bacteria | 693 |
| 86 | Ga0068857_100026635 | 3300005577 | Bacteria | 5096 |
| 87 | Ga0068857_100406941 | 3300005577 | Bacteria | 1267 |
| 88 | Ga0068857_100453743 | 3300005577 | Bacteria | 1199 |
| 89 | Ga0068857_100909489 | 3300005577 | Bacteria | 844 |
| 90 | Ga0068857_101303113 | 3300005577 | Bacteria | 705 |
| 91 | Ga0068854_100014393 | 3300005578 | Bacteria | 5215 |
| 92 | Ga0068854_100026074 | 3300005578 | Bacteria | 4014 |
| 93 | Ga0068854_100311268 | 3300005578 | Bacteria | 1277 |
| 94 | Ga0068854_100808194 | 3300005578 | Bacteria | 818 |
| 95 | Ga0068854_102221752 | 3300005578 | Bacteria | 508 |
| 96 | Ga0068856_100010899 | 3300005614 | Bacteria | 8824 |
| 97 | Ga0068856_100034245 | 3300005614 | Bacteria | 4975 |
| 98 | Ga0068852_100000758 | 3300005616 | Bacteria | 21259 |
| 99 | Ga0068852_100051241 | 3300005616 | Bacteria | 3542 |
| 100 | Ga0068852_100105092 | 3300005616 | Bacteria | 2557 |
| 101 | Ga0068852_100105713 | 3300005616 | Bacteria | 2551 |
| 102 | Ga0068852_100256336 | 3300005616 | Bacteria | 1678 |
| 103 | Ga0068852_100416092 | 3300005616 | Bacteria | 1325 |
| 104 | Ga0068852_100818601 | 3300005616 | Bacteria | 946 |
| 105 | Ga0068852_101558697 | 3300005616 | Bacteria | 683 |
| 106 | Ga0068859_100037781 | 3300005617 | Bacteria | 4845 |
| 107 | Ga0068859_100132339 | 3300005617 | Bacteria | 2566 |
| 108 | Ga0068859_101229877 | 3300005617 | Bacteria | 825 |
| 109 | Ga0068864_100008944 | 3300005618 | Bacteria | 8255 |
| 110 | Ga0068864_100045762 | 3300005618 | Bacteria | 3754 |
| 111 | Ga0068864_100105839 | 3300005618 | Bacteria | 2501 |
| 112 | Ga0068851_10729550 | 3300005834 | Bacteria | 612 |
| 113 | Ga0068863_100000063 | 3300005841 | Bacteria | 118269 |
| 114 | Ga0068863_100008940 | 3300005841 | Bacteria | 9780 |
| 115 | Ga0068863_100060815 | 3300005841 | Bacteria | 3572 |
| 116 | Ga0068863_100309527 | 3300005841 | Bacteria | 1533 |
| 117 | Ga0068863_101963737 | 3300005841 | Bacteria | 595 |
| 118 | Ga0068858_100004469 | 3300005842 | Bacteria | 13713 |
| 119 | Ga0068858_100021273 | 3300005842 | Bacteria | 6059 |
| 120 | Ga0068858_100028113 | 3300005842 | Bacteria | 5225 |
| 121 | Ga0068858_100085584 | 3300005842 | Bacteria | 2933 |
| 122 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 123 | Ga0068860_100012277 | 3300005843 | Bacteria | 8442 |
| 124 | Ga0068860_100318836 | 3300005843 | Bacteria | 1525 |
| 125 | Ga0068862_100003802 | 3300005844 | Bacteria | 12860 |
| 126 | Ga0068862_100006131 | 3300005844 | Bacteria | 10007 |
| 127 | Ga0068862_100114139 | 3300005844 | Bacteria | 2374 |
| 128 | Ga0068862_100580905 | 3300005844 | Bacteria | 1073 |
| 129 | Ga0068862_100794163 | 3300005844 | Bacteria | 924 |
| 130 | Ga0075364_10003609 | 3300006051 | Bacteria | 8818 |
| 131 | Ga0075364_10061160 | 3300006051 | Bacteria | 2470 |
| 132 | Ga0075362_10000224 | 3300006177 | Bacteria | 15734 |
| 133 | Ga0075362_10001562 | 3300006177 | Bacteria | 7399 |
| 134 | Ga0075362_10626854 | 3300006177 | Bacteria | 557 |
| 135 | Ga0075367_10457094 | 3300006178 | Bacteria | 809 |
| 136 | Ga0075367_10745492 | 3300006178 | Bacteria | 623 |
| 137 | Ga0075369_10000603 | 3300006186 | Bacteria | 11416 |
| 138 | Ga0075369_10099578 | 3300006186 | Bacteria | 1303 |
| 139 | Ga0075366_10000165 | 3300006195 | Bacteria | 28155 |
| 140 | Ga0075366_10024496 | 3300006195 | Bacteria | 3520 |
| 141 | Ga0097621_101802140 | 3300006237 | Bacteria | 583 |
| 142 | Ga0075370_10000055 | 3300006353 | Bacteria | 33979 |
| 143 | Ga0075370_10109389 | 3300006353 | Bacteria | 1604 |
| 144 | Ga0075370_10114286 | 3300006353 | Bacteria | 1569 |
| 145 | Ga0075370_10395206 | 3300006353 | Bacteria | 829 |
| 146 | Ga0075370_10958928 | 3300006353 | Bacteria | 524 |
| 147 | Ga0068871_101491322 | 3300006358 | Bacteria | 639 |
| 148 | Ga0068865_101363913 | 3300006881 | Bacteria | 632 |
| 149 | Ga0097620_100037781 | 3300006931 | Bacteria | 4845 |
| 150 | Ga0097620_100132345 | 3300006931 | Bacteria | 2566 |
| 151 | Ga0097620_101230097 | 3300006931 | Bacteria | 825 |
| 152 | Ga0079104_1017488 | 3300006946 | Bacteria | 2060 |
| 153 | Ga0079104_1042513 | 3300006946 | Bacteria | 1052 |
| 154 | Ga0079104_1053935 | 3300006946 | Bacteria | 886 |
| 155 | Ga0079104_1063071 | 3300006946 | Bacteria | 794 |
| 156 | Ga0075435_100360923 | 3300007076 | Bacteria | 1246 |
| 157 | Ga0105251_10005734 | 3300009011 | Bacteria | 8055 |
| 158 | Ga0105250_10030137 | 3300009092 | Bacteria | 2181 |
| 159 | Ga0105240_11252464 | 3300009093 | Bacteria | 784 |
| 160 | Ga0105247_10435273 | 3300009101 | Bacteria | 942 |
| 161 | Ga0105247_10671701 | 3300009101 | Bacteria | 776 |
| 162 | Ga0105248_10062723 | 3300009177 | Bacteria | 4173 |
| 163 | Ga0105248_10116332 | 3300009177 | Bacteria | 3016 |
| 164 | Ga0105248_10119186 | 3300009177 | Bacteria | 2977 |
| 165 | Ga0105248_10158753 | 3300009177 | Bacteria | 2551 |
| 166 | Ga0105248_10253309 | 3300009177 | Bacteria | 1981 |
| 167 | Ga0105248_10254717 | 3300009177 | Bacteria | 1976 |
| 168 | Ga0105248_10537137 | 3300009177 | Bacteria | 1319 |
| 169 | Ga0105237_11308184 | 3300009545 | Bacteria | 731 |
| 170 | Ga0105238_10157731 | 3300009551 | Bacteria | 2244 |
| 171 | Ga0105238_10977955 | 3300009551 | Bacteria | 867 |
| 172 | Ga0105249_10193944 | 3300009553 | Bacteria | 1984 |
| 173 | Ga0105249_10378964 | 3300009553 | Bacteria | 1440 |
| 174 | Ga0105249_10922752 | 3300009553 | Bacteria | 941 |
| 175 | Ga0105239_10296219 | 3300010375 | Bacteria | 1822 |
| 176 | Ga0105239_10993643 | 3300010375 | Bacteria | 965 |
| 177 | Ga0105239_11809824 | 3300010375 | Bacteria | 708 |
| 178 | Ga0157373_10082545 | 3300013100 | Bacteria | 2265 |
| 179 | Ga0157373_10578562 | 3300013100 | Bacteria | 816 |
| 180 | Ga0157371_10002809 | 3300013102 | Bacteria | 16324 |
| 181 | Ga0157371_10036220 | 3300013102 | Bacteria | 3534 |
| 182 | Ga0157371_10153097 | 3300013102 | Bacteria | 1645 |
| 183 | Ga0157370_10010951 | 3300013104 | Bacteria | 9517 |
| 184 | Ga0157370_11537248 | 3300013104 | Bacteria | 598 |
| 185 | Ga0157370_12049128 | 3300013104 | Bacteria | 513 |
| 186 | Ga0157369_10031565 | 3300013105 | Bacteria | 5832 |
| 187 | Ga0157369_10839832 | 3300013105 | Bacteria | 943 |
| 188 | Ga0157374_11626225 | 3300013296 | Bacteria | 670 |
| 189 | Ga0163162_10014475 | 3300013306 | Bacteria | 7708 |
| 190 | Ga0163162_10167894 | 3300013306 | Bacteria | 2318 |
| 191 | Ga0163162_10197192 | 3300013306 | Bacteria | 2142 |
| 192 | Ga0157372_10146911 | 3300013307 | Bacteria | 2719 |
| 193 | Ga0157372_10218382 | 3300013307 | Bacteria | 2210 |
| 194 | Ga0157372_10277271 | 3300013307 | Bacteria | 1949 |
| 195 | Ga0157372_10984604 | 3300013307 | Bacteria | 977 |
| 196 | Ga0157372_12154564 | 3300013307 | Bacteria | 640 |
| 197 | Ga0157380_12381425 | 3300014326 | Bacteria | 594 |
| 198 | Ga0209050_1001431 | 3300025298 | Bacteria | 25715 |
| 199 | Ga0207697_10023094 | 3300025315 | Bacteria | 2547 |
| 200 | Ga0207697_10458502 | 3300025315 | Bacteria | 565 |
| 201 | Ga0207696_1002800 | 3300025711 | Bacteria | 8275 |
| 202 | Ga0207713_1001941 | 3300025735 | Bacteria | 15635 |
| 203 | Ga0207680_10381077 | 3300025903 | Bacteria | 994 |
| 204 | Ga0207680_10422650 | 3300025903 | Bacteria | 944 |
| 205 | Ga0207647_10166053 | 3300025904 | Bacteria | 1286 |
| 206 | Ga0207647_10724915 | 3300025904 | Bacteria | 540 |
| 207 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 208 | Ga0207705_10013543 | 3300025909 | Bacteria | 5886 |
| 209 | Ga0207705_10160089 | 3300025909 | Bacteria | 1691 |
| 210 | Ga0207705_10247778 | 3300025909 | Bacteria | 1358 |
| 211 | Ga0207705_10252728 | 3300025909 | Bacteria | 1344 |
| 212 | Ga0207705_10544885 | 3300025909 | Bacteria | 902 |
| 213 | Ga0207707_11054439 | 3300025912 | Bacteria | 665 |
| 214 | Ga0207695_10007818 | 3300025913 | Bacteria | 13529 |
| 215 | Ga0207671_11379547 | 3300025914 | Bacteria | 547 |
| 216 | Ga0207660_10081512 | 3300025917 | Bacteria | 2378 |
| 217 | Ga0207657_10001019 | 3300025919 | Bacteria | 29733 |
| 218 | Ga0207649_10011737 | 3300025920 | Bacteria | 4843 |
| 219 | Ga0207649_10258227 | 3300025920 | Bacteria | 1258 |
| 220 | Ga0207649_10770472 | 3300025920 | Bacteria | 750 |
| 221 | Ga0207652_10003055 | 3300025921 | Bacteria | 13969 |
| 222 | Ga0207652_10037112 | 3300025921 | Bacteria | 4124 |
| 223 | Ga0207652_10238908 | 3300025921 | Bacteria | 1637 |
| 224 | Ga0207652_10386966 | 3300025921 | Bacteria | 1262 |
| 225 | Ga0207652_10524322 | 3300025921 | Bacteria | 1066 |
