F461173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 539 | 355 | 1078 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300049583|Ga0501067_0057968|Ga0501067_0057968_660_1415 |
| Length | 251 |
| Sequence | MEEPEAGHYNRLHRREPRATVAAARAGMEDDMALRIGDLAPNFDADTTEGRINFHEWLGNSWGVLFSHPKDFTPVCTTELGYMARLKPEFDKRNAKIIGLSVDAVSTHTRWSADIAETQGHQPNYPMIGDTTLAISKTWGMLPAELDGESEGRTAADNQTVRNVFVIGPDKKIKLIIVYPMTTGRNFDEVLRVLDSLQLTAAHKVSTPVNWEPGEDVIIAGSVSDDDARKLYPDGWRAPRPYLRWVSQPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 39 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300023224 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 | Metagenome | Unclassified |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 153 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 164 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 181 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 182 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 247 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 248 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 249 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 270 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 293 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 297 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 299 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 301 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 306 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 307 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 308 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 309 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 310 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 311 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 312 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 313 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 314 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 315 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 316 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 317 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 318 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 319 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 320 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 321 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 322 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 323 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 324 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 325 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 326 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 327 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 328 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 329 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 330 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 331 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 332 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 333 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 334 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 335 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 336 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 337 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 338 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 339 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 340 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 341 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 342 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 343 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 344 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 345 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 346 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 347 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 348 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 349 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 350 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 351 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 352 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 353 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 354 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 355 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.68 |
| Metatranscriptomes | 1.86 |
| Isolates | 9.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.27 |
| Nodule | 7.98 |
| Rhizoplane | 2.41 |
| Rhizosphere | 80.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501067_0057968 | 3300049583 | Bacteria | 2145 |
| 2 | SwRhRL2b_contig_3027696 | 2162886007 | Bacteria | 1029 |
| 3 | ARSoilOldRDRAFT_c007576 | 3300000044 | Bacteria | 904 |
| 4 | Ga0055531_10035663 | 3300003794 | Bacteria | 1552 |
| 5 | Ga0065704_10086191 | 3300005289 | Bacteria | 3145 |
| 6 | Ga0065715_10296567 | 3300005293 | Bacteria | 1051 |
| 7 | Ga0065715_10511823 | 3300005293 | Bacteria | 771 |
| 8 | Ga0065707_10084658 | 3300005295 | Bacteria | 6920 |
| 9 | Ga0070676_10037224 | 3300005328 | Bacteria | 2806 |
| 10 | Ga0070676_10083344 | 3300005328 | Bacteria | 1944 |
| 11 | Ga0070676_10146340 | 3300005328 | Bacteria | 1508 |
| 12 | Ga0070683_100005544 | 3300005329 | Bacteria | 10545 |
| 13 | Ga0070690_100008489 | 3300005330 | Bacteria | 5920 |
| 14 | Ga0070670_100180682 | 3300005331 | Bacteria | 1832 |
| 15 | Ga0070680_100006524 | 3300005336 | Bacteria | 8871 |
| 16 | Ga0070660_100087218 | 3300005339 | Bacteria | 2456 |
| 17 | Ga0070689_100043361 | 3300005340 | Bacteria | 3457 |
| 18 | Ga0070689_100219850 | 3300005340 | Bacteria | 1558 |
| 19 | Ga0070668_100430762 | 3300005347 | Bacteria | 1131 |
| 20 | Ga0070669_100017031 | 3300005353 | Bacteria | 5187 |
| 21 | Ga0070675_100992618 | 3300005354 | Bacteria | 771 |
| 22 | Ga0070673_100003169 | 3300005364 | Bacteria | 10188 |
| 23 | Ga0070673_100048697 | 3300005364 | Bacteria | 3306 |
| 24 | Ga0070688_100079679 | 3300005365 | Bacteria | 2117 |
| 25 | Ga0070688_100099951 | 3300005365 | Bacteria | 1911 |
| 26 | Ga0070667_100273321 | 3300005367 | Bacteria | 1516 |
| 27 | Ga0070701_10352428 | 3300005438 | Bacteria | 920 |
| 28 | Ga0070700_100003434 | 3300005441 | Bacteria | 8168 |
| 29 | Ga0070678_100425972 | 3300005456 | Bacteria | 1158 |
| 30 | Ga0070678_100470656 | 3300005456 | Bacteria | 1104 |
| 31 | Ga0070678_100799007 | 3300005456 | Bacteria | 857 |
| 32 | Ga0068867_100006142 | 3300005459 | Bacteria | 8503 |
| 33 | Ga0070685_10187834 | 3300005466 | Bacteria | 1335 |
| 34 | Ga0070685_10197049 | 3300005466 | Bacteria | 1307 |
| 35 | Ga0070707_100027692 | 3300005468 | Bacteria | 5391 |
| 36 | Ga0070698_100257890 | 3300005471 | Bacteria | 1676 |
| 37 | Ga0070684_100005771 | 3300005535 | Bacteria | 9518 |
| 38 | Ga0070672_100012367 | 3300005543 | Bacteria | 5989 |
| 39 | Ga0070672_100060614 | 3300005543 | Bacteria | 2980 |