| 226 | Ga0207681_10002566 | 3300025923 | Bacteria | 11526 |
| 227 | Ga0207681_10006548 | 3300025923 | Bacteria | 7146 |
| 228 | Ga0207681_10016888 | 3300025923 | Bacteria | 4576 |
| 229 | Ga0207681_10956275 | 3300025923 | Bacteria | 718 |
| 230 | Ga0207681_11111162 | 3300025923 | Bacteria | 664 |
| 231 | Ga0207694_10137682 | 3300025924 | Bacteria | 1962 |
| 232 | Ga0207650_10147954 | 3300025925 | Bacteria | 1851 |
| 233 | Ga0207650_10229638 | 3300025925 | Bacteria | 1496 |
| 234 | Ga0207659_10385227 | 3300025926 | Bacteria | 1170 |
| 235 | Ga0207664_10704950 | 3300025929 | Bacteria | 908 |
| 236 | Ga0207644_10000087 | 3300025931 | Bacteria | 67315 |
| 237 | Ga0207644_10000340 | 3300025931 | Bacteria | 30290 |
| 238 | Ga0207644_10003273 | 3300025931 | Bacteria | 10467 |
| 239 | Ga0207644_10021473 | 3300025931 | Bacteria | 4399 |
| 240 | Ga0207644_10503965 | 3300025931 | Bacteria | 999 |
| 241 | Ga0207644_11078784 | 3300025931 | Bacteria | 675 |
| 242 | Ga0207690_10008564 | 3300025932 | Bacteria | 6070 |
| 243 | Ga0207690_10504006 | 3300025932 | Bacteria | 979 |
| 244 | Ga0207706_10003993 | 3300025933 | Bacteria | 13976 |
| 245 | Ga0207706_10308999 | 3300025933 | Bacteria | 1377 |
| 246 | Ga0207711_10051707 | 3300025941 | Bacteria | 3519 |
| 247 | Ga0207711_10127685 | 3300025941 | Bacteria | 2276 |
| 248 | Ga0207711_10190382 | 3300025941 | Bacteria | 1869 |
| 249 | Ga0207711_10546457 | 3300025941 | Bacteria | 1080 |
| 250 | Ga0207711_10727738 | 3300025941 | Bacteria | 925 |
| 251 | Ga0207711_10766123 | 3300025941 | Bacteria | 899 |
| 252 | Ga0207661_10180176 | 3300025944 | Bacteria | 1845 |
| 253 | Ga0207661_11962162 | 3300025944 | Bacteria | 531 |
| 254 | Ga0207679_10053825 | 3300025945 | Bacteria | 2960 |
| 255 | Ga0207679_10061000 | 3300025945 | Bacteria | 2805 |
| 256 | Ga0207667_10005918 | 3300025949 | Bacteria | 14893 |
| 257 | Ga0207667_10017546 | 3300025949 | Bacteria | 8051 |
| 258 | Ga0207667_10044625 | 3300025949 | Bacteria | 4696 |
| 259 | Ga0207667_10056281 | 3300025949 | Bacteria | 4131 |
| 260 | Ga0207667_10351442 | 3300025949 | Bacteria | 1503 |
| 261 | Ga0207667_10403406 | 3300025949 | Bacteria | 1392 |
| 262 | Ga0207667_10422971 | 3300025949 | Bacteria | 1355 |
| 263 | Ga0207712_10948067 | 3300025961 | Bacteria | 762 |
| 264 | Ga0207668_10002561 | 3300025972 | Bacteria | 10621 |
| 265 | Ga0207668_10016806 | 3300025972 | Bacteria | 4575 |
| 266 | Ga0207668_10037776 | 3300025972 | Bacteria | 3235 |
| 267 | Ga0207668_10101665 | 3300025972 | Bacteria | 2137 |
| 268 | Ga0207668_10552993 | 3300025972 | Bacteria | 997 |
| 269 | Ga0207640_10000601 | 3300025981 | Bacteria | 21426 |
| 270 | Ga0207640_10011203 | 3300025981 | Bacteria | 5070 |
| 271 | Ga0207640_10045815 | 3300025981 | Bacteria | 2811 |
| 272 | Ga0207640_10285345 | 3300025981 | Bacteria | 1299 |
| 273 | Ga0207658_10001020 | 3300025986 | Bacteria | 22790 |
| 274 | Ga0207658_10004335 | 3300025986 | Bacteria | 9876 |
| 275 | Ga0207658_10013921 | 3300025986 | Bacteria | 5504 |
| 276 | Ga0207658_10016803 | 3300025986 | Bacteria | 5035 |
| 277 | Ga0207658_10136685 | 3300025986 | Bacteria | 1978 |
| 278 | Ga0207658_10176195 | 3300025986 | Bacteria | 1766 |
| 279 | Ga0207703_10005483 | 3300026035 | Bacteria | 10198 |
| 280 | Ga0207703_10006539 | 3300026035 | Bacteria | 9298 |
| 281 | Ga0207703_10069601 | 3300026035 | Bacteria | 2903 |
| 282 | Ga0207703_10233091 | 3300026035 | Bacteria | 1651 |
| 283 | Ga0207639_10029260 | 3300026041 | Bacteria | 4031 |
| 284 | Ga0207639_10074689 | 3300026041 | Bacteria | 2663 |
| 285 | Ga0207639_10335995 | 3300026041 | Bacteria | 1346 |
| 286 | Ga0207678_10153702 | 3300026067 | Bacteria | 1965 |
| 287 | Ga0207678_10953663 | 3300026067 | Bacteria | 759 |
| 288 | Ga0207702_10003311 | 3300026078 | Bacteria | 14824 |
| 289 | Ga0207702_10052951 | 3300026078 | Bacteria | 3435 |
| 290 | Ga0207641_10000081 | 3300026088 | Bacteria | 139770 |
| 291 | Ga0207641_10048636 | 3300026088 | Bacteria | 3580 |
| 292 | Ga0207641_10075846 | 3300026088 | Bacteria | 2905 |
| 293 | Ga0207641_10247505 | 3300026088 | Bacteria | 1663 |
| 294 | Ga0207641_11208578 | 3300026088 | Bacteria | 756 |
| 295 | Ga0207676_10016348 | 3300026095 | Bacteria | 5372 |
| 296 | Ga0207676_10374769 | 3300026095 | Bacteria | 1323 |
| 297 | Ga0207676_10562782 | 3300026095 | Bacteria | 1090 |
| 298 | Ga0207674_10043371 | 3300026116 | Bacteria | 4638 |
| 299 | Ga0207674_10090330 | 3300026116 | Bacteria | 3054 |
| 300 | Ga0207674_10174678 | 3300026116 | Bacteria | 2101 |
| 301 | Ga0207674_10385007 | 3300026116 | Bacteria | 1356 |
| 302 | Ga0207674_10455305 | 3300026116 | Bacteria | 1237 |
| 303 | Ga0207698_10000459 | 3300026142 | Bacteria | 23673 |
| 304 | Ga0207698_10051714 | 3300026142 | Bacteria | 3142 |
| 305 | Ga0207698_10085474 | 3300026142 | Bacteria | 2562 |
| 306 | Ga0207698_10128022 | 3300026142 | Bacteria | 2164 |
| 307 | Ga0207698_10223869 | 3300026142 | Bacteria | 1702 |
| 308 | Ga0207698_10533081 | 3300026142 | Bacteria | 1148 |
| 309 | Ga0207698_10726917 | 3300026142 | Bacteria | 990 |
| 310 | Ga0207698_11760381 | 3300026142 | Bacteria | 635 |
| 311 | Ga0209281_1010906 | 3300027111 | Bacteria | 2055 |
| 312 | Ga0209281_1033098 | 3300027111 | Bacteria | 910 |
| 313 | Ga0209974_10007859 | 3300027876 | Bacteria | 3659 |
| 314 | Ga0209974_10022724 | 3300027876 | Bacteria | 2077 |
| 315 | Ga0207428_10080863 | 3300027907 | Bacteria | 2538 |
| 316 | Ga0268266_10000462 | 3300028379 | Bacteria | 59105 |
| 317 | Ga0268266_10008187 | 3300028379 | Bacteria | 9328 |
| 318 | Ga0268266_10844423 | 3300028379 | Bacteria | 885 |
| 319 | Ga0268266_10873220 | 3300028379 | Bacteria | 869 |
| 320 | Ga0268265_10008470 | 3300028380 | Bacteria | 6947 |
| 321 | Ga0268265_10029620 | 3300028380 | Bacteria | 3932 |
| 322 | Ga0268265_10089395 | 3300028380 | Bacteria | 2456 |
| 323 | Ga0268265_10430316 | 3300028380 | Bacteria | 1228 |
| 324 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 325 | Ga0268264_10019317 | 3300028381 | Bacteria | 5570 |
| 326 | Ga0268264_11006057 | 3300028381 | Bacteria | 840 |
| 327 | Ga0265331_10022653 | 3300031250 | Bacteria | 3203 |
| 328 | Ga0265327_10349454 | 3300031251 | Bacteria | 646 |
| 329 | Ga0307508_10028060 | 3300031616 | Bacteria | 5093 |
| 330 | Ga0307405_10020044 | 3300031731 | Bacteria | 3728 |
| 331 | Ga0307405_10915136 | 3300031731 | Bacteria | 743 |
| 332 | Ga0307413_10055522 | 3300031824 | Bacteria | 2410 |
| 333 | Ga0307413_10636587 | 3300031824 | Bacteria | 878 |
| 334 | Ga0307413_11660536 | 3300031824 | Bacteria | 569 |
| 335 | Ga0307413_11714780 | 3300031824 | Bacteria | 560 |
| 336 | Ga0307413_12160986 | 3300031824 | Bacteria | 504 |
| 337 | Ga0307410_10793359 | 3300031852 | Bacteria | 805 |
| 338 | Ga0307407_10209976 | 3300031903 | Bacteria | 1310 |
| 339 | Ga0307412_10013998 | 3300031911 | Bacteria | 4722 |
| 340 | Ga0307409_100186857 | 3300031995 | Bacteria | 1840 |
| 341 | Ga0307409_100659868 | 3300031995 | Bacteria | 1041 |
| 342 | Ga0307409_101468269 | 3300031995 | Bacteria | 709 |
| 343 | Ga0307409_101988086 | 3300031995 | Bacteria | 611 |
| 344 | Ga0307409_102415654 | 3300031995 | Bacteria | 555 |
| 345 | Ga0307416_101329263 | 3300032002 | Bacteria | 825 |
| 346 | Ga0307414_10597986 | 3300032004 | Bacteria | 989 |
| 347 | Ga0307414_11179300 | 3300032004 | Bacteria | 709 |
| 348 | Ga0307411_10061273 | 3300032005 | Bacteria | 2504 |
| 349 | Ga0307411_10087411 | 3300032005 | Bacteria | 2165 |
| 350 | Ga0307415_100131927 | 3300032126 | Bacteria | 1893 |
| 351 | Ga0373932_0250651 | 3300035112 | Bacteria | 646 |
| 352 | Ga0373939_0309411 | 3300035114 | Bacteria | 632 |
| 353 | Ga0316574_0652228 | 3300035398 | Bacteria | 648 |
| 354 | Ga0373935_0468988 | 3300035692 | Bacteria | 911 |
| 355 | Ga0316584_0159681 | 3300036712 | Bacteria | 1675 |
| 356 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 357 | Ga0495627_000217 | 3300046453 | Bacteria | 62536 |
| 358 | Ga0495650_0000559 | 3300046471 | Bacteria | 52755 |
| 359 | Ga0495639_0363466 | 3300046475 | Bacteria | 728 |
| 360 | Ga0495596_0000233 | 3300046500 | Bacteria | 37690 |
| 361 | Ga0495596_0007814 | 3300046500 | Bacteria | 4797 |
| 362 | Ga0495607_0025544 | 3300046501 | Bacteria | 3673 |
| 363 | Ga0495583_0168886 | 3300046506 | Bacteria | 899 |
| 364 | Ga0495606_0029863 | 3300046507 | Bacteria | 3820 |
| 365 | Ga0495610_0000030 | 3300046512 | Bacteria | 265950 |
| 366 | Ga0495610_0000743 | 3300046512 | Bacteria | 30950 |
| 367 | Ga0495610_0002541 | 3300046512 | Bacteria | 15200 |
| 368 | Ga0495620_0023302 | 3300046515 | Bacteria | 2963 |
| 369 | Ga0495632_0005692 | 3300046519 | Bacteria | 8181 |
| 370 | Ga0495632_0061761 | 3300046519 | Bacteria | 1818 |
| 371 | Ga0495643_0000110 | 3300046522 | Bacteria | 135600 |
| 372 | Ga0495643_0010124 | 3300046522 | Bacteria | 5815 |
| 373 | Ga0495643_0016156 | 3300046522 | Bacteria | 4392 |
| 374 | Ga0495643_0026681 | 3300046522 | Bacteria | 3255 |
| 375 | Ga0495663_0321605 | 3300046525 | Bacteria | 560 |
| 376 | Ga0495652_1081901 | 3300046529 | Bacteria | 521 |
| 377 | Ga0495654_0178469 | 3300046530 | Bacteria | 921 |
| 378 | Ga0495654_0275725 | 3300046530 | Bacteria | 693 |
| 379 | Ga0495587_0439863 | 3300046536 | Bacteria | 723 |
| 380 | Ga0495668_0072941 | 3300046616 | Bacteria | 1886 |
| 381 | Ga0495668_0073421 | 3300046616 | Bacteria | 1879 |
| 382 | Ga0495668_0402879 | 3300046616 | Bacteria | 752 |
| 383 | Ga0495625_0008300 | 3300046660 | Bacteria | 8875 |
| 384 | Ga0495625_0360826 | 3300046660 | Bacteria | 916 |
| 385 | Ga0495661_0093611 | 3300046665 | Bacteria | 1705 |
| 386 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 387 | Ga0495686_0249834 | 3300047472 | Bacteria | 997 |
| 388 | Ga0495686_0365195 | 3300047472 | Bacteria | 782 |
| 389 | Ga0495615_0000025 | 3300048090 | Bacteria | 49753 |
| 390 | Ga0495626_0004061 | 3300048091 | Bacteria | 9120 |
| 391 | Ga0496100_0005027 | 3300048903 | Bacteria | 7076 |
| 392 | Ga0496100_0053361 | 3300048903 | Bacteria | 2632 |
| 393 | Ga0496101_0052143 | 3300048904 | Bacteria | 2949 |
| 394 | Ga0496101_0071618 | 3300048904 | Bacteria | 2542 |
| 395 | Ga0496101_0437837 | 3300048904 | Bacteria | 1031 |
| 396 | Ga0496101_0523329 | 3300048904 | Bacteria | 937 |
| 397 | Ga0496102_0000998 | 3300048905 | Bacteria | 26613 |
| 398 | Ga0496102_0053745 | 3300048905 | Bacteria | 3671 |
| 399 | Ga0496102_0848525 | 3300048905 | Bacteria | 836 |
| 400 | Ga0496102_1942457 | 3300048905 | Bacteria | 505 |
| 401 | Ga0496103_0000201 | 3300048906 | Bacteria | 59837 |
| 402 | Ga0496103_0019567 | 3300048906 | Bacteria | 4065 |
| 403 | Ga0496103_0292193 | 3300048906 | Bacteria | 1048 |
| 404 | Ga0496104_0000078 | 3300048907 | Bacteria | 100203 |
| 405 | Ga0496104_0219714 | 3300048907 | Bacteria | 1812 |
| 406 | Ga0496105_0004202 | 3300048908 | Bacteria | 10816 |
| 407 | Ga0496105_0059223 | 3300048908 | Bacteria | 3160 |
| 408 | Ga0496105_0563877 | 3300048908 | Bacteria | 887 |
| 409 | Ga0496105_0611034 | 3300048908 | Bacteria | 845 |
| 410 | Ga0496106_0002700 | 3300048909 | Bacteria | 13158 |
| 411 | Ga0496106_0613235 | 3300048909 | Bacteria | 871 |
| 412 | Ga0496107_0006277 | 3300048910 | Bacteria | 8171 |
| 413 | Ga0496108_0211764 | 3300048911 | Bacteria | 1682 |
| 414 | Ga0496108_0261278 | 3300048911 | Bacteria | 1507 |
| 415 | Ga0496109_0008938 | 3300048912 | Bacteria | 8536 |
| 416 | Ga0496109_0034178 | 3300048912 | Bacteria | 4577 |
| 417 | Ga0496110_0050983 | 3300048913 | Bacteria | 3636 |
| 418 | Ga0496110_0111736 | 3300048913 | Bacteria | 2456 |
| 419 | Ga0496110_1512883 | 3300048913 | Bacteria | 581 |
| 420 | Ga0496111_0023891 | 3300048914 | Bacteria | 4296 |
| 421 | Ga0496112_0172573 | 3300048915 | Bacteria | 2127 |
| 422 | Ga0496112_1046145 | 3300048915 | Bacteria | 735 |
| 423 | Ga0496113_0003327 | 3300048916 | Bacteria | 9598 |
| 424 | Ga0496113_0005353 | 3300048916 | Bacteria | 7997 |
| 425 | Ga0496114_0046711 | 3300048917 | Bacteria | 3599 |
| 426 | Ga0496114_0304975 | 3300048917 | Bacteria | 1406 |
| 427 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 428 | Ga0496116_0074998 | 3300048919 | Bacteria | 2125 |
| 429 | Ga0496116_0127484 | 3300048919 | Bacteria | 1458 |
| 430 | Ga0496116_0160607 | 3300048919 | Bacteria | 1233 |
| 431 | Ga0496117_0098938 | 3300048920 | Bacteria | 1852 |
| 432 | Ga0496117_0265331 | 3300048920 | Bacteria | 928 |
| 433 | Ga0496118_0044905 | 3300048921 | Bacteria | 3455 |
| 434 | Ga0496118_0087280 | 3300048921 | Bacteria | 2164 |
| 435 | Ga0496118_0150407 | 3300048921 | Bacteria | 1458 |
| 436 | Ga0496118_0436684 | 3300048921 | Bacteria | 669 |
| 437 | Ga0496119_0000114 | 3300048922 | Bacteria | 114495 |
| 438 | Ga0496119_0391750 | 3300048922 | Bacteria | 664 |
| 439 | Ga0496120_0000266 | 3300048923 | Bacteria | 87412 |
| 440 | Ga0496120_0106705 | 3300048923 | Bacteria | 1470 |
| 441 | Ga0496120_0310592 | 3300048923 | Bacteria | 719 |
| 442 | Ga0496121_0000021 | 3300048924 | Bacteria | 478544 |
| 443 | Ga0496121_0000520 | 3300048924 | Bacteria | 73411 |
| 444 | Ga0496121_0002014 | 3300048924 | Bacteria | 32249 |
| 445 | Ga0496121_0010367 | 3300048924 | Bacteria | 10526 |
| 446 | Ga0496121_0041974 | 3300048924 | Bacteria | 3987 |
| 447 | Ga0496122_0008602 | 3300048925 | Bacteria | 10961 |
| 448 | Ga0496122_0012616 | 3300048925 | Bacteria | 8385 |
| 449 | Ga0496122_0042142 | 3300048925 | Bacteria | 3595 |
| 450 | Ga0496122_0102140 | 3300048925 | Bacteria | 1913 |
| 451 | Ga0496122_0284079 | 3300048925 | Bacteria | 902 |
| 452 | Ga0496122_0329468 | 3300048925 | Bacteria | 807 |
| 453 | Ga0496122_0578838 | 3300048925 | Bacteria | 529 |
| 454 | Ga0496123_0001658 | 3300048926 | Bacteria | 29886 |
| 455 | Ga0496123_0001678 | 3300048926 | Bacteria | 29639 |
| 456 | Ga0496123_0100614 | 3300048926 | Bacteria | 1683 |
| 457 | Ga0496123_0147097 | 3300048926 | Bacteria | 1277 |
| 458 | Ga0496123_0192765 | 3300048926 | Bacteria | 1052 |
| 459 | Ga0496124_0003121 | 3300048927 | Bacteria | 20560 |
| 460 | Ga0496124_0003580 | 3300048927 | Bacteria | 18883 |
| 461 | Ga0496124_0004225 | 3300048927 | Bacteria | 16906 |
| 462 | Ga0496124_0040943 | 3300048927 | Bacteria | 4002 |
| 463 | Ga0496124_0059973 | 3300048927 | Bacteria | 3194 |
| 464 | Ga0496124_0213779 | 3300048927 | Bacteria | 1457 |
| 465 | Ga0496125_0013528 | 3300048928 | Bacteria | 8017 |
| 466 | Ga0496125_0022629 | 3300048928 | Bacteria | 5830 |
| 467 | Ga0496125_0031114 | 3300048928 | Bacteria | 4762 |
| 468 | Ga0496125_0081513 | 3300048928 | Bacteria | 2471 |
| 469 | Ga0496125_0413899 | 3300048928 | Bacteria | 784 |
| 470 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 471 | Ga0496126_0000173 | 3300048929 | Bacteria | 146490 |
| 472 | Ga0496126_0005189 | 3300048929 | Bacteria | 15051 |
| 473 | Ga0496126_0094396 | 3300048929 | Bacteria | 2625 |
| 474 | Ga0496126_0429614 | 3300048929 | Bacteria | 1066 |
| 475 | Ga0495682_0295026 | 3300049460 | Bacteria | 572 |
| 476 | Ga0501031_0301097 | 3300049568 | Bacteria | 1039 |
| 477 | Ga0501033_0330928 | 3300049570 | Bacteria | 1069 |
| 478 | Ga0501033_0650644 | 3300049570 | Bacteria | 720 |
| 479 | Ga0501034_0597955 | 3300049571 | Bacteria | 1009 |
| 480 | Ga0501036_1476949 | 3300049572 | Bacteria | 550 |
| 481 | Ga0501037_0921657 | 3300049573 | Bacteria | 572 |
| 482 | Ga0501047_0388150 | 3300049581 | Bacteria | 1230 |
| 483 | Ga0501035_0750341 | 3300049822 | Bacteria | 783 |
| 484 | Ga0501044_0001951 | 3300049823 | Bacteria | 23856 |
| 485 | Ga0501044_0591689 | 3300049823 | Bacteria | 1003 |
| 486 | Ga0501044_1427294 | 3300049823 | Bacteria | 558 |
| 487 | nmdc:mga03683_209906_c1 | 3300050489 | Bacteria | 896 |
| 488 | nmdc:mga03683_906_c1 | 3300050489 | Bacteria | 8520 |
| 489 | nmdc:mga03n38_291_c1 | 3300050490 | Bacteria | 12010 |
| 490 | nmdc:mga00v17_178182_c1 | 3300050491 | Bacteria | 1371 |
| 491 | nmdc:mga00v17_18971_c1 | 3300050491 | Bacteria | 3917 |
| 492 | nmdc:mga0k408_561372_c1 | 3300050493 | Bacteria | 674 |
| 493 | nmdc:mga0k408_7997_c1 | 3300050493 | Bacteria | 5669 |
| 494 | nmdc:mga0k408_7_c1 | 3300050493 | Bacteria | 164270 |
| 495 | nmdc:mga07m45_2156_c1 | 3300050496 | Bacteria | 9166 |
| 496 | nmdc:mga07m45_64983_c1 | 3300050496 | Bacteria | 2071 |
| 497 | nmdc:mga07m45_82669_c1 | 3300050496 | Bacteria | 1834 |
| 498 | nmdc:mga07m45_83984_c1 | 3300050496 | Bacteria | 1820 |
| 499 | nmdc:mga0rr50_399162_c1 | 3300050513 | Bacteria | 1161 |
| 500 | nmdc:mga0sz30_256747_c1 | 3300050516 | Bacteria | 778 |
| 501 | nmdc:mga0sz30_56372_c1 | 3300050516 | Bacteria | 1673 |
| 502 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 503 | Ga0500643_008523 | 3300053087 | Bacteria | 4023 |
| 504 | Ga0500643_109956 | 3300053087 | Bacteria | 745 |
| 505 | Ga0500566_0159358 | 3300053094 | Bacteria | 1178 |
| 506 | Ga0500562_188695 | 3300053108 | Bacteria | 559 |
| 507 | Ga0500572_297339 | 3300053111 | Bacteria | 520 |