| 40 | Ga0070672_100131317 | 3300005543 | Bacteria | 2059 |
| 41 | Ga0070686_100004024 | 3300005544 | Bacteria | 8078 |
| 42 | Ga0070686_100048836 | 3300005544 | Bacteria | 2682 |
| 43 | Ga0070665_100048184 | 3300005548 | Bacteria | 4279 |
| 44 | Ga0068859_101416007 | 3300005617 | Bacteria | 767 |
| 45 | Ga0068864_100000257 | 3300005618 | Bacteria | 47415 |
| 46 | Ga0068864_100692859 | 3300005618 | Bacteria | 995 |
| 47 | Ga0068861_100068818 | 3300005719 | Bacteria | 2737 |
| 48 | Ga0068861_100252018 | 3300005719 | Bacteria | 1507 |
| 49 | Ga0068863_100000167 | 3300005841 | Bacteria | 70943 |
| 50 | Ga0068863_100032385 | 3300005841 | Bacteria | 4983 |
| 51 | Ga0068863_100234986 | 3300005841 | Bacteria | 1769 |
| 52 | Ga0068863_100459293 | 3300005841 | Bacteria | 1250 |
| 53 | Ga0068858_100000198 | 3300005842 | Bacteria | 64645 |
| 54 | Ga0068858_100178942 | 3300005842 | Bacteria | 2002 |
| 55 | Ga0068862_100056629 | 3300005844 | Bacteria | 3359 |
| 56 | Ga0068862_100083341 | 3300005844 | Bacteria | 2776 |
| 57 | Ga0075365_10378596 | 3300006038 | Bacteria | 998 |
| 58 | Ga0075367_10055195 | 3300006178 | Bacteria | 2357 |
| 59 | Ga0075369_10031229 | 3300006186 | Bacteria | 2246 |
| 60 | Ga0097621_100921476 | 3300006237 | Bacteria | 815 |
| 61 | Ga0068871_100305711 | 3300006358 | Bacteria | 1397 |
| 62 | Ga0075433_10000725 | 3300006852 | Bacteria | 22569 |
| 63 | Ga0075433_10058484 | 3300006852 | Bacteria | 3372 |
| 64 | Ga0075433_10283071 | 3300006852 | Bacteria | 1469 |
| 65 | Ga0075434_100000689 | 3300006871 | Bacteria | 26347 |
| 66 | Ga0075434_100247287 | 3300006871 | Bacteria | 1803 |
| 67 | Ga0075429_100042731 | 3300006880 | Bacteria | 3944 |
| 68 | Ga0068865_100013996 | 3300006881 | Bacteria | 5090 |
| 69 | Ga0068865_100022507 | 3300006881 | Bacteria | 4113 |
| 70 | Ga0075435_100015826 | 3300007076 | Bacteria | 5677 |
| 71 | Ga0105250_10030101 | 3300009092 | Bacteria | 2183 |
| 72 | Ga0111539_10007988 | 3300009094 | Bacteria | 13496 |
| 73 | Ga0111539_10014458 | 3300009094 | Bacteria | 9850 |
| 74 | Ga0111539_10088766 | 3300009094 | Bacteria | 3633 |
| 75 | Ga0105245_10199742 | 3300009098 | Bacteria | 1920 |
| 76 | Ga0105245_10291083 | 3300009098 | Bacteria | 1600 |
| 77 | Ga0105247_10021077 | 3300009101 | Bacteria | 3921 |
| 78 | Ga0114129_10058155 | 3300009147 | Bacteria | 5408 |
| 79 | Ga0114129_10060064 | 3300009147 | Bacteria | 5315 |
| 80 | Ga0114129_10267221 | 3300009147 | Bacteria | 2290 |
| 81 | Ga0105243_10656531 | 3300009148 | Bacteria | 1017 |
| 82 | Ga0105242_10109055 | 3300009176 | Bacteria | 2357 |
| 83 | Ga0105248_10028948 | 3300009177 | Bacteria | 6175 |
| 84 | Ga0105248_10060890 | 3300009177 | Bacteria | 4238 |
| 85 | Ga0105248_10095065 | 3300009177 | Bacteria | 3355 |
| 86 | Ga0105248_10370243 | 3300009177 | Bacteria | 1613 |
| 87 | Ga0105249_10883877 | 3300009553 | Bacteria | 960 |
| 88 | Ga0099796_10087031 | 3300010159 | Bacteria | 1156 |
| 89 | Ga0105246_10206511 | 3300011119 | Bacteria | 1531 |
| 90 | Ga0157370_10592472 | 3300013104 | Bacteria | 1015 |
| 91 | Ga0163162_10705124 | 3300013306 | Bacteria | 1131 |
| 92 | Ga0157375_10155826 | 3300013308 | Bacteria | 2423 |
| 93 | Ga0163163_10145264 | 3300014325 | Bacteria | 2415 |
| 94 | Ga0157379_10108635 | 3300014968 | Bacteria | 2491 |
| 95 | Ga0197907_10788113 | 3300020069 | Bacteria | 858 |
| 96 | Ga0206356_10130870 | 3300020070 | Bacteria | 1103 |
| 97 | Ga0206352_10233446 | 3300020078 | Bacteria | 809 |
| 98 | Ga0206354_10262680 | 3300020081 | Bacteria | 791 |
| 99 | Ga0213872_10072545 | 3300021361 | Bacteria | 1551 |
| 100 | Ga0213876_10068841 | 3300021384 | Bacteria | 1870 |
| 101 | Ga0213876_10167594 | 3300021384 | Bacteria | 1168 |
| 102 | Ga0224712_10018533 | 3300022467 | Bacteria | 2329 |
| 103 | Ga0224712_10022857 | 3300022467 | Bacteria | 2162 |
| 104 | Ga0224712_10198587 | 3300022467 | Bacteria | 911 |
| 105 | Ga0224712_10336616 | 3300022467 | Bacteria | 711 |
| 106 | Ga0224575_102412 | 3300023224 | Bacteria | 1001 |
| 107 | Ga0209233_1001055 | 3300025261 | Bacteria | 11511 |
| 108 | Ga0207666_1006686 | 3300025271 | Bacteria | 1501 |
| 109 | Ga0209455_1004293 | 3300025272 | Bacteria | 4722 |
| 110 | Ga0209455_1015601 | 3300025272 | Bacteria | 1663 |
| 111 | Ga0209257_1001043 | 3300025304 | Bacteria | 36902 |
| 112 | Ga0207697_10032021 | 3300025315 | Bacteria | 2152 |
| 113 | Ga0207656_10045602 | 3300025321 | Bacteria | 1877 |
| 114 | Ga0207696_1021133 | 3300025711 | Bacteria | 2087 |
| 115 | Ga0207692_10150720 | 3300025898 | Bacteria | 1332 |
| 116 | Ga0207642_10056528 | 3300025899 | Bacteria | 1800 |
| 117 | Ga0207642_10459194 | 3300025899 | Bacteria | 773 |
| 118 | Ga0207710_10042830 | 3300025900 | Bacteria | 2012 |
| 119 | Ga0207710_10072427 | 3300025900 | Bacteria | 1582 |
| 120 | Ga0207688_10185189 | 3300025901 | Bacteria | 1243 |
| 121 | Ga0207685_10102394 | 3300025905 | Bacteria | 1227 |
| 122 | Ga0207699_10240339 | 3300025906 | Bacteria | 1244 |
| 123 | Ga0207645_10010682 | 3300025907 | Bacteria | 6297 |
| 124 | Ga0207643_10035885 | 3300025908 | Bacteria | 2781 |
| 125 | Ga0207705_10017885 | 3300025909 | Bacteria | 5070 |
| 126 | Ga0207684_10006702 | 3300025910 | Bacteria | 10461 |
| 127 | Ga0207654_10046859 | 3300025911 | Bacteria | 2467 |
| 128 | Ga0207707_10001819 | 3300025912 | Bacteria | 19559 |
| 129 | Ga0207707_10015670 | 3300025912 | Bacteria | 6603 |
| 130 | Ga0207707_10031473 | 3300025912 | Bacteria | 4642 |
| 131 | Ga0207695_10013123 | 3300025913 | Bacteria | 9890 |
| 132 | Ga0207695_10062858 | 3300025913 | Bacteria | 3830 |
| 133 | Ga0207671_10020984 | 3300025914 | Bacteria | 4965 |
| 134 | Ga0207671_10291550 | 3300025914 | Bacteria | 1288 |
| 135 | Ga0207663_10223902 | 3300025916 | Bacteria | 1370 |
| 136 | Ga0207660_10043186 | 3300025917 | Bacteria | 3167 |
| 137 | Ga0207660_10066655 | 3300025917 | Bacteria | 2605 |
| 138 | Ga0207662_10049253 | 3300025918 | Bacteria | 2499 |
| 139 | Ga0207657_10003059 | 3300025919 | Bacteria | 17896 |
| 140 | Ga0207649_10129108 | 3300025920 | Bacteria | 1714 |
| 141 | Ga0207652_10008071 | 3300025921 | Bacteria | 8450 |
| 142 | Ga0207652_10022569 | 3300025921 | Bacteria | 5207 |
| 143 | Ga0207652_10058830 | 3300025921 | Bacteria | 3311 |
| 144 | Ga0207681_10013903 | 3300025923 | Bacteria | 4987 |
| 145 | Ga0207694_10073184 | 3300025924 | Bacteria | 2680 |
| 146 | Ga0207650_10025727 | 3300025925 | Bacteria | 4194 |
| 147 | Ga0207650_10192786 | 3300025925 | Bacteria | 1629 |
| 148 | Ga0207650_10789702 | 3300025925 | Bacteria | 804 |
| 149 | Ga0207700_10036760 | 3300025928 | Bacteria | 3540 |
| 150 | Ga0207700_10351071 | 3300025928 | Bacteria | 1284 |
| 151 | Ga0207664_10126867 | 3300025929 | Bacteria | 2143 |
| 152 | Ga0207664_10513682 | 3300025929 | Bacteria | 1073 |
| 153 | Ga0207664_10767281 | 3300025929 | Bacteria | 867 |
| 154 | Ga0207706_10500047 | 3300025933 | Bacteria | 1049 |