| 508 | Ga0500595_018192 | 3300053119 | Bacteria | 2575 |
| 509 | Ga0500607_000354 | 3300053121 | Bacteria | 43487 |
| 510 | Ga0500607_004167 | 3300053121 | Bacteria | 10087 |
| 511 | Ga0500608_000156 | 3300053122 | Bacteria | 28195 |
| 512 | Ga0500614_088638 | 3300053123 | Bacteria | 876 |
| 513 | Ga0500559_0001842 | 3300053136 | Bacteria | 11561 |
| 514 | Ga0500559_0012360 | 3300053136 | Bacteria | 3632 |
| 515 | Ga0500564_059241 | 3300053138 | Bacteria | 1739 |
| 516 | Ga0500568_0248485 | 3300053139 | Bacteria | 648 |
| 517 | Ga0500590_002875 | 3300053148 | Bacteria | 7797 |
| 518 | Ga0500590_224027 | 3300053148 | Bacteria | 772 |
| 519 | Ga0500604_0155323 | 3300053151 | Bacteria | 778 |
| 520 | Ga0500616_0000893 | 3300053153 | Bacteria | 32769 |
| 521 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 522 | Ga0500637_0027500 | 3300053178 | Bacteria | 3140 |
| 523 | Ga0500567_004902 | 3300053723 | Bacteria | 6143 |
| 524 | Ga0500625_000021 | 3300053729 | Bacteria | 83503 |
| 525 | Ga0500625_258391 | 3300053729 | Bacteria | 510 |
| 526 | Ga0500645_005657 | 3300053730 | Bacteria | 4565 |
| 527 | Ga0500645_018923 | 3300053730 | Bacteria | 2146 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2895880812 | 2895884274 | 102 |
| 2 | 3300049573 | Ga0501037_0921657 | Ga0501037_0921657_112_492 | 103 |
| 3 | 3300046512 | Ga0495610_0002541 | Ga0495610_0002541_9588_9902 | 104 |
| 4 | 3300046660 | Ga0495625_0360826 | Ga0495625_0360826_72_452 | 104 |
| 5 | 3300047472 | Ga0495686_0365195 | Ga0495686_0365195_74_454 | 104 |
| 6 | 3300048091 | Ga0495626_0004061 | Ga0495626_0004061_5177_5491 | 104 |
| 7 | 3300053087 | Ga0500643_008523 | Ga0500643_008523_2517_2897 | 104 |
| 8 | 3300046530 | Ga0495654_0178469 | Ga0495654_0178469_267_599 | 105 |
| 9 | 3300053730 | Ga0500645_018923 | Ga0500645_018923_774_1106 | 105 |
| 10 | iso_pu_bacteria | 2738541301 | 2738849996 | 106 |
| 11 | iso_pu_bacteria | 2738541304 | 2738865725 | 106 |
| 12 | iso_pu_bacteria | 2738543022 | 2739298243 | 106 |
| 13 | iso_pu_bacteria | 2738543033 | 2739359921 | 106 |
| 14 | iso_pu_bacteria | 2739367664 | 2739649143 | 106 |
| 15 | iso_pu_bacteria | 2739367865 | 2740027616 | 106 |
| 16 | iso_pu_bacteria | 2818991438 | 2819553065 | 106 |
| 17 | iso_pu_bacteria | 2928100450 | 2928104189 | 106 |
| 18 | iso_pu_bacteria | 2928959182 | 2928961654 | 106 |
| 19 | iso_pu_bacteria | 8054302542 | 8054305899 | 106 |
| 20 | iso_pu_bacteria | 2882806704 | 2882807359 | 107 |
| 21 | 3300046529 | Ga0495652_1081901 | Ga0495652_1081901_49_375 | 108 |
| 22 | 3300048913 | Ga0496110_1512883 | Ga0496110_1512883_243_569 | 108 |
| 23 | 3300053148 | Ga0500590_002875 | Ga0500590_002875_2062_2388 | 108 |
| 24 | iso_pu_bacteria | 2510917021 | 2511125719 | 108 |
| 25 | 3300005295 | Ga0065707_10163979 | Ga0065707_101639792 | 109 |
| 26 | 3300005331 | Ga0070670_100092329 | Ga0070670_1000923292 | 109 |
| 27 | 3300005335 | Ga0070666_10084446 | Ga0070666_100844462 | 109 |
| 28 | 3300005353 | Ga0070669_100008686 | Ga0070669_1000086863 | 109 |
| 29 | 3300005353 | Ga0070669_101368264 | Ga0070669_1013682641 | 109 |
| 30 | 3300005355 | Ga0070671_100000818 | Ga0070671_1000008182 | 109 |
| 31 | 3300005367 | Ga0070667_100011501 | Ga0070667_1000115018 | 109 |
| 32 | 3300005468 | Ga0070707_101047625 | Ga0070707_1010476252 | 109 |
| 33 | 3300005548 | Ga0070665_100000107 | Ga0070665_10000010779 | 109 |
| 34 | 3300005548 | Ga0070665_100744214 | Ga0070665_1007442142 | 109 |
| 35 | 3300005841 | Ga0068863_100008940 | Ga0068863_1000089402 | 109 |
| 36 | 3300005841 | Ga0068863_101963737 | Ga0068863_1019637372 | 109 |
| 37 | 3300005843 | Ga0068860_100318836 | Ga0068860_1003188362 | 109 |
| 38 | 3300005844 | Ga0068862_100003802 | Ga0068862_1000038024 | 109 |
| 39 | 3300005844 | Ga0068862_100006131 | Ga0068862_1000061313 | 109 |
| 40 | 3300009177 | Ga0105248_10253309 | Ga0105248_102533093 | 109 |
| 41 | 3300009553 | Ga0105249_10378964 | Ga0105249_103789642 | 109 |
| 42 | 3300025315 | Ga0207697_10458502 | Ga0207697_104585021 | 109 |
| 43 | 3300025735 | Ga0207713_1001941 | Ga0207713_10019414 | 109 |
| 44 | 3300025923 | Ga0207681_10016888 | Ga0207681_100168882 | 109 |
| 45 | 3300025923 | Ga0207681_10956275 | Ga0207681_109562752 | 109 |
| 46 | 3300025925 | Ga0207650_10229638 | Ga0207650_102296381 | 109 |
| 47 | 3300025931 | Ga0207644_10000340 | Ga0207644_1000034016 | 109 |
| 48 | 3300025941 | Ga0207711_10190382 | Ga0207711_101903822 | 109 |
| 49 | 3300025961 | Ga0207712_10948067 | Ga0207712_109480671 | 109 |
| 50 | 3300025972 | Ga0207668_10002561 | Ga0207668_100025616 | 109 |
| 51 | 3300025986 | Ga0207658_10013921 | Ga0207658_100139216 | 109 |
| 52 | 3300026088 | Ga0207641_10247505 | Ga0207641_102475052 | 109 |
| 53 | 3300026088 | Ga0207641_11208578 | Ga0207641_112085782 | 109 |
| 54 | 3300028379 | Ga0268266_10000462 | Ga0268266_1000046252 | 109 |
| 55 | 3300028380 | Ga0268265_10008470 | Ga0268265_100084702 | 109 |
| 56 | 3300028380 | Ga0268265_10029620 | Ga0268265_100296202 | 109 |
| 57 | 3300028381 | Ga0268264_10019317 | Ga0268264_100193175 | 109 |
| 58 | 3300031824 | Ga0307413_10055522 | Ga0307413_100555222 | 109 |
| 59 | 3300031852 | Ga0307410_10793359 | Ga0307410_107933592 | 109 |
| 60 | 3300031995 | Ga0307409_100659868 | Ga0307409_1006598681 | 109 |
| 61 | 3300032005 | Ga0307411_10087411 | Ga0307411_100874114 | 109 |
| 62 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_741337_741666 | 109 |
| 63 | 3300048929 | Ga0496126_0429614 | Ga0496126_0429614_708_1037 | 109 |
| 64 | 3300050493 | nmdc:mga0k408_561372_c1 | nmdc:mga0k408_561372_c1_302_631 | 109 |
| 65 | 3300053153 | Ga0500616_0000893 | Ga0500616_0000893_28936_29265 | 109 |
| 66 | 2162886007 | SwRhRL2b_contig_1044026 | SwRhRL2b_0451.00003340 | 110 |
| 67 | 2162886007 | SwRhRL2b_contig_196785 | SwRhRL2b_0777.00001830 | 110 |
| 68 | 2162886007 | SwRhRL2b_contig_878851 | SwRhRL2b_0744.00004040 | 110 |
| 69 | 3300002074 | JGI24748J21848_1001818 | JGI24748J21848_10018183 | 110 |
| 70 | 3300002239 | JGI24034J26672_10069818 | JGI24034J26672_100698182 | 110 |
| 71 | 3300002459 | JGI24751J29686_10000080 | JGI24751J29686_1000008014 | 110 |
| 72 | 3300003791 | Ga0055530_10007261 | Ga0055530_100072613 | 110 |
| 73 | 3300005289 | Ga0065704_10070424 | Ga0065704_100704245 | 110 |
| 74 | 3300005289 | Ga0065704_10099696 | Ga0065704_100996962 | 110 |
| 75 | 3300005289 | Ga0065704_10791785 | Ga0065704_107917851 | 110 |
| 76 | 3300005327 | Ga0070658_10000371 | Ga0070658_1000037132 | 110 |
| 77 | 3300005327 | Ga0070658_10008372 | Ga0070658_100083726 | 110 |
| 78 | 3300005327 | Ga0070658_10190159 | Ga0070658_101901592 | 110 |
| 79 | 3300005327 | Ga0070658_10421638 | Ga0070658_104216382 | 110 |
| 80 | 3300005329 | Ga0070683_100094068 | Ga0070683_1000940683 | 110 |
| 81 | 3300005329 | Ga0070683_100120426 | Ga0070683_1001204262 | 110 |
| 82 | 3300005329 | Ga0070683_101700807 | Ga0070683_1017008072 | 110 |
| 83 | 3300005330 | Ga0070690_100066155 | Ga0070690_1000661552 | 110 |
| 84 | 3300005331 | Ga0070670_100177418 | Ga0070670_1001774183 | 110 |
| 85 | 3300005335 | Ga0070666_10442376 | Ga0070666_104423761 | 110 |
| 86 | 3300005336 | Ga0070680_100005540 | Ga0070680_1000055404 | 110 |
| 87 | 3300005339 | Ga0070660_100209166 | Ga0070660_1002091661 | 110 |
| 88 | 3300005339 | Ga0070660_100867063 | Ga0070660_1008670632 | 110 |
| 89 | 3300005344 | Ga0070661_100002979 | Ga0070661_1000029792 | 110 |
| 90 | 3300005347 | Ga0070668_100002062 | Ga0070668_10000206217 | 110 |
| 91 | 3300005347 | Ga0070668_100013390 | Ga0070668_1000133904 | 110 |
| 92 | 3300005347 | Ga0070668_100018387 | Ga0070668_1000183872 | 110 |
| 93 | 3300005347 | Ga0070668_100086994 | Ga0070668_1000869943 | 110 |
| 94 | 3300005353 | Ga0070669_100002274 | Ga0070669_1000022749 | 110 |
| 95 | 3300005353 | Ga0070669_100008689 | Ga0070669_1000086894 | 110 |
| 96 | 3300005355 | Ga0070671_100000066 | Ga0070671_10000006638 | 110 |
| 97 | 3300005355 | Ga0070671_100012590 | Ga0070671_1000125908 | 110 |
| 98 | 3300005355 | Ga0070671_100031501 | Ga0070671_1000315013 | 110 |
| 99 | 3300005355 | Ga0070671_100797815 | Ga0070671_1007978152 | 110 |
| 100 | 3300005355 | Ga0070671_101330014 | Ga0070671_1013300142 | 110 |
| 101 | 3300005366 | Ga0070659_100049705 | Ga0070659_1000497053 | 110 |
| 102 | 3300005366 | Ga0070659_100054618 | Ga0070659_1000546183 | 110 |
| 103 | 3300005366 | Ga0070659_101168960 | Ga0070659_1011689601 | 110 |
| 104 | 3300005367 | Ga0070667_100000998 | Ga0070667_1000009989 | 110 |
| 105 | 3300005367 | Ga0070667_100001602 | Ga0070667_1000016022 | 110 |
| 106 | 3300005367 | Ga0070667_100007905 | Ga0070667_1000079053 | 110 |
| 107 | 3300005367 | Ga0070667_100058832 | Ga0070667_1000588323 | 110 |
| 108 | 3300005455 | Ga0070663_100101057 | Ga0070663_1001010573 | 110 |
| 109 | 3300005455 | Ga0070663_101054260 | Ga0070663_1010542602 | 110 |
| 110 | 3300005457 | Ga0070662_100001119 | Ga0070662_10000111917 | 110 |
| 111 | 3300005457 | Ga0070662_100118583 | Ga0070662_1001185832 | 110 |
| 112 | 3300005458 | Ga0070681_10002647 | Ga0070681_100026472 | 110 |
| 113 | 3300005458 | Ga0070681_11770234 | Ga0070681_117702342 | 110 |
| 114 | 3300005530 | Ga0070679_100002687 | Ga0070679_1000026875 | 110 |
| 115 | 3300005530 | Ga0070679_100132426 | Ga0070679_1001324263 | 110 |
| 116 | 3300005530 | Ga0070679_100173227 | Ga0070679_1001732272 | 110 |
| 117 | 3300005530 | Ga0070679_100527508 | Ga0070679_1005275081 | 110 |
| 118 | 3300005530 | Ga0070679_100655079 | Ga0070679_1006550792 | 110 |
| 119 | 3300005530 | Ga0070679_101934650 | Ga0070679_1019346501 | 110 |
| 120 | 3300005535 | Ga0070684_100189909 | Ga0070684_1001899091 | 110 |
| 121 | 3300005535 | Ga0070684_100478349 | Ga0070684_1004783492 | 110 |
| 122 | 3300005539 | Ga0068853_100047946 | Ga0068853_1000479464 | 110 |
| 123 | 3300005539 | Ga0068853_100949023 | Ga0068853_1009490231 | 110 |
| 124 | 3300005539 | Ga0068853_101025056 | Ga0068853_1010250562 | 110 |
| 125 | 3300005544 | Ga0070686_100150652 | Ga0070686_1001506522 | 110 |
| 126 | 3300005547 | Ga0070693_100289961 | Ga0070693_1002899612 | 110 |
| 127 | 3300005548 | Ga0070665_100003786 | Ga0070665_1000037864 | 110 |
| 128 | 3300005548 | Ga0070665_100022366 | Ga0070665_1000223667 | 110 |
| 129 | 3300005548 | Ga0070665_100120521 | Ga0070665_1001205212 | 110 |
| 130 | 3300005548 | Ga0070665_100395975 | Ga0070665_1003959753 | 110 |
| 131 | 3300005548 | Ga0070665_100532855 | Ga0070665_1005328552 | 110 |
| 132 | 3300005563 | Ga0068855_100014772 | Ga0068855_1000147723 | 110 |
| 133 | 3300005563 | Ga0068855_100019897 | Ga0068855_1000198977 | 110 |
| 134 | 3300005563 | Ga0068855_100034858 | Ga0068855_1000348587 | 110 |
| 135 | 3300005563 | Ga0068855_100058595 | Ga0068855_1000585955 | 110 |
| 136 | 3300005563 | Ga0068855_100859043 | Ga0068855_1008590431 | 110 |
| 137 | 3300005564 | Ga0070664_100011134 | Ga0070664_1000111347 | 110 |
| 138 | 3300005564 | Ga0070664_100167840 | Ga0070664_1001678402 | 110 |
| 139 | 3300005564 | Ga0070664_100816556 | Ga0070664_1008165562 | 110 |
| 140 | 3300005564 | Ga0070664_101277729 | Ga0070664_1012777292 | 110 |
| 141 | 3300005577 | Ga0068857_100026635 | Ga0068857_1000266354 | 110 |
| 142 | 3300005577 | Ga0068857_100406941 | Ga0068857_1004069412 | 110 |
| 143 | 3300005577 | Ga0068857_100453743 | Ga0068857_1004537432 | 110 |
| 144 | 3300005577 | Ga0068857_100909489 | Ga0068857_1009094892 | 110 |
| 145 | 3300005577 | Ga0068857_101303113 | Ga0068857_1013031132 | 110 |
| 146 | 3300005578 | Ga0068854_100014393 | Ga0068854_1000143935 | 110 |
| 147 | 3300005578 | Ga0068854_100026074 | Ga0068854_1000260742 | 110 |
| 148 | 3300005578 | Ga0068854_100311268 | Ga0068854_1003112682 | 110 |
| 149 | 3300005578 | Ga0068854_100808194 | Ga0068854_1008081942 | 110 |
| 150 | 3300005578 | Ga0068854_102221752 | Ga0068854_1022217522 | 110 |
| 151 | 3300005614 | Ga0068856_100010899 | Ga0068856_1000108999 | 110 |
| 152 | 3300005614 | Ga0068856_100034245 | Ga0068856_1000342455 | 110 |
| 153 | 3300005616 | Ga0068852_100000758 | Ga0068852_10000075822 | 110 |
| 154 | 3300005616 | Ga0068852_100051241 | Ga0068852_1000512415 | 110 |
| 155 | 3300005616 | Ga0068852_100105092 | Ga0068852_1001050924 | 110 |
| 156 | 3300005616 | Ga0068852_100105713 | Ga0068852_1001057132 | 110 |
| 157 | 3300005616 | Ga0068852_100256336 | Ga0068852_1002563362 | 110 |
| 158 | 3300005616 | Ga0068852_100416092 | Ga0068852_1004160922 | 110 |
| 159 | 3300005616 | Ga0068852_100818601 | Ga0068852_1008186012 | 110 |
| 160 | 3300005616 | Ga0068852_101558697 | Ga0068852_1015586972 | 110 |
| 161 | 3300005617 | Ga0068859_100037781 | Ga0068859_1000377814 | 110 |
| 162 | 3300005617 | Ga0068859_100132339 | Ga0068859_1001323392 | 110 |
| 163 | 3300005617 | Ga0068859_101229877 | Ga0068859_1012298771 | 110 |
| 164 | 3300005618 | Ga0068864_100008944 | Ga0068864_1000089444 | 110 |
| 165 | 3300005618 | Ga0068864_100045762 | Ga0068864_1000457623 | 110 |
| 166 | 3300005618 | Ga0068864_100105839 | Ga0068864_1001058393 | 110 |
| 167 | 3300005834 | Ga0068851_10729550 | Ga0068851_107295501 | 110 |
| 168 | 3300005841 | Ga0068863_100000063 | Ga0068863_10000006355 | 110 |
| 169 | 3300005841 | Ga0068863_100060815 | Ga0068863_1000608153 | 110 |
| 170 | 3300005841 | Ga0068863_100309527 | Ga0068863_1003095272 | 110 |
| 171 | 3300005842 | Ga0068858_100004469 | Ga0068858_10000446910 | 110 |
| 172 | 3300005842 | Ga0068858_100021273 | Ga0068858_1000212738 | 110 |
| 173 | 3300005842 | Ga0068858_100028113 | Ga0068858_1000281135 | 110 |
| 174 | 3300005842 | Ga0068858_100085584 | Ga0068858_1000855843 | 110 |
| 175 | 3300005843 | Ga0068860_100000008 | Ga0068860_100000008295 | 110 |
| 176 | 3300005843 | Ga0068860_100012277 | Ga0068860_1000122774 | 110 |
| 177 | 3300005844 | Ga0068862_100114139 | Ga0068862_1001141392 | 110 |
| 178 | 3300005844 | Ga0068862_100580905 | Ga0068862_1005809052 | 110 |
| 179 | 3300005844 | Ga0068862_100794163 | Ga0068862_1007941632 | 110 |
| 180 | 3300006051 | Ga0075364_10003609 | Ga0075364_100036096 | 110 |
| 181 | 3300006051 | Ga0075364_10061160 | Ga0075364_100611602 | 110 |
| 182 | 3300006177 | Ga0075362_10000224 | Ga0075362_100002244 | 110 |
| 183 | 3300006177 | Ga0075362_10001562 | Ga0075362_100015622 | 110 |
| 184 | 3300006177 | Ga0075362_10626854 | Ga0075362_106268542 | 110 |
| 185 | 3300006178 | Ga0075367_10457094 | Ga0075367_104570942 | 110 |
| 186 | 3300006178 | Ga0075367_10745492 | Ga0075367_107454922 | 110 |
| 187 | 3300006186 | Ga0075369_10000603 | Ga0075369_100006038 | 110 |
| 188 | 3300006186 | Ga0075369_10099578 | Ga0075369_100995782 | 110 |
| 189 | 3300006195 | Ga0075366_10000165 | Ga0075366_100001659 | 110 |
| 190 | 3300006195 | Ga0075366_10024496 | Ga0075366_100244962 | 110 |
| 191 | 3300006237 | Ga0097621_101802140 | Ga0097621_1018021402 | 110 |
| 192 | 3300006353 | Ga0075370_10000055 | Ga0075370_1000005516 | 110 |
| 193 | 3300006353 | Ga0075370_10109389 | Ga0075370_101093893 | 110 |
| 194 | 3300006353 | Ga0075370_10114286 | Ga0075370_101142862 | 110 |
| 195 | 3300006353 | Ga0075370_10395206 | Ga0075370_103952062 | 110 |
| 196 | 3300006353 | Ga0075370_10958928 | Ga0075370_109589282 | 110 |
| 197 | 3300006358 | Ga0068871_101491322 | Ga0068871_1014913221 | 110 |
| 198 | 3300006881 | Ga0068865_101363913 | Ga0068865_1013639132 | 110 |
| 199 | 3300006931 | Ga0097620_100037781 | Ga0097620_1000377814 | 110 |
| 200 | 3300006931 | Ga0097620_100132345 | Ga0097620_1001323452 | 110 |
| 201 | 3300006931 | Ga0097620_101230097 | Ga0097620_1012300972 | 110 |
| 202 | 3300006946 | Ga0079104_1017488 | Ga0079104_10174883 | 110 |
| 203 | 3300006946 | Ga0079104_1042513 | Ga0079104_10425132 | 110 |
| 204 | 3300006946 | Ga0079104_1053935 | Ga0079104_10539351 | 110 |
| 205 | 3300006946 | Ga0079104_1063071 | Ga0079104_10630712 | 110 |
| 206 | 3300007076 | Ga0075435_100360923 | Ga0075435_1003609232 | 110 |
| 207 | 3300009011 | Ga0105251_10005734 | Ga0105251_100057348 | 110 |
| 208 | 3300009092 | Ga0105250_10030137 | Ga0105250_100301371 | 110 |
| 209 | 3300009093 | Ga0105240_11252464 | Ga0105240_112524642 | 110 |
| 210 | 3300009101 | Ga0105247_10435273 | Ga0105247_104352732 | 110 |
| 211 | 3300009101 | Ga0105247_10671701 | Ga0105247_106717012 | 110 |
| 212 | 3300009177 | Ga0105248_10062723 | Ga0105248_100627234 | 110 |
| 213 | 3300009177 | Ga0105248_10116332 | Ga0105248_101163322 | 110 |
| 214 | 3300009177 | Ga0105248_10119186 | Ga0105248_101191863 | 110 |
| 215 | 3300009177 | Ga0105248_10158753 | Ga0105248_101587533 | 110 |
| 216 | 3300009177 | Ga0105248_10254717 | Ga0105248_102547173 | 110 |
| 217 | 3300009177 | Ga0105248_10537137 | Ga0105248_105371372 | 110 |
| 218 | 3300009545 | Ga0105237_11308184 | Ga0105237_113081842 | 110 |
| 219 | 3300009551 | Ga0105238_10157731 | Ga0105238_101577313 | 110 |
| 220 | 3300009551 | Ga0105238_10977955 | Ga0105238_109779552 | 110 |
| 221 | 3300009553 | Ga0105249_10193944 | Ga0105249_101939441 | 110 |
| 222 | 3300009553 | Ga0105249_10922752 | Ga0105249_109227522 | 110 |