| 155 | Ga0207686_10069925 | 3300025934 | Bacteria | 2253 |
| 156 | Ga0207670_10010889 | 3300025936 | Bacteria | 5252 |
| 157 | Ga0207670_10020274 | 3300025936 | Bacteria | 4082 |
| 158 | Ga0207670_10049296 | 3300025936 | Bacteria | 2816 |
| 159 | Ga0207704_10009129 | 3300025938 | Bacteria | 4771 |
| 160 | Ga0207704_10089215 | 3300025938 | Bacteria | 2020 |
| 161 | Ga0207691_10006506 | 3300025940 | Bacteria | 11279 |
| 162 | Ga0207691_10109438 | 3300025940 | Bacteria | 2458 |
| 163 | Ga0207711_10015029 | 3300025941 | Bacteria | 6429 |
| 164 | Ga0207711_10128848 | 3300025941 | Bacteria | 2266 |
| 165 | Ga0207711_10156295 | 3300025941 | Bacteria | 2061 |
| 166 | Ga0207661_10001745 | 3300025944 | Bacteria | 14884 |
| 167 | Ga0207661_10099554 | 3300025944 | Bacteria | 2438 |
| 168 | Ga0207661_10143353 | 3300025944 | Bacteria | 2058 |
| 169 | Ga0207661_10266814 | 3300025944 | Bacteria | 1526 |
| 170 | Ga0207679_10409428 | 3300025945 | Bacteria | 1194 |
| 171 | Ga0207667_10009250 | 3300025949 | Bacteria | 11634 |
| 172 | Ga0207667_10395359 | 3300025949 | Bacteria | 1407 |
| 173 | Ga0207651_10007851 | 3300025960 | Bacteria | 5713 |
| 174 | Ga0207651_10019348 | 3300025960 | Bacteria | 4077 |
| 175 | Ga0207712_10193555 | 3300025961 | Bacteria | 1607 |
| 176 | Ga0207668_10387915 | 3300025972 | Bacteria | 1177 |
| 177 | Ga0207668_10444128 | 3300025972 | Bacteria | 1105 |
| 178 | Ga0207658_10594930 | 3300025986 | Bacteria | 993 |
| 179 | Ga0207658_10689479 | 3300025986 | Bacteria | 923 |
| 180 | Ga0207703_10000189 | 3300026035 | Bacteria | 72189 |
| 181 | Ga0207703_10059363 | 3300026035 | Bacteria | 3124 |
| 182 | Ga0207639_10030751 | 3300026041 | Bacteria | 3940 |
| 183 | Ga0207708_10009523 | 3300026075 | Bacteria | 7201 |
| 184 | Ga0207702_10017745 | 3300026078 | Bacteria | 5891 |
| 185 | Ga0207702_10195553 | 3300026078 | Bacteria | 1872 |
| 186 | Ga0207702_10727413 | 3300026078 | Bacteria | 979 |
| 187 | Ga0207641_10000120 | 3300026088 | Bacteria | 116070 |
| 188 | Ga0207641_10041258 | 3300026088 | Bacteria | 3867 |
| 189 | Ga0207648_10036082 | 3300026089 | Bacteria | 4355 |
| 190 | Ga0207648_10286881 | 3300026089 | Bacteria | 1473 |
| 191 | Ga0207676_10000091 | 3300026095 | Bacteria | 82019 |
| 192 | Ga0207674_10007968 | 3300026116 | Bacteria | 12293 |
| 193 | Ga0207674_10092227 | 3300026116 | Bacteria | 3018 |
| 194 | Ga0207675_100116435 | 3300026118 | Bacteria | 2525 |
| 195 | Ga0207683_10245039 | 3300026121 | Bacteria | 1635 |
| 196 | Ga0207683_10495199 | 3300026121 | Bacteria | 1128 |
| 197 | Ga0207683_10816802 | 3300026121 | Bacteria | 865 |
| 198 | Ga0207698_10335398 | 3300026142 | Bacteria | 1422 |
| 199 | Ga0207428_10004590 | 3300027907 | Bacteria | 13090 |
| 200 | Ga0207428_10161512 | 3300027907 | Bacteria | 1701 |
| 201 | Ga0268266_10044734 | 3300028379 | Bacteria | 3785 |
| 202 | Ga0268265_10478826 | 3300028380 | Bacteria | 1168 |
| 203 | Ga0268265_11210720 | 3300028380 | Bacteria | 753 |
| 204 | Ga0268264_10515913 | 3300028381 | Bacteria | 1168 |
| 205 | Ga0265337_1009221 | 3300028556 | Bacteria | 3537 |
| 206 | Ga0265334_10009110 | 3300028573 | Bacteria | 4208 |
| 207 | Ga0265318_10032293 | 3300028577 | Bacteria | 2026 |
| 208 | Ga0265323_10017191 | 3300028653 | Bacteria | 2812 |
| 209 | Ga0265322_10048523 | 3300028654 | Bacteria | 1206 |
| 210 | Ga0265336_10000322 | 3300028666 | Bacteria | 32476 |
| 211 | Ga0265338_10001338 | 3300028800 | Bacteria | 40180 |
| 212 | Ga0265330_10026407 | 3300031235 | Bacteria | 2627 |
| 213 | Ga0265328_10094267 | 3300031239 | Bacteria | 1107 |
| 214 | Ga0265325_10021822 | 3300031241 | Bacteria | 3512 |
| 215 | Ga0265340_10002383 | 3300031247 | Bacteria | 10694 |
| 216 | Ga0265339_10008271 | 3300031249 | Bacteria | 6628 |
| 217 | Ga0265339_10161534 | 3300031249 | Bacteria | 1127 |
| 218 | Ga0265331_10000920 | 3300031250 | Bacteria | 23547 |
| 219 | Ga0265327_10002385 | 3300031251 | Bacteria | 19950 |
| 220 | Ga0307509_10172017 | 3300031507 | Bacteria | 2043 |
| 221 | Ga0265314_10023499 | 3300031711 | Bacteria | 4698 |
| 222 | Ga0265314_10262150 | 3300031711 | Bacteria | 986 |
| 223 | Ga0265342_10019156 | 3300031712 | Bacteria | 4415 |
| 224 | Ga0307516_10018528 | 3300031730 | Bacteria | 7230 |
| 225 | Ga0307410_10530413 | 3300031852 | Bacteria | 973 |
| 226 | Ga0307416_100138797 | 3300032002 | Bacteria | 2205 |
| 227 | Ga0307507_10024361 | 3300033179 | Bacteria | 6600 |
| 228 | Ga0307510_10022118 | 3300033180 | Bacteria | 7391 |
| 229 | Ga0373926_0033409 | 3300035083 | Bacteria | 1818 |
| 230 | Ga0373934_0002672 | 3300035086 | Bacteria | 6553 |
| 231 | Ga0373944_0024889 | 3300035089 | Bacteria | 1759 |
| 232 | Ga0373923_0000076 | 3300035111 | Bacteria | 16201 |
| 233 | Ga0373923_0008861 | 3300035111 | Bacteria | 3609 |
| 234 | Ga0373936_0014534 | 3300035113 | Bacteria | 3012 |
| 235 | Ga0373936_0085862 | 3300035113 | Bacteria | 1314 |
| 236 | Ga0373945_0024711 | 3300035116 | Bacteria | 2084 |
| 237 | Ga0373953_0006184 | 3300035117 | Bacteria | 3934 |
| 238 | Ga0373953_0008940 | 3300035117 | Bacteria | 3422 |
| 239 | Ga0373954_0008912 | 3300035118 | Bacteria | 4414 |
| 240 | Ga0373954_0015738 | 3300035118 | Bacteria | 3383 |
| 241 | Ga0373954_0056865 | 3300035118 | Bacteria | 1842 |
| 242 | Ga0373956_0001935 | 3300035119 | Bacteria | 8560 |
| 243 | Ga0373957_0000856 | 3300035120 | Bacteria | 7964 |
| 244 | Ga0373957_0027322 | 3300035120 | Bacteria | 2073 |
| 245 | Ga0373943_0006359 | 3300035170 | Bacteria | 5308 |
| 246 | Ga0373943_0051402 | 3300035170 | Bacteria | 2029 |
| 247 | Ga0373943_0070389 | 3300035170 | Bacteria | 1770 |
| 248 | Ga0373943_0266900 | 3300035170 | Bacteria | 965 |
| 249 | Ga0373946_0001307 | 3300035171 | Bacteria | 8617 |
| 250 | Ga0373946_0012726 | 3300035171 | Bacteria | 3153 |
| 251 | Ga0373955_0000624 | 3300035172 | Bacteria | 15179 |
| 252 | Ga0373955_0034217 | 3300035172 | Bacteria | 2681 |
| 253 | Ga0373955_0069060 | 3300035172 | Bacteria | 1971 |
| 254 | Ga0373935_0000844 | 3300035692 | Bacteria | 16529 |
| 255 | Ga0373935_0050408 | 3300035692 | Bacteria | 2642 |
| 256 | Ga0373935_0106140 | 3300035692 | Bacteria | 1858 |
| 257 | Ga0373927_0000739 | 3300035695 | Bacteria | 24968 |
| 258 | Ga0373933_0022629 | 3300035724 | Bacteria | 3581 |
| 259 | Ga0373933_0030207 | 3300035724 | Bacteria | 3137 |
| 260 | Ga0373947_0014045 | 3300035725 | Bacteria | 4591 |
| 261 | Ga0373937_0021719 | 3300036401 | Bacteria | 5762 |
| 262 | Ga0373937_0069526 | 3300036401 | Bacteria | 3246 |
| 263 | Ga0373937_0074374 | 3300036401 | Bacteria | 3135 |
| 264 | Ga0373937_0142574 | 3300036401 | Bacteria | 2242 |
| 265 | Ga0373937_0362143 | 3300036401 | Bacteria | 1374 |
| 266 | Ga0373925_0006376 | 3300037068 | Bacteria | 8684 |
| 267 | Ga0373925_0017137 | 3300037068 | Bacteria | 5244 |
| 268 | Ga0373925_0025341 | 3300037068 | Bacteria | 4333 |
| 269 | Ga0373925_0030209 | 3300037068 | Bacteria | 3977 |
| 270 | Ga0395900_0007362 | 3300037418 | Bacteria | 11379 |
| 271 | Ga0395900_0151197 | 3300037418 | Bacteria | 2371 |
| 272 | Ga0395898_0022653 | 3300037466 | Bacteria | 6359 |
| 273 | Ga0395898_0034825 | 3300037466 | Bacteria | 5012 |
| 274 | Ga0395898_0227441 | 3300037466 | Bacteria | 1779 |
| 275 | Ga0395905_0027263 | 3300037471 | Bacteria | 5387 |
| 276 | Ga0436364_1466965 | 3300037853 | Bacteria | 1776 |
| 277 | Ga0395901_0688873 | 3300038443 | Bacteria | 1021 |
| 278 | Ga0436365_0731914 | 3300039437 | Bacteria | 1436 |
| 279 | Ga0436365_0838254 | 3300039437 | Bacteria | 3666 |
| 280 | Ga0436365_0953587 | 3300039437 | Bacteria | 2130 |
| 281 | Ga0436365_1584923 | 3300039437 | Bacteria | 4759 |
| 282 | Ga0436360_0178180 | 3300039438 | Bacteria | 1356 |
| 283 | Ga0436360_0987496 | 3300039438 | Bacteria | 994 |
| 284 | Ga0436363_1200853 | 3300039450 | Bacteria | 2710 |
| 285 | Ga0439439_0093279 | 3300041406 | Bacteria | 824 |
| 286 | Ga0450910_008019 | 3300042147 | Bacteria | 1481 |
| 287 | Ga0466966_0000112 | 3300044684 | Bacteria | 50307 |
| 288 | Ga0466971_0232943 | 3300044719 | Bacteria | 875 |
| 289 | Ga0466970_0331301 | 3300044765 | Bacteria | 862 |
| 290 | Ga0466959_0016459 | 3300045049 | Bacteria | 5404 |
| 291 | Ga0466959_0083672 | 3300045049 | Bacteria | 2297 |
| 292 | Ga0451576_0665015 | 3300045051 | Bacteria | 1094 |
| 293 | Ga0495592_0001191 | 3300046454 | Bacteria | 18057 |
| 294 | Ga0495603_0001448 | 3300046455 | Bacteria | 13810 |
| 295 | Ga0495603_0043666 | 3300046455 | Bacteria | 2676 |
| 296 | Ga0495603_0162462 | 3300046455 | Bacteria | 1295 |
| 297 | Ga0495629_0000117 | 3300046459 | Bacteria | 70838 |
| 298 | Ga0495629_0000450 | 3300046459 | Bacteria | 34200 |
| 299 | Ga0495629_0000930 | 3300046459 | Bacteria | 23556 |
| 300 | Ga0495629_0097674 | 3300046459 | Bacteria | 2049 |
| 301 | Ga0495641_0008537 | 3300046461 | Bacteria | 6228 |
| 302 | Ga0495641_0112829 | 3300046461 | Bacteria | 1212 |
| 303 | Ga0495651_0019753 | 3300046462 | Bacteria | 5223 |
| 304 | Ga0495653_0001141 | 3300046463 | Bacteria | 20414 |
| 305 | Ga0495653_0499697 | 3300046463 | Bacteria | 758 |
| 306 | Ga0495580_0004634 | 3300046472 | Bacteria | 11548 |
| 307 | Ga0495582_0000648 | 3300046473 | Bacteria | 19122 |
| 308 | Ga0495582_0015323 | 3300046473 | Bacteria | 4213 |
| 309 | Ga0495639_0000163 | 3300046475 | Bacteria | 34576 |
| 310 | Ga0495639_0015817 | 3300046475 | Bacteria | 3272 |
| 311 | Ga0495639_0029935 | 3300046475 | Bacteria | 2418 |
| 312 | Ga0495662_0000078 | 3300046476 | Bacteria | 34824 |
| 313 | Ga0495662_0021140 | 3300046476 | Bacteria | 3147 |
| 314 | Ga0495664_0007901 | 3300046477 | Bacteria | 5920 |
| 315 | Ga0495664_0035573 | 3300046477 | Bacteria | 2933 |
| 316 | Ga0495594_0003919 | 3300046499 | Bacteria | 7653 |
| 317 | Ga0495594_0004823 | 3300046499 | Bacteria | 6948 |
| 318 | Ga0495608_0000519 | 3300046511 | Bacteria | 26476 |
| 319 | Ga0495618_0095979 | 3300046514 | Bacteria | 1896 |
| 320 | Ga0495628_0008002 | 3300046516 | Bacteria | 9110 |
| 321 | Ga0495628_0074022 | 3300046516 | Bacteria | 2654 |
| 322 | Ga0495628_0260620 | 3300046516 | Bacteria | 1292 |
| 323 | Ga0495628_0431288 | 3300046516 | Bacteria | 959 |
| 324 | Ga0495630_0068652 | 3300046517 | Bacteria | 2666 |
| 325 | Ga0495630_0195182 | 3300046517 | Bacteria | 1545 |
| 326 | Ga0495666_0003344 | 3300046526 | Bacteria | 8102 |
| 327 | Ga0495652_0013345 | 3300046529 | Bacteria | 7393 |
| 328 | Ga0495652_0290622 | 3300046529 | Bacteria | 1193 |
| 329 | Ga0495665_0000296 | 3300046531 | Bacteria | 25045 |
| 330 | Ga0495640_0028307 | 3300046533 | Bacteria | 4036 |
| 331 | Ga0495640_0031656 | 3300046533 | Bacteria | 3773 |
| 332 | Ga0495640_0042916 | 3300046533 | Bacteria | 3152 |
| 333 | Ga0495640_0070231 | 3300046533 | Bacteria | 2354 |
| 334 | Ga0495586_0015475 | 3300046535 | Bacteria | 4058 |
| 335 | Ga0495586_0151474 | 3300046535 | Bacteria | 1305 |
| 336 | Ga0495587_0004141 | 3300046536 | Bacteria | 9593 |
| 337 | Ga0495645_0010029 | 3300046543 | Bacteria | 6634 |
| 338 | Ga0495622_0002444 | 3300046557 | Bacteria | 9006 |
| 339 | Ga0495667_0000128 | 3300046559 | Bacteria | 54804 |
| 340 | Ga0495667_0236600 | 3300046559 | Bacteria | 1164 |
| 341 | Ga0495667_0248013 | 3300046559 | Bacteria | 1133 |
| 342 | Ga0495634_0000996 | 3300046642 | Bacteria | 26710 |
| 343 | Ga0495634_0011171 | 3300046642 | Bacteria | 6550 |
| 344 | Ga0495634_0046870 | 3300046642 | Bacteria | 2915 |
| 345 | Ga0495635_0000232 | 3300046663 | Bacteria | 35357 |
| 346 | Ga0495635_0000514 | 3300046663 | Bacteria | 24491 |
| 347 | Ga0495635_0000997 | 3300046663 | Bacteria | 18689 |
| 348 | Ga0495657_0005432 | 3300046675 | Bacteria | 10090 |
| 349 | Ga0495657_0263560 | 3300046675 | Bacteria | 1035 |
| 350 | Ga0495599_0006443 | 3300046678 | Bacteria | 7080 |
| 351 | Ga0495623_0048122 | 3300046679 | Bacteria | 2705 |
| 352 | Ga0495646_0001526 | 3300046680 | Bacteria | 13800 |
| 353 | Ga0495646_0064984 | 3300046680 | Bacteria | 2161 |
| 354 | Ga0495647_0000732 | 3300046681 | Bacteria | 9712 |
| 355 | Ga0495647_0005822 | 3300046681 | Bacteria | 4055 |
| 356 | Ga0495647_0018515 | 3300046681 | Bacteria | 2481 |
| 357 | Ga0495658_0000349 | 3300046683 | Bacteria | 25998 |
| 358 | Ga0495613_0001521 | 3300046689 | Bacteria | 17651 |
| 359 | Ga0495613_0025346 | 3300046689 | Bacteria | 4419 |
| 360 | Ga0495624_0002980 | 3300046690 | Bacteria | 12661 |
| 361 | Ga0495624_0100812 | 3300046690 | Bacteria | 1778 |
| 362 | Ga0495600_0002638 | 3300046809 | Bacteria | 10351 |
| 363 | Ga0495600_0143544 | 3300046809 | Bacteria | 1548 |
| 364 | Ga0495600_0166282 | 3300046809 | Bacteria | 1425 |
| 365 | Ga0495581_0000222 | 3300047315 | Bacteria | 26831 |
| 366 | Ga0495581_0000650 | 3300047315 | Bacteria | 18214 |
| 367 | Ga0495581_0069663 | 3300047315 | Bacteria | 2034 |
| 368 | Ga0495604_0006026 | 3300047317 | Bacteria | 9620 |
| 369 | Ga0495674_0000709 | 3300047319 | Bacteria | 31521 |
| 370 | Ga0495674_0001713 | 3300047319 | Bacteria | 21564 |
| 371 | Ga0495674_0008861 | 3300047319 | Bacteria | 9572 |
| 372 | Ga0495674_0171560 | 3300047319 | Bacteria | 1810 |
| 373 | Ga0495680_0000314 | 3300047322 | Bacteria | 54452 |
| 374 | Ga0495680_0022308 | 3300047322 | Bacteria | 5279 |
| 375 | Ga0495675_0003282 | 3300047444 | Bacteria | 9723 |
| 376 | Ga0495675_0239817 | 3300047444 | Bacteria | 1092 |
| 377 | Ga0495684_0001551 | 3300047471 | Bacteria | 18398 |
| 378 | Ga0495684_0113030 | 3300047471 | Bacteria | 2047 |
| 379 | Ga0495593_0000476 | 3300047673 | Bacteria | 22569 |
| 380 | Ga0495593_0001148 | 3300047673 | Bacteria | 15449 |
| 381 | Ga0495593_0084143 | 3300047673 | Bacteria | 1642 |
| 382 | Ga0495602_0053304 | 3300048088 | Bacteria | 3583 |
| 383 | Ga0495614_0133702 | 3300048089 | Bacteria | 1099 |
| 384 | Ga0496102_0994928 | 3300048905 | Bacteria | 759 |
| 385 | Ga0496102_1141310 | 3300048905 | Bacteria | 699 |