| 223 | 3300010375 | Ga0105239_10296219 | Ga0105239_102962192 | 110 |
| 224 | 3300010375 | Ga0105239_10993643 | Ga0105239_109936432 | 110 |
| 225 | 3300010375 | Ga0105239_11809824 | Ga0105239_118098242 | 110 |
| 226 | 3300013100 | Ga0157373_10082545 | Ga0157373_100825453 | 110 |
| 227 | 3300013100 | Ga0157373_10578562 | Ga0157373_105785622 | 110 |
| 228 | 3300013102 | Ga0157371_10002809 | Ga0157371_100028095 | 110 |
| 229 | 3300013102 | Ga0157371_10036220 | Ga0157371_100362202 | 110 |
| 230 | 3300013102 | Ga0157371_10153097 | Ga0157371_101530974 | 110 |
| 231 | 3300013104 | Ga0157370_10010951 | Ga0157370_100109516 | 110 |
| 232 | 3300013104 | Ga0157370_11537248 | Ga0157370_115372481 | 110 |
| 233 | 3300013104 | Ga0157370_12049128 | Ga0157370_120491281 | 110 |
| 234 | 3300013105 | Ga0157369_10031565 | Ga0157369_100315654 | 110 |
| 235 | 3300013105 | Ga0157369_10839832 | Ga0157369_108398322 | 110 |
| 236 | 3300013296 | Ga0157374_11626225 | Ga0157374_116262252 | 110 |
| 237 | 3300013306 | Ga0163162_10014475 | Ga0163162_100144758 | 110 |
| 238 | 3300013306 | Ga0163162_10167894 | Ga0163162_101678942 | 110 |
| 239 | 3300013306 | Ga0163162_10197192 | Ga0163162_101971923 | 110 |
| 240 | 3300013307 | Ga0157372_10146911 | Ga0157372_101469114 | 110 |
| 241 | 3300013307 | Ga0157372_10218382 | Ga0157372_102183823 | 110 |
| 242 | 3300013307 | Ga0157372_10277271 | Ga0157372_102772712 | 110 |
| 243 | 3300013307 | Ga0157372_10984604 | Ga0157372_109846041 | 110 |
| 244 | 3300013307 | Ga0157372_12154564 | Ga0157372_121545642 | 110 |
| 245 | 3300014326 | Ga0157380_12381425 | Ga0157380_123814251 | 110 |
| 246 | 3300025298 | Ga0209050_1001431 | Ga0209050_10014318 | 110 |
| 247 | 3300025315 | Ga0207697_10023094 | Ga0207697_100230943 | 110 |
| 248 | 3300025711 | Ga0207696_1002800 | Ga0207696_10028008 | 110 |
| 249 | 3300025903 | Ga0207680_10381077 | Ga0207680_103810772 | 110 |
| 250 | 3300025903 | Ga0207680_10422650 | Ga0207680_104226502 | 110 |
| 251 | 3300025904 | Ga0207647_10166053 | Ga0207647_101660532 | 110 |
| 252 | 3300025904 | Ga0207647_10724915 | Ga0207647_107249151 | 110 |
| 253 | 3300025909 | Ga0207705_10000004 | Ga0207705_1000000494 | 110 |
| 254 | 3300025909 | Ga0207705_10013543 | Ga0207705_100135434 | 110 |
| 255 | 3300025909 | Ga0207705_10160089 | Ga0207705_101600892 | 110 |
| 256 | 3300025909 | Ga0207705_10247778 | Ga0207705_102477782 | 110 |
| 257 | 3300025909 | Ga0207705_10252728 | Ga0207705_102527282 | 110 |
| 258 | 3300025909 | Ga0207705_10544885 | Ga0207705_105448852 | 110 |
| 259 | 3300025912 | Ga0207707_11054439 | Ga0207707_110544392 | 110 |
| 260 | 3300025913 | Ga0207695_10007818 | Ga0207695_1000781811 | 110 |
| 261 | 3300025914 | Ga0207671_11379547 | Ga0207671_113795471 | 110 |
| 262 | 3300025917 | Ga0207660_10081512 | Ga0207660_100815123 | 110 |
| 263 | 3300025919 | Ga0207657_10001019 | Ga0207657_1000101918 | 110 |
| 264 | 3300025920 | Ga0207649_10011737 | Ga0207649_100117374 | 110 |
| 265 | 3300025920 | Ga0207649_10258227 | Ga0207649_102582272 | 110 |
| 266 | 3300025920 | Ga0207649_10770472 | Ga0207649_107704721 | 110 |
| 267 | 3300025921 | Ga0207652_10003055 | Ga0207652_100030555 | 110 |
| 268 | 3300025921 | Ga0207652_10037112 | Ga0207652_100371122 | 110 |
| 269 | 3300025921 | Ga0207652_10238908 | Ga0207652_102389082 | 110 |
| 270 | 3300025921 | Ga0207652_10386966 | Ga0207652_103869662 | 110 |
| 271 | 3300025921 | Ga0207652_10524322 | Ga0207652_105243221 | 110 |
| 272 | 3300025923 | Ga0207681_10002566 | Ga0207681_100025665 | 110 |
| 273 | 3300025923 | Ga0207681_10006548 | Ga0207681_100065485 | 110 |
| 274 | 3300025923 | Ga0207681_11111162 | Ga0207681_111111622 | 110 |
| 275 | 3300025924 | Ga0207694_10137682 | Ga0207694_101376823 | 110 |
| 276 | 3300025925 | Ga0207650_10147954 | Ga0207650_101479542 | 110 |
| 277 | 3300025926 | Ga0207659_10385227 | Ga0207659_103852272 | 110 |
| 278 | 3300025929 | Ga0207664_10704950 | Ga0207664_107049502 | 110 |
| 279 | 3300025931 | Ga0207644_10000087 | Ga0207644_1000008738 | 110 |
| 280 | 3300025931 | Ga0207644_10003273 | Ga0207644_1000327312 | 110 |
| 281 | 3300025931 | Ga0207644_10021473 | Ga0207644_100214733 | 110 |
| 282 | 3300025931 | Ga0207644_10503965 | Ga0207644_105039652 | 110 |
| 283 | 3300025931 | Ga0207644_11078784 | Ga0207644_110787842 | 110 |
| 284 | 3300025932 | Ga0207690_10008564 | Ga0207690_100085642 | 110 |
| 285 | 3300025932 | Ga0207690_10504006 | Ga0207690_105040062 | 110 |
| 286 | 3300025933 | Ga0207706_10003993 | Ga0207706_100039933 | 110 |
| 287 | 3300025933 | Ga0207706_10308999 | Ga0207706_103089992 | 110 |
| 288 | 3300025941 | Ga0207711_10051707 | Ga0207711_100517073 | 110 |
| 289 | 3300025941 | Ga0207711_10127685 | Ga0207711_101276851 | 110 |
| 290 | 3300025941 | Ga0207711_10546457 | Ga0207711_105464572 | 110 |
| 291 | 3300025941 | Ga0207711_10727738 | Ga0207711_107277382 | 110 |
| 292 | 3300025941 | Ga0207711_10766123 | Ga0207711_107661231 | 110 |
| 293 | 3300025944 | Ga0207661_10180176 | Ga0207661_101801762 | 110 |
| 294 | 3300025944 | Ga0207661_11962162 | Ga0207661_119621622 | 110 |
| 295 | 3300025945 | Ga0207679_10053825 | Ga0207679_100538253 | 110 |
| 296 | 3300025945 | Ga0207679_10061000 | Ga0207679_100610003 | 110 |
| 297 | 3300025949 | Ga0207667_10005918 | Ga0207667_1000591817 | 110 |
| 298 | 3300025949 | Ga0207667_10017546 | Ga0207667_100175467 | 110 |
| 299 | 3300025949 | Ga0207667_10044625 | Ga0207667_100446255 | 110 |
| 300 | 3300025949 | Ga0207667_10056281 | Ga0207667_100562811 | 110 |
| 301 | 3300025949 | Ga0207667_10351442 | Ga0207667_103514422 | 110 |
| 302 | 3300025949 | Ga0207667_10403406 | Ga0207667_104034062 | 110 |
| 303 | 3300025949 | Ga0207667_10422971 | Ga0207667_104229711 | 110 |
| 304 | 3300025972 | Ga0207668_10016806 | Ga0207668_100168062 | 110 |
| 305 | 3300025972 | Ga0207668_10037776 | Ga0207668_100377763 | 110 |
| 306 | 3300025972 | Ga0207668_10101665 | Ga0207668_101016652 | 110 |
| 307 | 3300025972 | Ga0207668_10552993 | Ga0207668_105529932 | 110 |
| 308 | 3300025981 | Ga0207640_10000601 | Ga0207640_100006017 | 110 |
| 309 | 3300025981 | Ga0207640_10011203 | Ga0207640_100112032 | 110 |
| 310 | 3300025981 | Ga0207640_10045815 | Ga0207640_100458152 | 110 |
| 311 | 3300025981 | Ga0207640_10285345 | Ga0207640_102853452 | 110 |
| 312 | 3300025986 | Ga0207658_10001020 | Ga0207658_1000102023 | 110 |
| 313 | 3300025986 | Ga0207658_10004335 | Ga0207658_100043353 | 110 |
| 314 | 3300025986 | Ga0207658_10016803 | Ga0207658_100168034 | 110 |
| 315 | 3300025986 | Ga0207658_10136685 | Ga0207658_101366853 | 110 |
| 316 | 3300025986 | Ga0207658_10176195 | Ga0207658_101761952 | 110 |
| 317 | 3300026035 | Ga0207703_10005483 | Ga0207703_100054835 | 110 |
| 318 | 3300026035 | Ga0207703_10006539 | Ga0207703_100065395 | 110 |
| 319 | 3300026035 | Ga0207703_10069601 | Ga0207703_100696012 | 110 |
| 320 | 3300026035 | Ga0207703_10233091 | Ga0207703_102330912 | 110 |
| 321 | 3300026041 | Ga0207639_10029260 | Ga0207639_100292604 | 110 |
| 322 | 3300026041 | Ga0207639_10074689 | Ga0207639_100746892 | 110 |
| 323 | 3300026041 | Ga0207639_10335995 | Ga0207639_103359952 | 110 |
| 324 | 3300026067 | Ga0207678_10153702 | Ga0207678_101537022 | 110 |
| 325 | 3300026067 | Ga0207678_10953663 | Ga0207678_109536632 | 110 |
| 326 | 3300026078 | Ga0207702_10003311 | Ga0207702_1000331112 | 110 |
| 327 | 3300026078 | Ga0207702_10052951 | Ga0207702_100529512 | 110 |
| 328 | 3300026088 | Ga0207641_10000081 | Ga0207641_1000008174 | 110 |
| 329 | 3300026088 | Ga0207641_10048636 | Ga0207641_100486363 | 110 |
| 330 | 3300026088 | Ga0207641_10075846 | Ga0207641_100758462 | 110 |
| 331 | 3300026095 | Ga0207676_10016348 | Ga0207676_100163483 | 110 |
| 332 | 3300026095 | Ga0207676_10374769 | Ga0207676_103747691 | 110 |
| 333 | 3300026095 | Ga0207676_10562782 | Ga0207676_105627822 | 110 |
| 334 | 3300026116 | Ga0207674_10043371 | Ga0207674_100433712 | 110 |
| 335 | 3300026116 | Ga0207674_10090330 | Ga0207674_100903302 | 110 |
| 336 | 3300026116 | Ga0207674_10174678 | Ga0207674_101746783 | 110 |
| 337 | 3300026116 | Ga0207674_10385007 | Ga0207674_103850072 | 110 |
| 338 | 3300026116 | Ga0207674_10455305 | Ga0207674_104553052 | 110 |
| 339 | 3300026142 | Ga0207698_10000459 | Ga0207698_1000045924 | 110 |
| 340 | 3300026142 | Ga0207698_10051714 | Ga0207698_100517143 | 110 |
| 341 | 3300026142 | Ga0207698_10085474 | Ga0207698_100854742 | 110 |
| 342 | 3300026142 | Ga0207698_10128022 | Ga0207698_101280222 | 110 |