| 386 | Ga0496103_0136594 | 3300048906 | Bacteria | 1567 |
| 387 | Ga0496104_0003694 | 3300048907 | Bacteria | 13207 |
| 388 | Ga0496104_0555220 | 3300048907 | Bacteria | 1059 |
| 389 | Ga0496105_0213216 | 3300048908 | Bacteria | 1573 |
| 390 | Ga0496109_0037707 | 3300048912 | Bacteria | 4368 |
| 391 | Ga0496110_0123160 | 3300048913 | Bacteria | 2338 |
| 392 | Ga0496110_0366940 | 3300048913 | Bacteria | 1312 |
| 393 | Ga0496112_0065896 | 3300048915 | Bacteria | 3574 |
| 394 | Ga0496112_0983185 | 3300048915 | Bacteria | 764 |
| 395 | Ga0496114_0052649 | 3300048917 | Bacteria | 3391 |
| 396 | Ga0496115_0076681 | 3300048918 | Bacteria | 2717 |
| 397 | Ga0496121_0487285 | 3300048924 | Bacteria | 786 |
| 398 | Ga0496124_0394230 | 3300048927 | Bacteria | 963 |
| 399 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 400 | Ga0496125_0000681 | 3300048928 | Bacteria | 56691 |
| 401 | Ga0496126_0000688 | 3300048929 | Bacteria | 61933 |
| 402 | Ga0496126_0020167 | 3300048929 | Bacteria | 6542 |
| 403 | Ga0496126_0151994 | 3300048929 | Bacteria | 1983 |
| 404 | Ga0496126_0332972 | 3300048929 | Bacteria | 1245 |
| 405 | Ga0501292_022866 | 3300049515 | Bacteria | 1019 |
| 406 | Ga0501293_002543 | 3300049516 | Bacteria | 1386 |
| 407 | Ga0501297_017590 | 3300049520 | Bacteria | 872 |
| 408 | Ga0501031_0001051 | 3300049568 | Bacteria | 16740 |
| 409 | Ga0501032_0004183 | 3300049569 | Bacteria | 10932 |
| 410 | Ga0501033_0000704 | 3300049570 | Bacteria | 30846 |
| 411 | Ga0501033_0012477 | 3300049570 | Bacteria | 6485 |
| 412 | Ga0501034_0005933 | 3300049571 | Bacteria | 13243 |
| 413 | Ga0501036_0004410 | 3300049572 | Bacteria | 11359 |
| 414 | Ga0501036_0409478 | 3300049572 | Bacteria | 1131 |
| 415 | Ga0501037_0001546 | 3300049573 | Bacteria | 16794 |
| 416 | Ga0501038_0000825 | 3300049574 | Bacteria | 27591 |
| 417 | Ga0501039_0039849 | 3300049575 | Bacteria | 3627 |
| 418 | Ga0501040_0301195 | 3300049576 | Bacteria | 1146 |
| 419 | Ga0501043_0002187 | 3300049579 | Bacteria | 16683 |
| 420 | Ga0501046_0000798 | 3300049580 | Bacteria | 30547 |
| 421 | Ga0501046_0076237 | 3300049580 | Bacteria | 2598 |
| 422 | Ga0501047_0000879 | 3300049581 | Bacteria | 30673 |
| 423 | Ga0501047_0058669 | 3300049581 | Bacteria | 3717 |
| 424 | Ga0501047_0186451 | 3300049581 | Bacteria | 1940 |
| 425 | Ga0501048_0001204 | 3300049582 | Bacteria | 19581 |
| 426 | Ga0501067_0016464 | 3300049583 | Bacteria | 4084 |
| 427 | Ga0501069_0008428 | 3300049585 | Bacteria | 5419 |
| 428 | Ga0501070_0000703 | 3300049586 | Bacteria | 30732 |
| 429 | Ga0501070_0086990 | 3300049586 | Bacteria | 2587 |
| 430 | Ga0501071_0384240 | 3300049587 | Bacteria | 1071 |
| 431 | Ga0501072_0061226 | 3300049588 | Bacteria | 2968 |
| 432 | Ga0501073_0003233 | 3300049589 | Bacteria | 12229 |
| 433 | Ga0501073_0017283 | 3300049589 | Bacteria | 5225 |
| 434 | Ga0501074_0011132 | 3300049590 | Bacteria | 6534 |
| 435 | Ga0501074_0023594 | 3300049590 | Bacteria | 4471 |
| 436 | Ga0501074_0065507 | 3300049590 | Bacteria | 2615 |
| 437 | Ga0501075_0083803 | 3300049591 | Bacteria | 2415 |
| 438 | Ga0501206_010895 | 3300049653 | Bacteria | 1223 |
| 439 | Ga0501235_035292 | 3300049669 | Bacteria | 1135 |
| 440 | Ga0501259_024055 | 3300049688 | Bacteria | 1106 |
| 441 | Ga0501079_0026136 | 3300049741 | Bacteria | 4476 |
| 442 | Ga0501080_0003659 | 3300049742 | Bacteria | 13567 |
| 443 | Ga0501080_0223360 | 3300049742 | Bacteria | 1723 |
| 444 | Ga0501080_0656771 | 3300049742 | Bacteria | 927 |
| 445 | Ga0501083_0002212 | 3300049744 | Bacteria | 13292 |
| 446 | Ga0501083_0051200 | 3300049744 | Bacteria | 2777 |
| 447 | Ga0501035_0001052 | 3300049822 | Bacteria | 28914 |
| 448 | Ga0501044_0000735 | 3300049823 | Bacteria | 39493 |
| 449 | Ga0501044_0021407 | 3300049823 | Bacteria | 6898 |
| 450 | nmdc:mga03n38_444443_c1 | 3300050490 | Bacteria | 720 |
| 451 | nmdc:mga0yw44_321062_c1 | 3300050492 | Bacteria | 1040 |
| 452 | nmdc:mga0yw44_419697_c1 | 3300050492 | Bacteria | 906 |
| 453 | nmdc:mga0k408_69803_c1 | 3300050493 | Bacteria | 2051 |
| 454 | nmdc:mga05p37_115225_c1 | 3300050507 | Bacteria | 3304 |
| 455 | nmdc:mga05p37_99909_c1 | 3300050507 | Bacteria | 3573 |
| 456 | nmdc:mga09592_54752_c1 | 3300050508 | Bacteria | 3370 |
| 457 | nmdc:mga08y16_133789_c1 | 3300050511 | Bacteria | 2577 |
| 458 | nmdc:mga08y16_4107_c1 | 3300050511 | Bacteria | 15189 |
| 459 | nmdc:mga0n895_448662_c1 | 3300050512 | Bacteria | 1302 |
| 460 | nmdc:mga0n895_5085_c1 | 3300050512 | Bacteria | 10924 |
| 461 | nmdc:mga0n895_555193_c1 | 3300050512 | Bacteria | 1154 |
| 462 | nmdc:mga0rr50_3330_c1 | 3300050513 | Bacteria | 9227 |
| 463 | nmdc:mga0rr50_38429_c1 | 3300050513 | Bacteria | 3463 |
| 464 | nmdc:mga08x19_337374_c1 | 3300050514 | Bacteria | 1051 |
| 465 | nmdc:mga0sz30_29115_c1 | 3300050516 | Bacteria | 2275 |
| 466 | Ga0495601_0011938 | 3300053077 | Bacteria | 5207 |
| 467 | Ga0495612_0105842 | 3300053078 | Bacteria | 1201 |
| 468 | Ga0500635_0019248 | 3300053080 | Bacteria | 2073 |
| 469 | Ga0495595_0043731 | 3300053084 | Bacteria | 2056 |
| 470 | Ga0495619_0001294 | 3300053085 | Bacteria | 16443 |
| 471 | Ga0495619_0008505 | 3300053085 | Bacteria | 6490 |
| 472 | Ga0495619_0020174 | 3300053085 | Bacteria | 4242 |
| 473 | Ga0495619_0033744 | 3300053085 | Bacteria | 3324 |
| 474 | Ga0500566_0154263 | 3300053094 | Bacteria | 1204 |
| 475 | Ga0500556_0160760 | 3300053104 | Bacteria | 886 |
| 476 | Ga0500603_003826 | 3300053150 | Bacteria | 3220 |
| 477 | Ga0500638_235503 | 3300053162 | Bacteria | 748 |
| 478 | Ga0500639_073690 | 3300053163 | Bacteria | 1734 |
| 479 | Ga0500636_0107824 | 3300053177 | Bacteria | 1576 |
| 480 | Ga0500637_0001714 | 3300053178 | Bacteria | 9438 |
| 481 | Ga0500657_071190 | 3300053728 | Bacteria | 1523 |
| 482 | Ga0500596_001454 | 3300053735 | Bacteria | 4795 |
| 483 | Ga0501084_0034459 | 3300054114 | Bacteria | 4234 |
| 484 | Ga0501084_0452206 | 3300054114 | Bacteria | 1086 |
| 485 | Ga0587072_073270 | 3300059643 | Bacteria | 727 |
| 486 | Ga0587075_019661 | 3300059644 | Bacteria | 991 |
| 487 | Ga0501082_0028724 | 3300060353 | Bacteria | 4790 |
| 488 | Ga0501082_0578371 | 3300060353 | Bacteria | 983 |
| 489 | 2513875779 | 2513237139 | Bacteria | 8737671 |
| 490 | 2513893942 | 2513237141 | Bacteria | 8496279 |
| 491 | 2728750624 | 2728368998 | Bacteria | 8720350 |
| 492 | 2805917709 | 2802429603 | Bacteria | 8777136 |
| 493 | 2824698397 | 2824696289 | Bacteria | 8335049 |
| 494 | 2824773953 | 2824773399 | Bacteria | 8360218 |
| 495 | 2844318102 | 2844315083 | Bacteria | 8138177 |
| 496 | 2847945476 | 2847939898 | Bacteria | 8606328 |
| 497 | 2856349644 | 2856349417 | Bacteria | 6230045 |
| 498 | 2856359829 | 2856356410 | Bacteria | 6297484 |
| 499 | 2871493856 | 2871488783 | Bacteria | 6929816 |
| 500 | 2871498299 | 2871495908 | Bacteria | 6935695 |
| 501 | 2878756432 | 2878753008 | Bacteria | 6922523 |
| 502 | 2878762519 | 2878760144 | Bacteria | 6823465 |
| 503 | 2878769486 | 2878767105 | Bacteria | 6898628 |
| 504 | 2881157368 | 2881155292 | Bacteria | 6461656 |
| 505 | 2881850739 | 2881845957 | Bacteria | 6611900 |
| 506 | 2881854892 | 2881853255 | Bacteria | 6698367 |
| 507 | 2881868344 | 2881861095 | Bacteria | 7128710 |
| 508 | 2882918162 | 2882912400 | Bacteria | 6801539 |
| 509 | 2885321170 | 2885318864 | Bacteria | 6729568 |
| 510 | 2885346347 | 2885342637 | Bacteria | 7011821 |
| 511 | 2885351575 | 2885350715 | Bacteria | 6787678 |
| 512 | 2885383243 | 2885374607 | Bacteria | 8927485 |
| 513 | 2903502640 | 2903492973 | Bacteria | 13473544 |
| 514 | 2903543094 | 2903540706 | Bacteria | 7062119 |
| 515 | 2903734159 | 2903727486 | Bacteria | 8281579 |
| 516 | 2906605737 | 2906602504 | Bacteria | 8295279 |
| 517 | 2924788010 | 2924784321 | Bacteria | 7416538 |
| 518 | 2937996947 | 2937994558 | Bacteria | 7036190 |
| 519 | 2958167416 | 2958165035 | Bacteria | 6906348 |
| 520 | 2961131910 | 2961127735 | Bacteria | 7196641 |
| 521 | 2961165888 | 2961163497 | Bacteria | 6901077 |
| 522 | 2961172721 | 2961170736 | Bacteria | 7072258 |
| 523 | 2965020707 | 2965018300 | Bacteria | 6883036 |
| 524 | 2967997933 | 2967996073 | Bacteria | 6787468 |
| 525 | 2968008584 | 2968003550 | Bacteria | 6929263 |
| 526 | 2968174286 | 2968171901 | Bacteria | 6894245 |
| 527 | 2970505315 | 2970503327 | Bacteria | 7099517 |
| 528 | 2970557377 | 2970554993 | Bacteria | 6814252 |
| 529 | 2977825613 | 2977821940 | Bacteria | 6906439 |
| 530 | 2977834796 | 2977828996 | Bacteria | 7007971 |
| 531 | 2979810036 | 2979808191 | Bacteria | 7179355 |
| 532 | 2987661895 | 2987659509 | Bacteria | 6966464 |
| 533 | 3004190944 | 3004188549 | Bacteria | 6952365 |
| 534 | 3005598153 | 3005594810 | Bacteria | 8716512 |
| 535 | 8004378021 | 8004374579 | Bacteria | 6898112 |
| 536 | 8016621962 | 8016613128 | Bacteria | 8794220 |
| 537 | 8054477746 | 8054472261 | Bacteria | 7464355 |
| 538 | 8056694284 | 8056689827 | Bacteria | 6712655 |
| 539 | 8056972455 | 8056967851 | Bacteria | 9038162 |
| 540 | Ga0501067_0057968 | |||
| 541 | SwRhRL2b_contig_3027696 | |||
| 542 | ARSoilOldRDRAFT_c007576 | |||
| 543 | Ga0055531_10035663 | |||
| 544 | Ga0065704_10086191 | |||
| 545 | Ga0065715_10296567 | |||
| 546 | Ga0065715_10511823 | |||
| 547 | Ga0065707_10084658 | |||
| 548 | Ga0070676_10037224 | |||
| 549 | Ga0070676_10083344 | |||
| 550 | Ga0070676_10146340 | |||
| 551 | Ga0070683_100005544 | |||
| 552 | Ga0070690_100008489 | |||
| 553 | Ga0070670_100180682 | |||
| 554 | Ga0070680_100006524 | |||
| 555 | Ga0070660_100087218 | |||
| 556 | Ga0070689_100043361 | |||
| 557 | Ga0070689_100219850 | |||
| 558 | Ga0070668_100430762 | |||
| 559 | Ga0070669_100017031 | |||
| 560 | Ga0070675_100992618 | |||
| 561 | Ga0070673_100003169 | |||
| 562 | Ga0070673_100048697 | |||
| 563 | Ga0070688_100079679 | |||
| 564 | Ga0070688_100099951 | |||
| 565 | Ga0070667_100273321 | |||
| 566 | Ga0070701_10352428 | |||
| 567 | Ga0070700_100003434 | |||
| 568 | Ga0070678_100425972 | |||
| 569 | Ga0070678_100470656 | |||
| 570 | Ga0070678_100799007 | |||
| 571 | Ga0068867_100006142 | |||
| 572 | Ga0070685_10187834 | |||
| 573 | Ga0070685_10197049 | |||
| 574 | Ga0070707_100027692 | |||
| 575 | Ga0070698_100257890 | |||
| 576 | Ga0070684_100005771 | |||
| 577 | Ga0070672_100012367 | |||
| 578 | Ga0070672_100060614 | |||
| 579 | Ga0070672_100131317 | |||
| 580 | Ga0070686_100004024 | |||
| 581 | Ga0070686_100048836 | |||
| 582 | Ga0070665_100048184 | |||
| 583 | Ga0068859_101416007 | |||
| 584 | Ga0068864_100000257 | |||
| 585 | Ga0068864_100692859 | |||
| 586 | Ga0068861_100068818 | |||
| 587 | Ga0068861_100252018 | |||
| 588 | Ga0068863_100000167 | |||
| 589 | Ga0068863_100032385 | |||
| 590 | Ga0068863_100234986 | |||
| 591 | Ga0068863_100459293 | |||
| 592 | Ga0068858_100000198 | |||
| 593 | Ga0068858_100178942 | |||
| 594 | Ga0068862_100056629 | |||
| 595 | Ga0068862_100083341 | |||
| 596 | Ga0075365_10378596 | |||
| 597 | Ga0075367_10055195 | |||
| 598 | Ga0075369_10031229 | |||
| 599 | Ga0097621_100921476 | |||
| 600 | Ga0068871_100305711 | |||
| 601 | Ga0075433_10000725 | |||
| 602 | Ga0075433_10058484 | |||
| 603 | Ga0075433_10283071 | |||
| 604 | Ga0075434_100000689 | |||
| 605 | Ga0075434_100247287 | |||
| 606 | Ga0075429_100042731 | |||
| 607 | Ga0068865_100013996 | |||
| 608 | Ga0068865_100022507 | |||
| 609 | Ga0075435_100015826 | |||
| 610 | Ga0105250_10030101 | |||
| 611 | Ga0111539_10007988 | |||
| 612 | Ga0111539_10014458 | |||
| 613 | Ga0111539_10088766 | |||
| 614 | Ga0105245_10199742 | |||
| 615 | Ga0105245_10291083 | |||
| 616 | Ga0105247_10021077 | |||
| 617 | Ga0114129_10058155 | |||
| 618 | Ga0114129_10060064 | |||
| 619 | Ga0114129_10267221 | |||
| 620 | Ga0105243_10656531 | |||
| 621 | Ga0105242_10109055 | |||
| 622 | Ga0105248_10028948 | |||
| 623 | Ga0105248_10060890 | |||
| 624 | Ga0105248_10095065 | |||
| 625 | Ga0105248_10370243 | |||
| 626 | Ga0105249_10883877 | |||
| 627 | Ga0099796_10087031 | |||
| 628 | Ga0105246_10206511 | |||
| 629 | Ga0157370_10592472 | |||
| 630 | Ga0163162_10705124 | |||
| 631 | Ga0157375_10155826 | |||
| 632 | Ga0163163_10145264 | |||
| 633 | Ga0157379_10108635 | |||
| 634 | Ga0197907_10788113 | |||
| 635 | Ga0206356_10130870 | |||
| 636 | Ga0206352_10233446 | |||
| 637 | Ga0206354_10262680 | |||
| 638 | Ga0213872_10072545 | |||
| 639 | Ga0213876_10068841 | |||
| 640 | Ga0213876_10167594 | |||
| 641 | Ga0224712_10018533 | |||
| 642 | Ga0224712_10022857 | |||
| 643 | Ga0224712_10198587 | |||
| 644 | Ga0224712_10336616 | |||
| 645 | Ga0224575_102412 | |||
| 646 | Ga0209233_1001055 | |||
| 647 | Ga0207666_1006686 | |||
| 648 | Ga0209455_1004293 | |||
| 649 | Ga0209455_1015601 | |||
| 650 | Ga0209257_1001043 | |||
| 651 | Ga0207697_10032021 | |||
| 652 | Ga0207656_10045602 | |||
| 653 | Ga0207696_1021133 | |||
| 654 | Ga0207692_10150720 | |||
| 655 | Ga0207642_10056528 | |||
| 656 | Ga0207642_10459194 | |||
| 657 | Ga0207710_10042830 | |||
| 658 | Ga0207710_10072427 | |||
| 659 | Ga0207688_10185189 | |||
| 660 | Ga0207685_10102394 | |||
| 661 | Ga0207699_10240339 | |||
| 662 | Ga0207645_10010682 | |||
| 663 | Ga0207643_10035885 | |||
| 664 | Ga0207705_10017885 | |||
| 665 | Ga0207684_10006702 | |||
| 666 | Ga0207654_10046859 | |||
| 667 | Ga0207707_10001819 | |||
| 668 | Ga0207707_10015670 | |||
| 669 | Ga0207707_10031473 | |||
| 670 | Ga0207695_10013123 | |||
| 671 | Ga0207695_10062858 | |||
| 672 | Ga0207671_10020984 | |||
| 673 | Ga0207671_10291550 | |||
| 674 | Ga0207663_10223902 | |||
| 675 | Ga0207660_10043186 | |||
| 676 | Ga0207660_10066655 | |||
| 677 | Ga0207662_10049253 | |||
| 678 | Ga0207657_10003059 | |||
| 679 | Ga0207649_10129108 | |||
| 680 | Ga0207652_10008071 | |||
| 681 | Ga0207652_10022569 | |||
| 682 | Ga0207652_10058830 | |||
| 683 | Ga0207681_10013903 | |||