| 343 | 3300026142 | Ga0207698_10223869 | Ga0207698_102238692 | 110 |
| 344 | 3300026142 | Ga0207698_10533081 | Ga0207698_105330812 | 110 |
| 345 | 3300026142 | Ga0207698_10726917 | Ga0207698_107269172 | 110 |
| 346 | 3300026142 | Ga0207698_11760381 | Ga0207698_117603812 | 110 |
| 347 | 3300027111 | Ga0209281_1010906 | Ga0209281_10109062 | 110 |
| 348 | 3300027111 | Ga0209281_1033098 | Ga0209281_10330982 | 110 |
| 349 | 3300027876 | Ga0209974_10007859 | Ga0209974_100078594 | 110 |
| 350 | 3300027876 | Ga0209974_10022724 | Ga0209974_100227242 | 110 |
| 351 | 3300027907 | Ga0207428_10080863 | Ga0207428_100808632 | 110 |
| 352 | 3300028379 | Ga0268266_10008187 | Ga0268266_100081878 | 110 |
| 353 | 3300028379 | Ga0268266_10844423 | Ga0268266_108444232 | 110 |
| 354 | 3300028379 | Ga0268266_10873220 | Ga0268266_108732202 | 110 |
| 355 | 3300028380 | Ga0268265_10089395 | Ga0268265_100893953 | 110 |
| 356 | 3300028380 | Ga0268265_10430316 | Ga0268265_104303162 | 110 |
| 357 | 3300028381 | Ga0268264_10000018 | Ga0268264_10000018239 | 110 |
| 358 | 3300028381 | Ga0268264_11006057 | Ga0268264_110060572 | 110 |
| 359 | 3300031250 | Ga0265331_10022653 | Ga0265331_100226534 | 110 |
| 360 | 3300031251 | Ga0265327_10349454 | Ga0265327_103494541 | 110 |
| 361 | 3300031616 | Ga0307508_10028060 | Ga0307508_100280602 | 110 |
| 362 | 3300031731 | Ga0307405_10020044 | Ga0307405_100200444 | 110 |
| 363 | 3300031731 | Ga0307405_10915136 | Ga0307405_109151362 | 110 |
| 364 | 3300031824 | Ga0307413_10636587 | Ga0307413_106365872 | 110 |
| 365 | 3300031824 | Ga0307413_11660536 | Ga0307413_116605361 | 110 |
| 366 | 3300031824 | Ga0307413_11714780 | Ga0307413_117147802 | 110 |
| 367 | 3300031824 | Ga0307413_12160986 | Ga0307413_121609861 | 110 |
| 368 | 3300031903 | Ga0307407_10209976 | Ga0307407_102099762 | 110 |
| 369 | 3300031911 | Ga0307412_10013998 | Ga0307412_100139981 | 110 |
| 370 | 3300031995 | Ga0307409_100186857 | Ga0307409_1001868572 | 110 |
| 371 | 3300031995 | Ga0307409_101468269 | Ga0307409_1014682691 | 110 |
| 372 | 3300031995 | Ga0307409_101988086 | Ga0307409_1019880862 | 110 |
| 373 | 3300031995 | Ga0307409_102415654 | Ga0307409_1024156542 | 110 |
| 374 | 3300032002 | Ga0307416_101329263 | Ga0307416_1013292632 | 110 |
| 375 | 3300032004 | Ga0307414_10597986 | Ga0307414_105979862 | 110 |
| 376 | 3300032004 | Ga0307414_11179300 | Ga0307414_111793002 | 110 |
| 377 | 3300032005 | Ga0307411_10061273 | Ga0307411_100612732 | 110 |
| 378 | 3300032126 | Ga0307415_100131927 | Ga0307415_1001319272 | 110 |
| 379 | 3300035112 | Ga0373932_0250651 | Ga0373932_0250651_128_505 | 110 |
| 380 | 3300035114 | Ga0373939_0309411 | Ga0373939_0309411_188_565 | 110 |
| 381 | 3300035398 | Ga0316574_0652228 | Ga0316574_0652228_127_459 | 110 |
| 382 | 3300035692 | Ga0373935_0468988 | Ga0373935_0468988_39_371 | 110 |
| 383 | 3300036712 | Ga0316584_0159681 | Ga0316584_0159681_574_906 | 110 |
| 384 | 3300046453 | Ga0495627_000217 | Ga0495627_000217_36139_36471 | 110 |
| 385 | 3300046471 | Ga0495650_0000559 | Ga0495650_0000559_38199_38531 | 110 |
| 386 | 3300046475 | Ga0495639_0363466 | Ga0495639_0363466_60_392 | 110 |
| 387 | 3300046500 | Ga0495596_0000233 | Ga0495596_0000233_17712_18050 | 110 |
| 388 | 3300046500 | Ga0495596_0007814 | Ga0495596_0007814_3766_4098 | 110 |
| 389 | 3300046501 | Ga0495607_0025544 | Ga0495607_0025544_2267_2605 | 110 |
| 390 | 3300046506 | Ga0495583_0168886 | Ga0495583_0168886_449_787 | 110 |
| 391 | 3300046507 | Ga0495606_0029863 | Ga0495606_0029863_2278_2616 | 110 |
| 392 | 3300046512 | Ga0495610_0000030 | Ga0495610_0000030_131529_131861 | 110 |
| 393 | 3300046512 | Ga0495610_0000743 | Ga0495610_0000743_28037_28417 | 110 |
| 394 | 3300046515 | Ga0495620_0023302 | Ga0495620_0023302_2001_2333 | 110 |
| 395 | 3300046519 | Ga0495632_0005692 | Ga0495632_0005692_877_1209 | 110 |
| 396 | 3300046519 | Ga0495632_0061761 | Ga0495632_0061761_769_1107 | 110 |
| 397 | 3300046522 | Ga0495643_0000110 | Ga0495643_0000110_86591_86971 | 110 |
| 398 | 3300046522 | Ga0495643_0010124 | Ga0495643_0010124_3516_3854 | 110 |
| 399 | 3300046522 | Ga0495643_0016156 | Ga0495643_0016156_1037_1369 | 110 |
| 400 | 3300046522 | Ga0495643_0026681 | Ga0495643_0026681_338_676 | 110 |
| 401 | 3300046525 | Ga0495663_0321605 | Ga0495663_0321605_207_539 | 110 |
| 402 | 3300046530 | Ga0495654_0275725 | Ga0495654_0275725_333_665 | 110 |
| 403 | 3300046536 | Ga0495587_0439863 | Ga0495587_0439863_344_676 | 110 |
| 404 | 3300046616 | Ga0495668_0072941 | Ga0495668_0072941_466_798 | 110 |
| 405 | 3300046616 | Ga0495668_0073421 | Ga0495668_0073421_541_879 | 110 |
| 406 | 3300046616 | Ga0495668_0402879 | Ga0495668_0402879_27_359 | 110 |
| 407 | 3300046660 | Ga0495625_0008300 | Ga0495625_0008300_7437_7775 | 110 |
| 408 | 3300046665 | Ga0495661_0093611 | Ga0495661_0093611_888_1226 | 110 |
| 409 | 3300047470 | Ga0495681_0000011 | Ga0495681_0000011_133184_133516 | 110 |
| 410 | 3300047472 | Ga0495686_0249834 | Ga0495686_0249834_338_676 | 110 |
| 411 | 3300048090 | Ga0495615_0000025 | Ga0495615_0000025_20341_20673 | 110 |
| 412 | 3300048903 | Ga0496100_0005027 | Ga0496100_0005027_6064_6396 | 110 |
| 413 | 3300048903 | Ga0496100_0053361 | Ga0496100_0053361_2047_2379 | 110 |
| 414 | 3300048904 | Ga0496101_0052143 | Ga0496101_0052143_1862_2194 | 110 |
| 415 | 3300048904 | Ga0496101_0071618 | Ga0496101_0071618_519_851 | 110 |
| 416 | 3300048904 | Ga0496101_0437837 | Ga0496101_0437837_98_430 | 110 |
| 417 | 3300048904 | Ga0496101_0523329 | Ga0496101_0523329_497_829 | 110 |
| 418 | 3300048905 | Ga0496102_0000998 | Ga0496102_0000998_16874_17206 | 110 |
| 419 | 3300048905 | Ga0496102_0053745 | Ga0496102_0053745_3056_3388 | 110 |
| 420 | 3300048905 | Ga0496102_0848525 | Ga0496102_0848525_250_582 | 110 |
| 421 | 3300048905 | Ga0496102_1942457 | Ga0496102_1942457_134_466 | 110 |
| 422 | 3300048906 | Ga0496103_0000201 | Ga0496103_0000201_16743_17075 | 110 |
| 423 | 3300048906 | Ga0496103_0019567 | Ga0496103_0019567_108_446 | 110 |
| 424 | 3300048906 | Ga0496103_0292193 | Ga0496103_0292193_482_814 | 110 |
| 425 | 3300048907 | Ga0496104_0000078 | Ga0496104_0000078_60380_60712 | 110 |
| 426 | 3300048907 | Ga0496104_0219714 | Ga0496104_0219714_482_814 | 110 |
| 427 | 3300048908 | Ga0496105_0004202 | Ga0496105_0004202_7032_7364 | 110 |
| 428 | 3300048908 | Ga0496105_0059223 | Ga0496105_0059223_1327_1659 | 110 |
| 429 | 3300048908 | Ga0496105_0563877 | Ga0496105_0563877_270_602 | 110 |
| 430 | 3300048908 | Ga0496105_0611034 | Ga0496105_0611034_400_732 | 110 |
| 431 | 3300048909 | Ga0496106_0002700 | Ga0496106_0002700_12041_12373 | 110 |
| 432 | 3300048909 | Ga0496106_0613235 | Ga0496106_0613235_314_646 | 110 |
| 433 | 3300048910 | Ga0496107_0006277 | Ga0496107_0006277_860_1192 | 110 |
| 434 | 3300048911 | Ga0496108_0211764 | Ga0496108_0211764_1015_1347 | 110 |
| 435 | 3300048911 | Ga0496108_0261278 | Ga0496108_0261278_422_754 | 110 |
| 436 | 3300048912 | Ga0496109_0008938 | Ga0496109_0008938_6437_6769 | 110 |
| 437 | 3300048912 | Ga0496109_0034178 | Ga0496109_0034178_952_1284 | 110 |
| 438 | 3300048913 | Ga0496110_0050983 | Ga0496110_0050983_1830_2162 | 110 |
| 439 | 3300048913 | Ga0496110_0111736 | Ga0496110_0111736_933_1265 | 110 |
| 440 | 3300048914 | Ga0496111_0023891 | Ga0496111_0023891_1053_1385 | 110 |
| 441 | 3300048915 | Ga0496112_0172573 | Ga0496112_0172573_24_356 | 110 |
| 442 | 3300048915 | Ga0496112_1046145 | Ga0496112_1046145_193_525 | 110 |
| 443 | 3300048916 | Ga0496113_0003327 | Ga0496113_0003327_9013_9345 | 110 |
| 444 | 3300048916 | Ga0496113_0005353 | Ga0496113_0005353_4056_4388 | 110 |
| 445 | 3300048917 | Ga0496114_0046711 | Ga0496114_0046711_565_897 | 110 |
| 446 | 3300048917 | Ga0496114_0304975 | Ga0496114_0304975_448_780 | 110 |
| 447 | 3300048919 | Ga0496116_0000028 | Ga0496116_0000028_99791_100123 | 110 |
| 448 | 3300048919 | Ga0496116_0074998 | Ga0496116_0074998_1411_1749 | 110 |
| 449 | 3300048919 | Ga0496116_0127484 | Ga0496116_0127484_36_368 | 110 |
| 450 | 3300048919 | Ga0496116_0160607 | Ga0496116_0160607_866_1198 | 110 |
| 451 | 3300048920 | Ga0496117_0098938 | Ga0496117_0098938_637_969 | 110 |
| 452 | 3300048920 | Ga0496117_0265331 | Ga0496117_0265331_292_624 | 110 |
| 453 | 3300048921 | Ga0496118_0044905 | Ga0496118_0044905_1694_2026 | 110 |
| 454 | 3300048921 | Ga0496118_0087280 | Ga0496118_0087280_1360_1698 | 110 |
| 455 | 3300048921 | Ga0496118_0150407 | Ga0496118_0150407_1091_1423 | 110 |