| 684 | Ga0207694_10073184 | |||
| 685 | Ga0207650_10025727 | |||
| 686 | Ga0207650_10192786 | |||
| 687 | Ga0207650_10789702 | |||
| 688 | Ga0207700_10036760 | |||
| 689 | Ga0207700_10351071 | |||
| 690 | Ga0207664_10126867 | |||
| 691 | Ga0207664_10513682 | |||
| 692 | Ga0207664_10767281 | |||
| 693 | Ga0207706_10500047 | |||
| 694 | Ga0207686_10069925 | |||
| 695 | Ga0207670_10010889 | |||
| 696 | Ga0207670_10020274 | |||
| 697 | Ga0207670_10049296 | |||
| 698 | Ga0207704_10009129 | |||
| 699 | Ga0207704_10089215 | |||
| 700 | Ga0207691_10006506 | |||
| 701 | Ga0207691_10109438 | |||
| 702 | Ga0207711_10015029 | |||
| 703 | Ga0207711_10128848 | |||
| 704 | Ga0207711_10156295 | |||
| 705 | Ga0207661_10001745 | |||
| 706 | Ga0207661_10099554 | |||
| 707 | Ga0207661_10143353 | |||
| 708 | Ga0207661_10266814 | |||
| 709 | Ga0207679_10409428 | |||
| 710 | Ga0207667_10009250 | |||
| 711 | Ga0207667_10395359 | |||
| 712 | Ga0207651_10007851 | |||
| 713 | Ga0207651_10019348 | |||
| 714 | Ga0207712_10193555 | |||
| 715 | Ga0207668_10387915 | |||
| 716 | Ga0207668_10444128 | |||
| 717 | Ga0207658_10594930 | |||
| 718 | Ga0207658_10689479 | |||
| 719 | Ga0207703_10000189 | |||
| 720 | Ga0207703_10059363 | |||
| 721 | Ga0207639_10030751 | |||
| 722 | Ga0207708_10009523 | |||
| 723 | Ga0207702_10017745 | |||
| 724 | Ga0207702_10195553 | |||
| 725 | Ga0207702_10727413 | |||
| 726 | Ga0207641_10000120 | |||
| 727 | Ga0207641_10041258 | |||
| 728 | Ga0207648_10036082 | |||
| 729 | Ga0207648_10286881 | |||
| 730 | Ga0207676_10000091 | |||
| 731 | Ga0207674_10007968 | |||
| 732 | Ga0207674_10092227 | |||
| 733 | Ga0207675_100116435 | |||
| 734 | Ga0207683_10245039 | |||
| 735 | Ga0207683_10495199 | |||
| 736 | Ga0207683_10816802 | |||
| 737 | Ga0207698_10335398 | |||
| 738 | Ga0207428_10004590 | |||
| 739 | Ga0207428_10161512 | |||
| 740 | Ga0268266_10044734 | |||
| 741 | Ga0268265_10478826 | |||
| 742 | Ga0268265_11210720 | |||
| 743 | Ga0268264_10515913 | |||
| 744 | Ga0265337_1009221 | |||
| 745 | Ga0265334_10009110 | |||
| 746 | Ga0265318_10032293 | |||
| 747 | Ga0265323_10017191 | |||
| 748 | Ga0265322_10048523 | |||
| 749 | Ga0265336_10000322 | |||
| 750 | Ga0265338_10001338 | |||
| 751 | Ga0265330_10026407 | |||
| 752 | Ga0265328_10094267 | |||
| 753 | Ga0265325_10021822 | |||
| 754 | Ga0265340_10002383 | |||
| 755 | Ga0265339_10008271 | |||
| 756 | Ga0265339_10161534 | |||
| 757 | Ga0265331_10000920 | |||
| 758 | Ga0265327_10002385 | |||
| 759 | Ga0307509_10172017 | |||
| 760 | Ga0265314_10023499 | |||
| 761 | Ga0265314_10262150 | |||
| 762 | Ga0265342_10019156 | |||
| 763 | Ga0307516_10018528 | |||
| 764 | Ga0307410_10530413 | |||
| 765 | Ga0307416_100138797 | |||
| 766 | Ga0307507_10024361 | |||
| 767 | Ga0307510_10022118 | |||
| 768 | Ga0373926_0033409 | |||
| 769 | Ga0373934_0002672 | |||
| 770 | Ga0373944_0024889 | |||
| 771 | Ga0373923_0000076 | |||
| 772 | Ga0373923_0008861 | |||
| 773 | Ga0373936_0014534 | |||
| 774 | Ga0373936_0085862 | |||
| 775 | Ga0373945_0024711 | |||
| 776 | Ga0373953_0006184 | |||
| 777 | Ga0373953_0008940 | |||
| 778 | Ga0373954_0008912 | |||
| 779 | Ga0373954_0015738 | |||
| 780 | Ga0373954_0056865 | |||
| 781 | Ga0373956_0001935 | |||
| 782 | Ga0373957_0000856 | |||
| 783 | Ga0373957_0027322 | |||
| 784 | Ga0373943_0006359 | |||
| 785 | Ga0373943_0051402 | |||
| 786 | Ga0373943_0070389 | |||
| 787 | Ga0373943_0266900 | |||
| 788 | Ga0373946_0001307 | |||
| 789 | Ga0373946_0012726 | |||
| 790 | Ga0373955_0000624 | |||
| 791 | Ga0373955_0034217 | |||
| 792 | Ga0373955_0069060 | |||
| 793 | Ga0373935_0000844 | |||
| 794 | Ga0373935_0050408 | |||
| 795 | Ga0373935_0106140 | |||
| 796 | Ga0373927_0000739 | |||
| 797 | Ga0373933_0022629 | |||
| 798 | Ga0373933_0030207 | |||
| 799 | Ga0373947_0014045 | |||
| 800 | Ga0373937_0021719 | |||
| 801 | Ga0373937_0069526 | |||
| 802 | Ga0373937_0074374 | |||
| 803 | Ga0373937_0142574 | |||
| 804 | Ga0373937_0362143 | |||
| 805 | Ga0373925_0006376 | |||
| 806 | Ga0373925_0017137 | |||
| 807 | Ga0373925_0025341 | |||
| 808 | Ga0373925_0030209 | |||
| 809 | Ga0395900_0007362 | |||
| 810 | Ga0395900_0151197 | |||
| 811 | Ga0395898_0022653 | |||
| 812 | Ga0395898_0034825 | |||
| 813 | Ga0395898_0227441 | |||
| 814 | Ga0395905_0027263 | |||
| 815 | Ga0436364_1466965 | |||
| 816 | Ga0395901_0688873 | |||
| 817 | Ga0436365_0731914 | |||
| 818 | Ga0436365_0838254 | |||
| 819 | Ga0436365_0953587 | |||
| 820 | Ga0436365_1584923 | |||
| 821 | Ga0436360_0178180 | |||
| 822 | Ga0436360_0987496 | |||
| 823 | Ga0436363_1200853 | |||
| 824 | Ga0439439_0093279 | |||
| 825 | Ga0450910_008019 | |||
| 826 | Ga0466966_0000112 | |||
| 827 | Ga0466971_0232943 | |||
| 828 | Ga0466970_0331301 | |||
| 829 | Ga0466959_0016459 | |||
| 830 | Ga0466959_0083672 | |||
| 831 | Ga0451576_0665015 | |||
| 832 | Ga0495592_0001191 | |||
| 833 | Ga0495603_0001448 | |||
| 834 | Ga0495603_0043666 | |||
| 835 | Ga0495603_0162462 | |||
| 836 | Ga0495629_0000117 | |||
| 837 | Ga0495629_0000450 | |||
| 838 | Ga0495629_0000930 | |||
| 839 | Ga0495629_0097674 | |||
| 840 | Ga0495641_0008537 | |||
| 841 | Ga0495641_0112829 | |||
| 842 | Ga0495651_0019753 | |||
| 843 | Ga0495653_0001141 | |||
| 844 | Ga0495653_0499697 | |||
| 845 | Ga0495580_0004634 | |||
| 846 | Ga0495582_0000648 | |||
| 847 | Ga0495582_0015323 | |||
| 848 | Ga0495639_0000163 | |||
| 849 | Ga0495639_0015817 | |||
| 850 | Ga0495639_0029935 | |||
| 851 | Ga0495662_0000078 | |||
| 852 | Ga0495662_0021140 | |||
| 853 | Ga0495664_0007901 | |||
| 854 | Ga0495664_0035573 | |||
| 855 | Ga0495594_0003919 | |||
| 856 | Ga0495594_0004823 | |||
| 857 | Ga0495608_0000519 | |||
| 858 | Ga0495618_0095979 | |||
| 859 | Ga0495628_0008002 | |||
| 860 | Ga0495628_0074022 | |||
| 861 | Ga0495628_0260620 | |||
| 862 | Ga0495628_0431288 | |||
| 863 | Ga0495630_0068652 | |||
| 864 | Ga0495630_0195182 | |||
| 865 | Ga0495666_0003344 | |||
| 866 | Ga0495652_0013345 | |||
| 867 | Ga0495652_0290622 | |||
| 868 | Ga0495665_0000296 | |||
| 869 | Ga0495640_0028307 | |||
| 870 | Ga0495640_0031656 | |||
| 871 | Ga0495640_0042916 | |||
| 872 | Ga0495640_0070231 | |||
| 873 | Ga0495586_0015475 | |||
| 874 | Ga0495586_0151474 | |||
| 875 | Ga0495587_0004141 | |||
| 876 | Ga0495645_0010029 | |||
| 877 | Ga0495622_0002444 | |||
| 878 | Ga0495667_0000128 | |||
| 879 | Ga0495667_0236600 | |||
| 880 | Ga0495667_0248013 | |||
| 881 | Ga0495634_0000996 | |||
| 882 | Ga0495634_0011171 | |||
| 883 | Ga0495634_0046870 | |||
| 884 | Ga0495635_0000232 | |||
| 885 | Ga0495635_0000514 | |||
| 886 | Ga0495635_0000997 | |||
| 887 | Ga0495657_0005432 | |||
| 888 | Ga0495657_0263560 | |||
| 889 | Ga0495599_0006443 | |||
| 890 | Ga0495623_0048122 | |||
| 891 | Ga0495646_0001526 | |||
| 892 | Ga0495646_0064984 | |||
| 893 | Ga0495647_0000732 | |||
| 894 | Ga0495647_0005822 | |||
| 895 | Ga0495647_0018515 | |||
| 896 | Ga0495658_0000349 | |||
| 897 | Ga0495613_0001521 | |||
| 898 | Ga0495613_0025346 | |||
| 899 | Ga0495624_0002980 | |||
| 900 | Ga0495624_0100812 | |||
| 901 | Ga0495600_0002638 | |||
| 902 | Ga0495600_0143544 | |||
| 903 | Ga0495600_0166282 | |||
| 904 | Ga0495581_0000222 | |||
| 905 | Ga0495581_0000650 | |||
| 906 | Ga0495581_0069663 | |||
| 907 | Ga0495604_0006026 | |||
| 908 | Ga0495674_0000709 | |||
| 909 | Ga0495674_0001713 | |||
| 910 | Ga0495674_0008861 | |||
| 911 | Ga0495674_0171560 | |||
| 912 | Ga0495680_0000314 | |||
| 913 | Ga0495680_0022308 | |||
| 914 | Ga0495675_0003282 | |||
| 915 | Ga0495675_0239817 | |||
| 916 | Ga0495684_0001551 | |||
| 917 | Ga0495684_0113030 | |||
| 918 | Ga0495593_0000476 | |||
| 919 | Ga0495593_0001148 | |||
| 920 | Ga0495593_0084143 | |||
| 921 | Ga0495602_0053304 | |||
| 922 | Ga0495614_0133702 | |||
| 923 | Ga0496102_0994928 | |||
| 924 | Ga0496102_1141310 | |||
| 925 | Ga0496103_0136594 | |||
| 926 | Ga0496104_0003694 | |||
| 927 | Ga0496104_0555220 | |||
| 928 | Ga0496105_0213216 | |||
| 929 | Ga0496109_0037707 | |||
| 930 | Ga0496110_0123160 | |||
| 931 | Ga0496110_0366940 | |||
| 932 | Ga0496112_0065896 | |||
| 933 | Ga0496112_0983185 | |||
| 934 | Ga0496114_0052649 | |||
| 935 | Ga0496115_0076681 | |||
| 936 | Ga0496121_0487285 | |||
| 937 | Ga0496124_0394230 | |||
| 938 | Ga0496125_0000125 | |||
| 939 | Ga0496125_0000681 | |||
| 940 | Ga0496126_0000688 | |||
| 941 | Ga0496126_0020167 | |||
| 942 | Ga0496126_0151994 | |||
| 943 | Ga0496126_0332972 | |||
| 944 | Ga0501292_022866 | |||
| 945 | Ga0501293_002543 | |||
| 946 | Ga0501297_017590 | |||
| 947 | Ga0501031_0001051 | |||
| 948 | Ga0501032_0004183 | |||
| 949 | Ga0501033_0000704 | |||
| 950 | Ga0501033_0012477 | |||
| 951 | Ga0501034_0005933 | |||
| 952 | Ga0501036_0004410 | |||
| 953 | Ga0501036_0409478 | |||
| 954 | Ga0501037_0001546 | |||
| 955 | Ga0501038_0000825 | |||
| 956 | Ga0501039_0039849 | |||
| 957 | Ga0501040_0301195 | |||
| 958 | Ga0501043_0002187 | |||
| 959 | Ga0501046_0000798 | |||
| 960 | Ga0501046_0076237 | |||
| 961 | Ga0501047_0000879 | |||
| 962 | Ga0501047_0058669 | |||
| 963 | Ga0501047_0186451 | |||
| 964 | Ga0501048_0001204 | |||
| 965 | Ga0501067_0016464 | |||
| 966 | Ga0501069_0008428 | |||
| 967 | Ga0501070_0000703 | |||
| 968 | Ga0501070_0086990 | |||
| 969 | Ga0501071_0384240 | |||
| 970 | Ga0501072_0061226 | |||
| 971 | Ga0501073_0003233 | |||
| 972 | Ga0501073_0017283 | |||
| 973 | Ga0501074_0011132 | |||
| 974 | Ga0501074_0023594 | |||
| 975 | Ga0501074_0065507 | |||
| 976 | Ga0501075_0083803 | |||
| 977 | Ga0501206_010895 | |||
| 978 | Ga0501235_035292 | |||
| 979 | Ga0501259_024055 | |||
| 980 | Ga0501079_0026136 | |||
| 981 | Ga0501080_0003659 | |||
| 982 | Ga0501080_0223360 | |||
| 983 | Ga0501080_0656771 | |||
| 984 | Ga0501083_0002212 | |||
| 985 | Ga0501083_0051200 | |||
| 986 | Ga0501035_0001052 | |||
| 987 | Ga0501044_0000735 | |||
| 988 | Ga0501044_0021407 | |||
| 989 | nmdc:mga03n38_444443_c1 | |||
| 990 | nmdc:mga0yw44_321062_c1 | |||
| 991 | nmdc:mga0yw44_419697_c1 | |||
| 992 | nmdc:mga0k408_69803_c1 | |||
| 993 | nmdc:mga05p37_115225_c1 | |||
| 994 | nmdc:mga05p37_99909_c1 | |||
| 995 | nmdc:mga09592_54752_c1 | |||
| 996 | nmdc:mga08y16_133789_c1 | |||
| 997 | nmdc:mga08y16_4107_c1 | |||
| 998 | nmdc:mga0n895_448662_c1 | |||
| 999 | nmdc:mga0n895_5085_c1 | |||
| 1000 | nmdc:mga0n895_555193_c1 | |||
| 1001 | nmdc:mga0rr50_3330_c1 | |||
| 1002 | nmdc:mga0rr50_38429_c1 | |||
| 1003 | nmdc:mga08x19_337374_c1 | |||
| 1004 | nmdc:mga0sz30_29115_c1 | |||
| 1005 | Ga0495601_0011938 | |||
| 1006 | Ga0495612_0105842 | |||
| 1007 | Ga0500635_0019248 | |||
| 1008 | Ga0495595_0043731 | |||
| 1009 | Ga0495619_0001294 | |||
| 1010 | Ga0495619_0008505 | |||
| 1011 | Ga0495619_0020174 | |||
| 1012 | Ga0495619_0033744 | |||
| 1013 | Ga0500566_0154263 | |||
| 1014 | Ga0500556_0160760 | |||
| 1015 | Ga0500603_003826 | |||
| 1016 | Ga0500638_235503 | |||
| 1017 | Ga0500639_073690 | |||
| 1018 | Ga0500636_0107824 | |||
| 1019 | Ga0500637_0001714 | |||
| 1020 | Ga0500657_071190 | |||
| 1021 | Ga0500596_001454 | |||
| 1022 | Ga0501084_0034459 | |||
| 1023 | Ga0501084_0452206 | |||
| 1024 | Ga0587072_073270 | |||
| 1025 | Ga0587075_019661 | |||
| 1026 | Ga0501082_0028724 | |||
| 1027 | Ga0501082_0578371 | |||
| 1028 | 2513875779 | |||
| 1029 | 2513893942 | |||
| 1030 | 2728750624 | |||
| 1031 | 2805917709 | |||
| 1032 | 2824698397 | |||
| 1033 | 2824773953 | |||
| 1034 | 2844318102 | |||
| 1035 | 2847945476 | |||
| 1036 | 2856349644 | |||
| 1037 | 2856359829 | |||
| 1038 | 2871493856 | |||
| 1039 | 2871498299 | |||
| 1040 | 2878756432 | |||
| 1041 | 2878762519 | |||
| 1042 | 2878769486 | |||
| 1043 | 2881157368 | |||
| 1044 | 2881850739 | |||
| 1045 | 2881854892 | |||
| 1046 | 2881868344 | |||
| 1047 | 2882918162 | |||
| 1048 | 2885321170 | |||
| 1049 | 2885346347 | |||
| 1050 | 2885351575 | |||
| 1051 | 2885383243 | |||
| 1052 | 2903502640 | |||
| 1053 | 2903543094 | |||
| 1054 | 2903734159 | |||
| 1055 | 2906605737 | |||
| 1056 | 2924788010 | |||
| 1057 | 2937996947 | |||
| 1058 | 2958167416 | |||
| 1059 | 2961131910 | |||
| 1060 | 2961165888 | |||
| 1061 | 2961172721 | |||
| 1062 | 2965020707 | |||
| 1063 | 2967997933 | |||
| 1064 | 2968008584 | |||
| 1065 | 2968174286 | |||
| 1066 | 2970505315 | |||
| 1067 | 2970557377 | |||
| 1068 | 2977825613 | |||
| 1069 | 2977834796 | |||
| 1070 | 2979810036 | |||
| 1071 | 2987661895 | |||
| 1072 | 3004190944 | |||
| 1073 | 3005598153 | |||
| 1074 | 8004378021 | |||
| 1075 | 8016621962 | |||
| 1076 | 8054477746 | |||
| 1077 | 8056694284 | |||
| 1078 | 8056972455 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9675 | 2 | 219 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9628 | 2 | 219 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9609 | 3 | 219 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9563 | 3 | 219 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9404 | 2 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9566 | 5 | 106 | 3.40.30.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9302 | 5 | 106 | 3.40.30.10 |
| 3a2vB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9066 | 1 | 150 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9055 | 155 | 218 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9025 | 155 | 216 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9854 | 1 | 103 |
|
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9835 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3M6WLM4-F1-model_v4 | Thioredoxin domain-containing protein | 0.9806 | 1 | 111 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2V5ZNJ6-F1-model_v4 | Peroxidase | 0.9785 | 3 | 94 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A534YD48-F1-model_v4 | Peroxiredoxin | 0.9775 | 1 | 184 |
GO:0005829
GO:0045454 GO:0051920 |