| 456 | 3300048921 | Ga0496118_0436684 | Ga0496118_0436684_256_594 | 110 |
| 457 | 3300048922 | Ga0496119_0000114 | Ga0496119_0000114_60380_60712 | 110 |
| 458 | 3300048922 | Ga0496119_0391750 | Ga0496119_0391750_95_433 | 110 |
| 459 | 3300048923 | Ga0496120_0000266 | Ga0496120_0000266_38781_39113 | 110 |
| 460 | 3300048923 | Ga0496120_0106705 | Ga0496120_0106705_838_1176 | 110 |
| 461 | 3300048923 | Ga0496120_0310592 | Ga0496120_0310592_349_681 | 110 |
| 462 | 3300048924 | Ga0496121_0000021 | Ga0496121_0000021_380525_380869 | 110 |
| 463 | 3300048924 | Ga0496121_0000520 | Ga0496121_0000520_54937_55269 | 110 |
| 464 | 3300048924 | Ga0496121_0002014 | Ga0496121_0002014_27089_27427 | 110 |
| 465 | 3300048924 | Ga0496121_0010367 | Ga0496121_0010367_6166_6498 | 110 |
| 466 | 3300048924 | Ga0496121_0041974 | Ga0496121_0041974_711_1043 | 110 |
| 467 | 3300048925 | Ga0496122_0008602 | Ga0496122_0008602_7031_7363 | 110 |
| 468 | 3300048925 | Ga0496122_0012616 | Ga0496122_0012616_2473_2805 | 110 |
| 469 | 3300048925 | Ga0496122_0042142 | Ga0496122_0042142_785_1117 | 110 |
| 470 | 3300048925 | Ga0496122_0102140 | Ga0496122_0102140_197_535 | 110 |
| 471 | 3300048925 | Ga0496122_0284079 | Ga0496122_0284079_560_892 | 110 |
| 472 | 3300048925 | Ga0496122_0329468 | Ga0496122_0329468_408_740 | 110 |
| 473 | 3300048925 | Ga0496122_0578838 | Ga0496122_0578838_108_440 | 110 |
| 474 | 3300048926 | Ga0496123_0001658 | Ga0496123_0001658_29047_29379 | 110 |
| 475 | 3300048926 | Ga0496123_0001678 | Ga0496123_0001678_22037_22369 | 110 |
| 476 | 3300048926 | Ga0496123_0100614 | Ga0496123_0100614_577_915 | 110 |
| 477 | 3300048926 | Ga0496123_0147097 | Ga0496123_0147097_161_493 | 110 |
| 478 | 3300048926 | Ga0496123_0192765 | Ga0496123_0192765_161_493 | 110 |
| 479 | 3300048927 | Ga0496124_0003121 | Ga0496124_0003121_8857_9189 | 110 |
| 480 | 3300048927 | Ga0496124_0003580 | Ga0496124_0003580_15283_15615 | 110 |
| 481 | 3300048927 | Ga0496124_0004225 | Ga0496124_0004225_11749_12081 | 110 |
| 482 | 3300048927 | Ga0496124_0040943 | Ga0496124_0040943_771_1109 | 110 |
| 483 | 3300048927 | Ga0496124_0059973 | Ga0496124_0059973_1021_1353 | 110 |
| 484 | 3300048927 | Ga0496124_0213779 | Ga0496124_0213779_636_968 | 110 |
| 485 | 3300048928 | Ga0496125_0013528 | Ga0496125_0013528_1218_1556 | 110 |
| 486 | 3300048928 | Ga0496125_0022629 | Ga0496125_0022629_4390_4722 | 110 |
| 487 | 3300048928 | Ga0496125_0031114 | Ga0496125_0031114_2851_3183 | 110 |
| 488 | 3300048928 | Ga0496125_0081513 | Ga0496125_0081513_560_892 | 110 |
| 489 | 3300048928 | Ga0496125_0413899 | Ga0496125_0413899_78_410 | 110 |
| 490 | 3300048929 | Ga0496126_0000079 | Ga0496126_0000079_142696_143028 | 110 |
| 491 | 3300048929 | Ga0496126_0000173 | Ga0496126_0000173_78689_79021 | 110 |
| 492 | 3300048929 | Ga0496126_0005189 | Ga0496126_0005189_14535_14867 | 110 |
| 493 | 3300048929 | Ga0496126_0094396 | Ga0496126_0094396_136_474 | 110 |
| 494 | 3300049460 | Ga0495682_0295026 | Ga0495682_0295026_136_516 | 110 |
| 495 | 3300049568 | Ga0501031_0301097 | Ga0501031_0301097_452_784 | 110 |
| 496 | 3300049570 | Ga0501033_0330928 | Ga0501033_0330928_179_511 | 110 |
| 497 | 3300049570 | Ga0501033_0650644 | Ga0501033_0650644_185_517 | 110 |
| 498 | 3300049571 | Ga0501034_0597955 | Ga0501034_0597955_320_652 | 110 |
| 499 | 3300049572 | Ga0501036_1476949 | Ga0501036_1476949_151_483 | 110 |
| 500 | 3300049581 | Ga0501047_0388150 | Ga0501047_0388150_457_795 | 110 |
| 501 | 3300049822 | Ga0501035_0750341 | Ga0501035_0750341_258_590 | 110 |
| 502 | 3300049823 | Ga0501044_0001951 | Ga0501044_0001951_4534_4872 | 110 |
| 503 | 3300049823 | Ga0501044_0591689 | Ga0501044_0591689_41_373 | 110 |
| 504 | 3300049823 | Ga0501044_1427294 | Ga0501044_1427294_135_470 | 110 |
| 505 | 3300050489 | nmdc:mga03683_209906_c1 | nmdc:mga03683_209906_c1_86_418 | 110 |
| 506 | 3300050489 | nmdc:mga03683_906_c1 | nmdc:mga03683_906_c1_609_941 | 110 |
| 507 | 3300050490 | nmdc:mga03n38_291_c1 | nmdc:mga03n38_291_c1_11062_11439 | 110 |
| 508 | 3300050491 | nmdc:mga00v17_178182_c1 | nmdc:mga00v17_178182_c1_267_644 | 110 |
| 509 | 3300050491 | nmdc:mga00v17_18971_c1 | nmdc:mga00v17_18971_c1_3274_3606 | 110 |
| 510 | 3300050493 | nmdc:mga0k408_7997_c1 | nmdc:mga0k408_7997_c1_2705_3037 | 110 |
| 511 | 3300050493 | nmdc:mga0k408_7_c1 | nmdc:mga0k408_7_c1_37500_37877 | 110 |
| 512 | 3300050496 | nmdc:mga07m45_2156_c1 | nmdc:mga07m45_2156_c1_3148_3528 | 110 |
| 513 | 3300050496 | nmdc:mga07m45_64983_c1 | nmdc:mga07m45_64983_c1_1428_1760 | 110 |
| 514 | 3300050496 | nmdc:mga07m45_82669_c1 | nmdc:mga07m45_82669_c1_67_447 | 110 |
| 515 | 3300050496 | nmdc:mga07m45_83984_c1 | nmdc:mga07m45_83984_c1_316_648 | 110 |
| 516 | 3300050513 | nmdc:mga0rr50_399162_c1 | nmdc:mga0rr50_399162_c1_98_475 | 110 |
| 517 | 3300050516 | nmdc:mga0sz30_256747_c1 | nmdc:mga0sz30_256747_c1_284_622 | 110 |
| 518 | 3300050516 | nmdc:mga0sz30_56372_c1 | nmdc:mga0sz30_56372_c1_461_793 | 110 |
| 519 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_748733_749068 | 110 |
| 520 | 3300053087 | Ga0500643_109956 | Ga0500643_109956_220_555 | 110 |
| 521 | 3300053094 | Ga0500566_0159358 | Ga0500566_0159358_419_751 | 110 |
| 522 | 3300053108 | Ga0500562_188695 | Ga0500562_188695_150_530 | 110 |
| 523 | 3300053111 | Ga0500572_297339 | Ga0500572_297339_150_482 | 110 |
| 524 | 3300053119 | Ga0500595_018192 | Ga0500595_018192_377_757 | 110 |
| 525 | 3300053121 | Ga0500607_000354 | Ga0500607_000354_14709_15089 | 110 |
| 526 | 3300053121 | Ga0500607_004167 | Ga0500607_004167_2696_3034 | 110 |
| 527 | 3300053122 | Ga0500608_000156 | Ga0500608_000156_16191_16523 | 110 |
| 528 | 3300053123 | Ga0500614_088638 | Ga0500614_088638_80_412 | 110 |
| 529 | 3300053136 | Ga0500559_0001842 | Ga0500559_0001842_1877_2209 | 110 |
| 530 | 3300053136 | Ga0500559_0012360 | Ga0500559_0012360_3002_3334 | 110 |
| 531 | 3300053138 | Ga0500564_059241 | Ga0500564_059241_603_935 | 110 |
| 532 | 3300053139 | Ga0500568_0248485 | Ga0500568_0248485_184_564 | 110 |
| 533 | 3300053148 | Ga0500590_224027 | Ga0500590_224027_218_598 | 110 |
| 534 | 3300053151 | Ga0500604_0155323 | Ga0500604_0155323_257_592 | 110 |
| 535 | 3300053156 | Ga0500622_0000145 | Ga0500622_0000145_53423_53755 | 110 |
| 536 | 3300053178 | Ga0500637_0027500 | Ga0500637_0027500_918_1298 | 110 |
| 537 | 3300053723 | Ga0500567_004902 | Ga0500567_004902_174_506 | 110 |
| 538 | 3300053729 | Ga0500625_000021 | Ga0500625_000021_63083_63415 | 110 |
| 539 | 3300053729 | Ga0500625_258391 | Ga0500625_258391_97_477 | 110 |
| 540 | 3300053730 | Ga0500645_005657 | Ga0500645_005657_2928_3308 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nbl-assembly2.cif.gz_D | cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide | 0.9229 | 1 | 105 |
| 4ltu-assembly2.cif.gz_B | crystal structure of ferredoxin from rhodopseudomonas palustris haa2 | 0.9208 | 3 | 103 |
| 2wlb-assembly2.cif.gz_B | adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria | 0.9188 | 1 | 101 |
| 3lb8-assembly1.cif.gz_C | crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex | 0.9176 | 3 | 101 |
| 1uwm-assembly1.cif.gz_A | reduced ferredoxin 6 from rhodobacter capsulatus | 0.9168 | 2 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4I8U3_74_163_2.40.330.10 | Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain | 0.934 | 2 | 17 | 2.40.330.10 |
| af_Q9UBI4_290_397_3.30.1050.10 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.9261 | 2 | 16 | 3.30.1050.10 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9223 | 2 | 107 | 3.10.20.30 |
| af_Q9SGR4_1_83_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9212 | 3 | 15 | 3.10.20.90 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9208 | 3 | 103 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W7MGD4-F1-model_v4 | Ferredoxin, 2Fe-2S | 0.9519 | 1 | 108 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A7T8AC12-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9515 | 1 | 109 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A2A2SKV2-F1-model_v4 | 2Fe-2S ferredoxin | 0.9511 | 1 | 101 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A0Q4EDQ0-F1-model_v4 | 2Fe-2S ferredoxin | 0.9492 | 2 | 101 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A844XS28-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9485 | 2 | 108 |
GO:0009055
GO:0051537 GO:0140647 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar