F461133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 539 | 358 | 1078 | 363 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000892|Ga0213875_100008928 |
| Length | 422 |
| Sequence | MNKLWQLRHGPRPPSQVAGTHGAIGSVAVSNGQTGQRRRRGPDLYGLAYRTVLRRLPPEGAHRAGFGLIRLAGSVPGGPVLLRRRFAPRDPVLRVRALGLDLPGPLGLAAGFDKDARGADALGALGFAFVEVGTVTAQPQPGNPQPRMFRLAADRALINRMGFNNEGAAVAAARLAGRAGLAWRGRFGRRGEPVAVGVNIGKTKVVPAERAIADYVASARLVAAVAAYVVVNVSSPNTPGLRDLQAVSTLRPLLGAVRAALDEAGTGRRVPLLVKIAPDLADGDVDAIADLALELGLDGIIATNTTIGRAGLASDPALVAAAGAGGLSGAPLRARALAVLRRLYARTGDRLVLIAAGGIGDADDAWERICAGATLVQAYTGFIYGGPGWPRQVQDGLARRVRAAGLTSIEQARGTGEPGGPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 57 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 92 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 95 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 98 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 99 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 102 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 109 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 121 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 122 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 123 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 124 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 125 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 128 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 129 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 130 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 131 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 132 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 133 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 134 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 139 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 140 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 141 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 142 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 143 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 144 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 145 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 148 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 149 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 150 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 210 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 211 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 238 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 240 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 246 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 247 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 248 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 249 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 250 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 254 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 255 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 256 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 257 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 258 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 259 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 260 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 261 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 262 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 263 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 264 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 265 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 266 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 267 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 268 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 269 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 270 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 271 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 272 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 273 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 274 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 275 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 276 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 277 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 278 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 279 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 280 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 281 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 282 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 283 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 284 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 285 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 286 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 287 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 288 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 289 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 290 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 291 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 292 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 293 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 294 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 295 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 296 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 297 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 298 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 299 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 300 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 301 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 302 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 303 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 304 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 305 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 306 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 307 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 308 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 309 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 310 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 311 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 312 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 313 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 314 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 315 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 316 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 317 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 318 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 319 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 320 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 321 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 322 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 323 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 324 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 325 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 326 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 327 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 328 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 329 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 330 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 331 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 332 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 333 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 334 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 335 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 336 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 337 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 338 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 339 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 340 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 341 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 342 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 343 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 344 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 345 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 346 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 347 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 348 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 349 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 350 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 351 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 352 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 353 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 354 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 355 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 356 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 357 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 358 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.96 |
| Metatranscriptomes | 0.37 |
| Isolates | 19.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0.74 |
| Rhizoplane | 0.19 |
| Rhizosphere | 77.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10000892 | 3300021388 | Bacteria | 21840 |
| 2 | JGI24746J21847_1000031 | 3300001977 | Bacteria | 13254 |
| 3 | JGI25406J46586_10001754 | 3300003203 | Bacteria | 10200 |
| 4 | JGI25160J50197_1006937 | 3300003354 | Bacteria | 4507 |
| 5 | Ga0006562J51391_1085515 | 3300003578 | Bacteria | 2380 |
| 6 | Ga0006562J51391_1085518 | 3300003578 | Bacteria | 1700 |
| 7 | Ga0070658_10008171 | 3300005327 | Bacteria | 8412 |
| 8 | Ga0070658_10089898 | 3300005327 | Bacteria | 2529 |
| 9 | Ga0070683_100269659 | 3300005329 | Bacteria | 1619 |
| 10 | Ga0068869_100121841 | 3300005334 | Bacteria | 1995 |
| 11 | Ga0070680_100104476 | 3300005336 | Bacteria | 2354 |
| 12 | Ga0070682_100089766 | 3300005337 | Bacteria | 2008 |
| 13 | Ga0070689_100133804 | 3300005340 | Bacteria | 1990 |
| 14 | Ga0070687_100066366 | 3300005343 | Bacteria | 1922 |
| 15 | Ga0070661_100142545 | 3300005344 | Bacteria | 1807 |
| 16 | Ga0070669_100013838 | 3300005353 | Bacteria | 5734 |
| 17 | Ga0070659_100123776 | 3300005366 | Bacteria | 2097 |
| 18 | Ga0070714_100057666 | 3300005435 | Bacteria | 3325 |
| 19 | Ga0070714_100122001 | 3300005435 | Bacteria | 2319 |
| 20 | Ga0070714_100225832 | 3300005435 | Bacteria | 1723 |
| 21 | Ga0070708_100007779 | 3300005445 | Bacteria | 8588 |
| 22 | Ga0070708_100039555 | 3300005445 | Bacteria | 4126 |
| 23 | Ga0070678_100014093 | 3300005456 | Bacteria | 5031 |
| 24 | Ga0068867_100050253 | 3300005459 | Bacteria | 3072 |
| 25 | Ga0070685_10062037 | 3300005466 | Bacteria | 2191 |
| 26 | Ga0070706_100052235 | 3300005467 | Bacteria | 3773 |
| 27 | Ga0070707_100040545 | 3300005468 | Bacteria | 4455 |
| 28 | Ga0070698_100029723 | 3300005471 | Bacteria | 5671 |
| 29 | Ga0070698_100140101 | 3300005471 | Bacteria | 2370 |
| 30 | Ga0068853_100038815 | 3300005539 | Bacteria | 4058 |
| 31 | Ga0068853_100103820 | 3300005539 | Bacteria | 2516 |
| 32 | Ga0070665_100032333 | 3300005548 | Bacteria | 5266 |
| 33 | Ga0068855_100033196 | 3300005563 | Bacteria | 6161 |
| 34 | Ga0068855_100073786 | 3300005563 | Bacteria | 3963 |
| 35 | Ga0068854_100092696 | 3300005578 | Bacteria | 2250 |
| 36 | Ga0068854_100132215 | 3300005578 | Bacteria | 1906 |
| 37 | Ga0068856_100093917 | 3300005614 | Bacteria | 2986 |
| 38 | Ga0070702_100062575 | 3300005615 | Bacteria | 2170 |
| 39 | Ga0068852_100017250 | 3300005616 | Bacteria | 5662 |
| 40 | Ga0068852_100115250 | 3300005616 | Bacteria | 2450 |
| 41 | Ga0068852_100173942 | 3300005616 | Bacteria | 2020 |
| 42 | Ga0068859_100274727 | 3300005617 | Bacteria | 1777 |
| 43 | Ga0068864_100248217 | 3300005618 | Bacteria | 1651 |
| 44 | Ga0068866_10136553 | 3300005718 | Bacteria | 1402 |
| 45 | Ga0081455_10082915 | 3300005937 | Bacteria | 2621 |
| 46 | Ga0081539_10000376 | 3300005985 | Bacteria | 97498 |
| 47 | Ga0070717_10000032 | 3300006028 | Bacteria | 136233 |
| 48 | Ga0075365_10032630 | 3300006038 | Bacteria | 3349 |
| 49 | Ga0075368_10001295 | 3300006042 | Bacteria | 7929 |
| 50 | Ga0075364_10010539 | 3300006051 | Bacteria | 5588 |
| 51 | Ga0075429_100013448 | 3300006880 | Bacteria | 7099 |
| 52 | Ga0075429_100025136 | 3300006880 | Bacteria | 5170 |
| 53 | Ga0075429_100275906 | 3300006880 | Bacteria | 1472 |
| 54 | Ga0097620_100274740 | 3300006931 | Bacteria | 1777 |
| 55 | Ga0099826_10057660 | 3300006948 | Bacteria | 2552 |
| 56 | Ga0105245_10000041 | 3300009098 | Bacteria | 142882 |
| 57 | Ga0105238_10005281 | 3300009551 | Bacteria | 12773 |
| 58 | Ga0099796_10066507 | 3300010159 | Bacteria | 1291 |
| 59 | Ga0105239_10087569 | 3300010375 | Bacteria | 3433 |
| 60 | Ga0157371_10228542 | 3300013102 | Bacteria | 1337 |
| 61 | Ga0157369_10000908 | 3300013105 | Bacteria | 37806 |
| 62 | Ga0157374_10003955 | 3300013296 | Bacteria | 12464 |
| 63 | Ga0157378_10079821 | 3300013297 | Bacteria | 2955 |
| 64 | Ga0163162_10086096 | 3300013306 | Bacteria | 3220 |
| 65 | Ga0157372_10039286 | 3300013307 | Bacteria | 5222 |
| 66 | Ga0163163_10098639 | 3300014325 | Bacteria | 2943 |
| 67 | Ga0182008_10006324 | 3300014497 | Bacteria | 6634 |
| 68 | Ga0182007_10000683 | 3300015262 | Bacteria | 19451 |
| 69 | Ga0183367_1017 | 3300015688 | Bacteria | 126691 |
| 70 | Ga0213876_10045007 | 3300021384 | Bacteria | 2334 |
| 71 | Ga0213876_10080618 | 3300021384 | Bacteria | 1721 |
| 72 | Ga0213875_10000073 | 3300021388 | Bacteria | 119027 |
| 73 | Ga0213875_10000941 | 3300021388 | Bacteria | 20900 |
| 74 | Ga0209758_1006346 | 3300025297 | Bacteria | 8559 |
| 75 | Ga0207426_1003507 | 3300025302 | Bacteria | 8450 |
| 76 | Ga0207426_1014365 | 3300025302 | Bacteria | 2901 |
| 77 | Ga0207426_1019987 | 3300025302 | Bacteria | 2334 |
| 78 | Ga0207713_1022573 | 3300025735 | Bacteria | 2982 |
| 79 | Ga0207653_10007066 | 3300025885 | Bacteria | 3507 |
| 80 | Ga0207710_10002798 | 3300025900 | Bacteria | 7967 |
| 81 | Ga0207688_10011614 | 3300025901 | Bacteria | 4790 |
| 82 | Ga0207647_10015266 | 3300025904 | Bacteria | 5271 |
| 83 | Ga0207643_10156374 | 3300025908 | Bacteria | 1369 |
| 84 | Ga0207705_10073846 | 3300025909 | Bacteria | 2475 |
| 85 | Ga0207705_10308025 | 3300025909 | Bacteria | 1215 |
| 86 | Ga0207684_10009915 | 3300025910 | Bacteria | 8399 |
| 87 | Ga0207684_10023300 | 3300025910 | Bacteria | 5286 |
| 88 | Ga0207695_10091095 | 3300025913 | Bacteria | 3064 |
| 89 | Ga0207663_10114169 | 3300025916 | Bacteria | 1838 |
| 90 | Ga0207660_10216925 | 3300025917 | Bacteria | 1500 |
| 91 | Ga0207657_10028408 | 3300025919 | Bacteria | 5103 |
| 92 | Ga0207649_10107502 | 3300025920 | Bacteria | 1858 |
| 93 | Ga0207694_10098421 | 3300025924 | Bacteria | 2316 |
| 94 | Ga0207687_10000392 | 3300025927 | Bacteria | 29727 |
| 95 | Ga0207664_10022012 | 3300025929 | Bacteria | 4751 |
| 96 | Ga0207664_10115528 | 3300025929 | Bacteria | 2238 |
| 97 | Ga0207690_10146970 | 3300025932 | Bacteria | 1744 |
| 98 | Ga0207670_10065661 | 3300025936 | Bacteria | 2491 |
| 99 | Ga0207670_10135038 | 3300025936 | Bacteria | 1812 |
| 100 | Ga0207670_10278348 | 3300025936 | Bacteria | 1303 |
| 101 | Ga0207689_10023572 | 3300025942 | Bacteria | 5162 |
| 102 | Ga0207667_10247584 | 3300025949 | Bacteria | 1823 |
| 103 | Ga0207667_10262886 | 3300025949 | Bacteria | 1764 |
| 104 | Ga0207667_10336919 | 3300025949 | Bacteria | 1540 |
| 105 | Ga0207712_10021343 | 3300025961 | Bacteria | 4252 |
| 106 | Ga0207703_10152385 | 3300026035 | Bacteria | 2017 |
| 107 | Ga0207639_10084997 | 3300026041 | Bacteria | 2515 |
| 108 | Ga0207639_10088647 | 3300026041 | Bacteria | 2470 |
| 109 | Ga0207708_10062716 | 3300026075 | Bacteria | 2839 |
| 110 | Ga0207708_10199031 | 3300026075 | Bacteria | 1598 |
| 111 | Ga0207702_10048220 | 3300026078 | Bacteria | 3591 |
| 112 | Ga0207641_10065028 | 3300026088 | Bacteria | 3119 |
| 113 | Ga0207648_10057606 | 3300026089 | Bacteria | 3390 |
| 114 | Ga0207683_10007465 | 3300026121 | Bacteria | 9377 |
| 115 | Ga0207698_10009594 | 3300026142 | Bacteria | 6180 |
| 116 | Ga0209813_10000503 | 3300027866 | Bacteria | 9212 |
| 117 | Ga0268264_10361034 | 3300028381 | Bacteria | 1385 |
| 118 | Ga0307517_10019126 | 3300028786 | Bacteria | 8814 |
| 119 | Ga0307515_10002608 | 3300028794 | Bacteria | 38833 |
| 120 | Ga0307515_10051008 | 3300028794 | Bacteria | 6181 |
| 121 | Ga0265338_10061013 | 3300028800 | Bacteria | 3307 |
| 122 | Ga0307511_10004900 | 3300030521 | Bacteria | 13659 |
| 123 | Ga0307511_10092747 | 3300030521 | Bacteria | 2034 |
| 124 | Ga0307512_10001963 | 3300030522 | Bacteria | 27453 |
| 125 | Ga0307512_10137212 | 3300030522 | Bacteria | 1510 |
| 126 | Ga0265332_10003874 | 3300031238 | Bacteria | 7145 |
| 127 | Ga0265340_10005169 | 3300031247 | Bacteria | 7255 |
| 128 | Ga0307513_10090705 | 3300031456 | Bacteria | 3116 |
| 129 | Ga0307513_10215213 | 3300031456 | Bacteria | 1748 |
| 130 | Ga0307513_10218960 | 3300031456 | Bacteria | 1727 |
| 131 | Ga0307509_10000014 | 3300031507 | Bacteria | 276789 |
| 132 | Ga0307509_10036124 | 3300031507 | Bacteria | 5414 |
| 133 | Ga0307509_10086976 | 3300031507 | Bacteria | 3212 |
| 134 | Ga0307509_10118889 | 3300031507 | Bacteria | 2625 |
| 135 | Ga0307509_10149742 | 3300031507 | Bacteria | 2252 |
| 136 | Ga0307508_10003886 | 3300031616 | Bacteria | 14869 |
| 137 | Ga0307508_10227006 | 3300031616 | Bacteria | 1466 |
| 138 | Ga0307514_10003022 | 3300031649 | Bacteria | 16626 |
| 139 | Ga0316579_10000161 | 3300031691 | Bacteria | 19214 |
| 140 | Ga0307516_10004071 | 3300031730 | Bacteria | 18297 |
| 141 | Ga0307516_10017536 | 3300031730 | Bacteria | 7462 |
| 142 | Ga0307516_10019788 | 3300031730 | Bacteria | 6963 |
| 143 | Ga0307518_10107010 | 3300031838 | Bacteria | 1996 |
| 144 | Ga0307406_10005617 | 3300031901 | Bacteria | 6857 |
| 145 | Ga0307412_10131955 | 3300031911 | Bacteria | 1816 |
| 146 | Ga0307416_100039000 | 3300032002 | Bacteria | 3672 |
| 147 | Ga0307510_10019180 | 3300033180 | Bacteria | 8025 |
| 148 | Ga0307510_10055554 | 3300033180 | Bacteria | 4134 |
| 149 | Ga0307510_10057316 | 3300033180 | Bacteria | 4044 |
| 150 | Ga0373949_0000704 | 3300035090 | Bacteria | 10855 |
| 151 | Ga0373961_0000024 | 3300035241 | Bacteria | 97889 |
| 152 | Ga0373925_0116449 | 3300037068 | Bacteria | 2070 |
| 153 | Ga0395899_0028112 | 3300037312 | Bacteria | 4236 |
| 154 | Ga0395899_0090479 | 3300037312 | Bacteria | 2219 |
| 155 | Ga0395900_0014660 | 3300037418 | Bacteria | 7994 |
| 156 | Ga0395900_0061529 | 3300037418 | Bacteria | 3860 |
| 157 | Ga0395898_0061502 | 3300037466 | Bacteria | 3648 |
| 158 | Ga0395905_0238894 | 3300037471 | Bacteria | 1698 |
| 159 | Ga0436364_0290389 | 3300037853 | Bacteria | 159315 |
| 160 | Ga0436364_0390119 | 3300037853 | Bacteria | 23235 |
| 161 | Ga0436364_0778436 | 3300037853 | Bacteria | 42655 |
| 162 | Ga0436364_0798736 | 3300037853 | Bacteria | 130922 |
| 163 | Ga0436364_0874499 | 3300037853 | Bacteria | 22688 |
| 164 | Ga0436364_0967991 | 3300037853 | Bacteria | 1627 |
| 165 | Ga0436364_1520720 | 3300037853 | Bacteria | 3379 |
| 166 | Ga0395901_0075962 | 3300038443 | Bacteria | 3505 |
| 167 | Ga0395901_0146770 | 3300038443 | Bacteria | 2479 |
| 168 | Ga0395901_0416003 | 3300038443 | Bacteria | 1379 |
| 169 | Ga0436365_0600614 | 3300039437 | Bacteria | 5346 |
| 170 | Ga0436365_1316248 | 3300039437 | Bacteria | 2590 |
| 171 | Ga0436363_0407644 | 3300039450 | Bacteria | 1584 |
| 172 | Ga0439436_0001570 | 3300041404 | Bacteria | 6650 |
| 173 | Ga0439436_0005183 | 3300041404 | Bacteria | 3997 |
| 174 | Ga0451833_1025771 | 3300041491 | Bacteria | 13112 |
| 175 | Ga0451837_1532308 | 3300041494 | Bacteria | 2007 |
| 176 | Ga0451853_0427650 | 3300041512 | Bacteria | 2707 |
| 177 | Ga0451853_0459326 | 3300041512 | Bacteria | 3035 |
| 178 | Ga0439442_007772 | 3300042002 | Bacteria | 2163 |
| 179 | Ga0439448_0011741 | 3300042005 | Bacteria | 2612 |
| 180 | Ga0439449_0020868 | 3300042007 | Bacteria | 2454 |
| 181 | Ga0439454_001259 | 3300042011 | Bacteria | 2380 |
| 182 | Ga0439455_0007951 | 3300042012 | Bacteria | 2260 |
| 183 | Ga0439457_007177 | 3300042014 | Bacteria | 2688 |
| 184 | Ga0450894_000076 | 3300042131 | Bacteria | 15727 |
| 185 | Ga0450898_001492 | 3300042134 | Bacteria | 3096 |
| 186 | Ga0450903_000046 | 3300042138 | Bacteria | 24085 |
| 187 | Ga0450906_000281 | 3300042145 | Bacteria | 10126 |
| 188 | Ga0439458_0006218 | 3300042157 | Bacteria | 2664 |
| 189 | Ga0439458_0028100 | 3300042157 | Bacteria | 1330 |
| 190 | Ga0450908_008941 | 3300042184 | Bacteria | 1869 |
| 191 | Ga0450901_001209 | 3300042533 | Bacteria | 2993 |
| 192 | Ga0451577_0074692 | 3300042876 | Bacteria | 3023 |
| 193 | Ga0466969_0010080 | 3300044656 | Bacteria | 5012 |
| 194 | Ga0466972_0002673 | 3300044658 | Bacteria | 8821 |
| 195 | Ga0466972_0013123 | 3300044658 | Bacteria | 4163 |
| 196 | Ga0466965_0007210 | 3300044683 | Bacteria | 5096 |
| 197 | Ga0466966_0000230 | 3300044684 | Bacteria | 37271 |
| 198 | Ga0466966_0005404 | 3300044684 | Bacteria | 8394 |
| 199 | Ga0466966_0007053 | 3300044684 | Bacteria | 7443 |
| 200 | Ga0466961_0000512 | 3300044693 | Bacteria | 24646 |
| 201 | Ga0466961_0018359 | 3300044693 | Bacteria | 4498 |
| 202 | Ga0466961_0021854 | 3300044693 | Bacteria | 4116 |
| 203 | Ga0466963_0000103 | 3300044694 | Bacteria | 30319 |
| 204 | Ga0466963_0001976 | 3300044694 | Bacteria | 11260 |
| 205 | Ga0466963_0004004 | 3300044694 | Bacteria | 8521 |
| 206 | Ga0466963_0111108 | 3300044694 | Bacteria | 1881 |
| 207 | Ga0466963_0165353 | 3300044694 | Bacteria | 1541 |
| 208 | Ga0466964_0002590 | 3300044706 | Bacteria | 6460 |
| 209 | Ga0453684_0275432 | 3300044712 | Bacteria | 1921 |
| 210 | Ga0466971_0000923 | 3300044719 | Bacteria | 12058 |
| 211 | Ga0466971_0083388 | 3300044719 | Bacteria | 1459 |
| 212 | Ga0466968_0022692 | 3300044735 | Bacteria | 2552 |
| 213 | Ga0466970_0000790 | 3300044765 | Bacteria | 15275 |
| 214 | Ga0466957_0000043 | 3300044842 | Bacteria | 46532 |
| 215 | Ga0466957_0002744 | 3300044842 | Bacteria | 9526 |
| 216 | Ga0466957_0047651 | 3300044842 | Bacteria | 2604 |
| 217 | Ga0466960_0001086 | 3300044901 | Bacteria | 9773 |
| 218 | Ga0466960_0143629 | 3300044901 | Bacteria | 1270 |
| 219 | Ga0466959_0000959 | 3300045049 | Bacteria | 17152 |
| 220 | Ga0466959_0058258 | 3300045049 | Bacteria | 2813 |
| 221 | Ga0466959_0118935 | 3300045049 | Bacteria | 1880 |
| 222 | Ga0466958_0000096 | 3300045836 | Bacteria | 27471 |
| 223 | Ga0466958_0001366 | 3300045836 | Bacteria | 11542 |
| 224 | Ga0466958_0061357 | 3300045836 | Bacteria | 2290 |
| 225 | Ga0466967_0007319 | 3300045976 | Bacteria | 7949 |
| 226 | Ga0466967_0095359 | 3300045976 | Bacteria | 2711 |
| 227 | Ga0466967_0123948 | 3300045976 | Bacteria | 2391 |
| 228 | Ga0466967_0389002 | 3300045976 | Bacteria | 1355 |
| 229 | Ga0495617_004108 | 3300046452 | Bacteria | 5338 |
| 230 | Ga0495592_0005445 | 3300046454 | Bacteria | 9398 |
| 231 | Ga0495592_0035258 | 3300046454 | Bacteria | 3770 |
| 232 | Ga0495592_0086454 | 3300046454 | Bacteria | 2258 |
| 233 | Ga0495603_0000385 | 3300046455 | Bacteria | 24132 |
| 234 | Ga0495603_0004799 | 3300046455 | Bacteria | 8079 |
| 235 | Ga0495603_0014411 | 3300046455 | Bacteria | 4781 |
| 236 | Ga0495603_0035563 | 3300046455 | Bacteria | 2991 |
| 237 | Ga0495603_0055003 | 3300046455 | Bacteria | 2358 |
| 238 | Ga0495629_0023749 | 3300046459 | Bacteria | 4367 |
| 239 | Ga0495629_0024309 | 3300046459 | Bacteria | 4313 |
| 240 | Ga0495629_0025949 | 3300046459 | Bacteria | 4163 |
| 241 | Ga0495629_0036258 | 3300046459 | Bacteria | 3482 |
| 242 | Ga0495629_0050282 | 3300046459 | Bacteria | 2919 |
| 243 | Ga0495629_0068687 | 3300046459 | Bacteria | 2473 |
| 244 | Ga0495638_0057880 | 3300046460 | Bacteria | 2403 |
| 245 | Ga0495651_0006927 | 3300046462 | Bacteria | 8665 |
| 246 | Ga0495651_0025601 | 3300046462 | Bacteria | 4594 |
| 247 | Ga0495605_0006939 | 3300046474 | Bacteria | 6468 |
| 248 | Ga0495639_0025409 | 3300046475 | Bacteria | 2612 |
| 249 | Ga0495662_0013223 | 3300046476 | Bacteria | 4017 |
| 250 | Ga0495662_0019753 | 3300046476 | Bacteria | 3259 |
| 251 | Ga0495662_0022564 | 3300046476 | Bacteria | 3039 |
| 252 | Ga0495662_0026573 | 3300046476 | Bacteria | 2794 |
| 253 | Ga0495664_0003910 | 3300046477 | Bacteria | 8130 |
| 254 | Ga0495594_0011889 | 3300046499 | Bacteria | 4528 |
| 255 | Ga0495594_0016656 | 3300046499 | Bacteria | 3874 |
| 256 | Ga0495594_0035947 | 3300046499 | Bacteria | 2700 |
| 257 | Ga0495594_0037786 | 3300046499 | Bacteria | 2635 |
| 258 | Ga0495594_0056702 | 3300046499 | Bacteria | 2162 |
| 259 | Ga0495607_0005439 | 3300046501 | Bacteria | 9120 |
| 260 | Ga0495607_0017238 | 3300046501 | Bacteria | 4643 |
| 261 | Ga0495583_0033484 | 3300046506 | Bacteria | 2471 |
| 262 | Ga0495583_0068857 | 3300046506 | Bacteria | 1559 |
| 263 | Ga0495606_0018422 | 3300046507 | Bacteria | 5234 |
| 264 | Ga0495616_0023893 | 3300046513 | Bacteria | 3284 |
| 265 | Ga0495618_0026619 | 3300046514 | Bacteria | 3598 |
| 266 | Ga0495618_0127959 | 3300046514 | Bacteria | 1626 |
| 267 | Ga0495620_0018147 | 3300046515 | Bacteria | 3489 |
| 268 | Ga0495620_0024737 | 3300046515 | Bacteria | 2851 |
| 269 | Ga0495628_0175252 | 3300046516 | Bacteria | 1624 |
| 270 | Ga0495630_0082663 | 3300046517 | Bacteria | 2424 |
| 271 | Ga0495637_0076695 | 3300046520 | Bacteria | 1339 |
| 272 | Ga0495643_0002273 | 3300046522 | Bacteria | 15532 |
| 273 | Ga0495666_0007665 | 3300046526 | Bacteria | 5401 |
| 274 | Ga0495652_0007948 | 3300046529 | Bacteria | 9738 |
| 275 | Ga0495652_0012194 | 3300046529 | Bacteria | 7762 |
| 276 | Ga0495652_0046677 | 3300046529 | Bacteria | 3717 |
| 277 | Ga0495640_0064996 | 3300046533 | Bacteria | 2465 |
| 278 | Ga0495640_0068885 | 3300046533 | Bacteria | 2380 |
| 279 | Ga0495587_0003207 | 3300046536 | Bacteria | 10929 |
| 280 | Ga0495645_0077824 | 3300046543 | Bacteria | 2384 |
| 281 | Ga0495622_0058236 | 3300046557 | Bacteria | 1789 |
| 282 | Ga0495622_0084631 | 3300046557 | Bacteria | 1459 |
| 283 | Ga0495668_0009145 | 3300046616 | Bacteria | 6104 |
| 284 | Ga0495634_0003004 | 3300046642 | Bacteria | 13731 |
| 285 | Ga0495634_0006104 | 3300046642 | Bacteria | 9181 |
| 286 | Ga0495625_0006692 | 3300046660 | Bacteria | 10224 |
| 287 | Ga0495625_0022129 | 3300046660 | Bacteria | 4879 |
| 288 | Ga0495625_0103482 | 3300046660 | Bacteria | 1953 |
| 289 | Ga0495635_0011210 | 3300046663 | Bacteria | 6284 |
| 290 | Ga0495635_0019909 | 3300046663 | Bacteria | 4676 |
| 291 | Ga0495635_0149644 | 3300046663 | Bacteria | 1589 |
| 292 | Ga0495661_0047594 | 3300046665 | Bacteria | 2610 |
| 293 | Ga0495588_0016271 | 3300046674 | Bacteria | 3593 |
| 294 | Ga0495588_0078749 | 3300046674 | Bacteria | 1719 |
| 295 | Ga0495657_0009949 | 3300046675 | Bacteria | 7176 |
| 296 | Ga0495657_0031486 | 3300046675 | Bacteria | 3707 |
| 297 | Ga0495657_0050453 | 3300046675 | Bacteria | 2797 |
| 298 | Ga0495599_0054967 | 3300046678 | Bacteria | 2494 |
| 299 | Ga0495623_0021810 | 3300046679 | Bacteria | 4137 |
| 300 | Ga0495623_0140773 | 3300046679 | Bacteria | 1435 |
| 301 | Ga0495646_0102867 | 3300046680 | Bacteria | 1635 |
| 302 | Ga0495613_0004494 | 3300046689 | Bacteria | 10453 |
| 303 | Ga0495613_0007075 | 3300046689 | Bacteria | 8351 |
| 304 | Ga0495613_0023924 | 3300046689 | Bacteria | 4550 |
| 305 | Ga0495613_0092145 | 3300046689 | Bacteria | 2194 |
| 306 | Ga0495613_0140827 | 3300046689 | Bacteria | 1723 |
| 307 | Ga0495589_0007765 | 3300046794 | Bacteria | 5614 |
| 308 | Ga0495589_0012355 | 3300046794 | Bacteria | 4423 |
| 309 | Ga0495589_0025534 | 3300046794 | Bacteria | 2998 |
| 310 | Ga0495589_0033119 | 3300046794 | Bacteria | 2596 |
| 311 | Ga0495600_0034386 | 3300046809 | Bacteria | 3290 |
| 312 | Ga0495581_0011839 | 3300047315 | Bacteria | 5049 |
| 313 | Ga0495604_0004411 | 3300047317 | Bacteria | 11139 |
| 314 | Ga0495604_0011150 | 3300047317 | Bacteria | 7135 |
| 315 | Ga0495604_0106034 | 3300047317 | Bacteria | 2056 |
| 316 | Ga0495636_0053367 | 3300047318 | Bacteria | 1697 |
| 317 | Ga0495674_0002204 | 3300047319 | Bacteria | 19154 |
| 318 | Ga0495672_0053138 | 3300047320 | Bacteria | 2375 |
| 319 | Ga0495676_0001761 | 3300047321 | Bacteria | 18907 |
| 320 | Ga0495676_0022644 | 3300047321 | Bacteria | 5462 |
| 321 | Ga0495676_0039155 | 3300047321 | Bacteria | 3929 |
| 322 | Ga0495676_0042629 | 3300047321 | Bacteria | 3722 |
| 323 | Ga0495676_0088896 | 3300047321 | Bacteria | 2315 |
| 324 | Ga0495680_0035410 | 3300047322 | Bacteria | 4021 |
| 325 | Ga0495683_0000945 | 3300047323 | Bacteria | 20440 |
| 326 | Ga0495687_002181 | 3300047443 | Bacteria | 16294 |
| 327 | Ga0495687_004425 | 3300047443 | Bacteria | 9508 |
| 328 | Ga0495687_016456 | 3300047443 | Bacteria | 3718 |
| 329 | Ga0495687_032451 | 3300047443 | Bacteria | 2382 |
| 330 | Ga0495685_010538 | 3300047447 | Bacteria | 3102 |
| 331 | Ga0495685_026091 | 3300047447 | Bacteria | 2011 |
| 332 | Ga0495681_0025946 | 3300047470 | Bacteria | 3060 |
| 333 | Ga0495684_0077000 | 3300047471 | Bacteria | 2533 |
| 334 | Ga0495686_0014657 | 3300047472 | Bacteria | 5391 |
| 335 | Ga0495686_0046721 | 3300047472 | Bacteria | 2735 |
| 336 | Ga0495593_0008603 | 3300047673 | Bacteria | 5935 |
| 337 | Ga0495593_0039430 | 3300047673 | Bacteria | 2546 |
| 338 | Ga0496123_0024000 | 3300048926 | Bacteria | 4651 |
| 339 | Ga0496124_0178068 | 3300048927 | Bacteria | 1639 |
| 340 | Ga0496125_0212071 | 3300048928 | Bacteria | 1257 |
| 341 | Ga0495678_013192 | 3300049459 | Bacteria | 3890 |
| 342 | Ga0501031_0031986 | 3300049568 | Bacteria | 3431 |
| 343 | Ga0501031_0137043 | 3300049568 | Bacteria | 1599 |
| 344 | Ga0501032_0039533 | 3300049569 | Bacteria | 3208 |
| 345 | Ga0501032_0051886 | 3300049569 | Bacteria | 2764 |
| 346 | Ga0501032_0077532 | 3300049569 | Bacteria | 2212 |
| 347 | Ga0501033_0003296 | 3300049570 | Bacteria | 13343 |
| 348 | Ga0501033_0015639 | 3300049570 | Bacteria | 5753 |
| 349 | Ga0501033_0021306 | 3300049570 | Bacteria | 4889 |
| 350 | Ga0501033_0031613 | 3300049570 | Bacteria | 3976 |
| 351 | Ga0501033_0033690 | 3300049570 | Bacteria | 3845 |
| 352 | Ga0501034_0002413 | 3300049571 | Bacteria | 22626 |
| 353 | Ga0501034_0019134 | 3300049571 | Bacteria | 7012 |
| 354 | Ga0501034_0021321 | 3300049571 | Bacteria | 6606 |
| 355 | Ga0501034_0023035 | 3300049571 | Bacteria | 6346 |
| 356 | Ga0501034_0029263 | 3300049571 | Bacteria | 5600 |
| 357 | Ga0501036_0002141 | 3300049572 | Bacteria | 15410 |
| 358 | Ga0501036_0009642 | 3300049572 | Bacteria | 7944 |
| 359 | Ga0501036_0019715 | 3300049572 | Bacteria | 5662 |
| 360 | Ga0501036_0038834 | 3300049572 | Bacteria | 4030 |
| 361 | Ga0501036_0146964 | 3300049572 | Bacteria | 1988 |
| 362 | Ga0501037_0008190 | 3300049573 | Bacteria | 7662 |
| 363 | Ga0501037_0057069 | 3300049573 | Bacteria | 2851 |
| 364 | Ga0501038_0005643 | 3300049574 | Bacteria | 11609 |
| 365 | Ga0501038_0024412 | 3300049574 | Bacteria | 5394 |
| 366 | Ga0501038_0040864 | 3300049574 | Bacteria | 4047 |
| 367 | Ga0501038_0137207 | 3300049574 | Bacteria | 2003 |
| 368 | Ga0501038_0211459 | 3300049574 | Bacteria | 1551 |
| 369 | Ga0501039_0069947 | 3300049575 | Bacteria | 2726 |
| 370 | Ga0501042_0001137 | 3300049578 | Bacteria | 15342 |
| 371 | Ga0501042_0013805 | 3300049578 | Bacteria | 5502 |
| 372 | Ga0501042_0113915 | 3300049578 | Bacteria | 1947 |
| 373 | Ga0501043_0038571 | 3300049579 | Bacteria | 3756 |
| 374 | Ga0501046_0002489 | 3300049580 | Bacteria | 17261 |
| 375 | Ga0501046_0007834 | 3300049580 | Bacteria | 9371 |
| 376 | Ga0501046_0206518 | 3300049580 | Bacteria | 1460 |
| 377 | Ga0501047_0000182 | 3300049581 | Bacteria | 76846 |
| 378 | Ga0501047_0010642 | 3300049581 | Bacteria | 8695 |
| 379 | Ga0501047_0017296 | 3300049581 | Bacteria | 6904 |
| 380 | Ga0501047_0035909 | 3300049581 | Bacteria | 4788 |
| 381 | Ga0501047_0043008 | 3300049581 | Bacteria | 4364 |
| 382 | Ga0501047_0178398 | 3300049581 | Bacteria | 1991 |
| 383 | Ga0501048_0009275 | 3300049582 | Bacteria | 7391 |
| 384 | Ga0501070_0004986 | 3300049586 | Bacteria | 11330 |
| 385 | Ga0501070_0012026 | 3300049586 | Bacteria | 7304 |
| 386 | Ga0501070_0017784 | 3300049586 | Bacteria | 5969 |
| 387 | Ga0501070_0177003 | 3300049586 | Bacteria | 1756 |
| 388 | Ga0501070_0227949 | 3300049586 | Bacteria | 1527 |
| 389 | Ga0501073_0042426 | 3300049589 | Bacteria | 3211 |
| 390 | Ga0501074_0008200 | 3300049590 | Bacteria | 7572 |
| 391 | Ga0501077_0015687 | 3300049593 | Bacteria | 4771 |
| 392 | Ga0501225_0006849 | 3300049705 | Bacteria | 3324 |
| 393 | Ga0501080_0209990 | 3300049742 | Bacteria | 1784 |
| 394 | Ga0501083_0000027 | 3300049744 | Bacteria | 117605 |
| 395 | Ga0501083_0019295 | 3300049744 | Bacteria | 4749 |
| 396 | Ga0501035_0002470 | 3300049822 | Bacteria | 18053 |
| 397 | Ga0501035_0002656 | 3300049822 | Bacteria | 17390 |
| 398 | Ga0501035_0010494 | 3300049822 | Bacteria | 8584 |
| 399 | Ga0501035_0020532 | 3300049822 | Bacteria | 6067 |
| 400 | Ga0501035_0090028 | 3300049822 | Bacteria | 2701 |
| 401 | Ga0501035_0279490 | 3300049822 | Bacteria | 1411 |
| 402 | Ga0501044_0001722 | 3300049823 | Bacteria | 25608 |
| 403 | Ga0501044_0042008 | 3300049823 | Bacteria | 4759 |
| 404 | Ga0501044_0043533 | 3300049823 | Bacteria | 4663 |
| 405 | Ga0501044_0113990 | 3300049823 | Bacteria | 2709 |
| 406 | Ga0501044_0114078 | 3300049823 | Bacteria | 2708 |
| 407 | Ga0501044_0162155 | 3300049823 | Bacteria | 2211 |
| 408 | Ga0501044_0205142 | 3300049823 | Bacteria | 1928 |
| 409 | Ga0501045_0087496 | 3300049824 | Bacteria | 2301 |
| 410 | nmdc:mga03n38_88649_c1 | 3300050490 | Bacteria | 1468 |
| 411 | nmdc:mga00v17_8115_c1 | 3300050491 | Bacteria | 5635 |
| 412 | nmdc:mga0k408_170092_c1 | 3300050493 | Bacteria | 1299 |
| 413 | nmdc:mga06z11_4361_c1 | 3300050494 | Bacteria | 5565 |
| 414 | nmdc:mga04h51_438_c1 | 3300050495 | Bacteria | 10010 |
| 415 | nmdc:mga07m45_100471_c1 | 3300050496 | Bacteria | 1661 |
| 416 | nmdc:mga09592_22697_c1 | 3300050508 | Bacteria | 5178 |
| 417 | nmdc:mga09592_23081_c1 | 3300050508 | Bacteria | 5135 |
| 418 | nmdc:mga09592_73379_c1 | 3300050508 | Bacteria | 2907 |
| 419 | nmdc:mga0qj67_18818_c1 | 3300050509 | Bacteria | 5267 |
| 420 | nmdc:mga08x19_110950_c1 | 3300050514 | Bacteria | 1829 |
| 421 | Ga0495612_0027629 | 3300053078 | Bacteria | 2282 |
| 422 | Ga0495612_0031644 | 3300053078 | Bacteria | 2134 |
| 423 | Ga0500566_0009248 | 3300053094 | Bacteria | 5829 |
| 424 | Ga0500640_012540 | 3300053095 | Bacteria | 3483 |
| 425 | Ga0500555_006503 | 3300053103 | Bacteria | 3321 |
| 426 | Ga0500597_061357 | 3300053120 | Bacteria | 1616 |
| 427 | Ga0500614_009385 | 3300053123 | Bacteria | 2087 |
| 428 | Ga0500568_0009617 | 3300053139 | Bacteria | 4580 |
| 429 | Ga0501082_0310092 | 3300060353 | Bacteria | 1374 |
| 430 | Ga0466962_0000688 | 3300061719 | Bacteria | 15035 |
| 431 | Ga0466962_0000852 | 3300061719 | Bacteria | 13804 |
| 432 | Ga0466962_0018210 | 3300061719 | Bacteria | 3379 |
| 433 | Ga0466962_0047721 | 3300061719 | Bacteria | 2046 |
| 434 | 2515852055 | 2515154155 | Bacteria | 7985436 |
| 435 | 2547406504 | 2547132111 | Bacteria | 8013147 |
| 436 | 2554259571 | 2554235005 | Bacteria | 6457341 |
| 437 | 2585300367 | 2582581312 | Bacteria | 7308206 |
| 438 | 2585303503 | 2582581313 | Bacteria | 10042643 |
| 439 | 2585316986 | 2582581314 | Bacteria | 11452267 |
| 440 | 2616695596 | 2616644814 | Bacteria | 11555299 |
| 441 | 2616900850 | 2616644941 | Bacteria | 8510691 |
| 442 | 2643760239 | 2643221548 | Bacteria | 8053412 |
| 443 | 2643904463 | 2643221578 | Bacteria | 9213798 |
| 444 | 2643946576 | 2643221587 | Bacteria | 7586415 |
| 445 | 2644267994 | 2643221647 | Bacteria | 10741251 |
| 446 | 2644389072 | 2643221670 | Bacteria | 6497041 |
| 447 | 2644406269 | 2643221673 | Bacteria | 9196637 |
| 448 | 2644434380 | 2643221677 | Bacteria | 7584031 |
| 449 | 2644443670 | 2643221678 | Bacteria | 9540101 |
| 450 | 2644455888 | 2643221681 | Bacteria | 3707866 |
| 451 | 2644460065 | 2643221682 | Bacteria | 6743283 |
| 452 | 2644629600 | 2643221714 | Bacteria | 9015452 |
| 453 | 2645720874 | 2643221961 | Bacteria | 3919167 |
| 454 | 2645723879 | 2643221962 | Bacteria | 3874254 |
| 455 | 2676475919 | 2675903058 | Bacteria | 6822861 |
| 456 | 2676490633 | 2675903060 | Bacteria | 10051191 |
| 457 | 2729906039 | 2728369276 | Bacteria | 5610032 |
| 458 | 2784586723 | 2784132148 | Bacteria | 8627943 |
| 459 | 2785345763 | 2784746763 | Bacteria | 9783172 |
| 460 | 2785367126 | 2784746768 | Bacteria | 10036182 |
| 461 | 2786668174 | 2786546132 | Bacteria | 10419719 |
| 462 | 2808847632 | 2808606359 | Bacteria | 9866990 |
| 463 | 2808918366 | 2808606375 | Bacteria | 9466072 |
| 464 | 2809230290 | 2808606448 | Bacteria | 8656184 |
| 465 | 2811846942 | 2808606982 | Bacteria | 7791042 |
| 466 | 2812360343 | 2811994879 | Bacteria | 9313447 |
| 467 | 2812482443 | 2811994917 | Bacteria | 7761064 |
| 468 | 2819696342 | 2818991463 | Bacteria | 7948711 |
| 469 | 2827630481 | 2827628540 | Bacteria | 6858585 |
| 470 | 2844855356 | 2844852863 | Bacteria | 3849151 |
| 471 | 2852637686 | 2852635781 | Bacteria | 8251373 |
| 472 | 2862186275 | 2862178590 | Bacteria | 8583590 |
| 473 | 2862289686 | 2862281513 | Bacteria | 9621493 |
| 474 | 2862292440 | 2862290372 | Bacteria | 7471434 |
| 475 | 2862386384 | 2862382967 | Bacteria | 10317375 |
| 476 | 2862510393 | 2862507626 | Bacteria | 9425308 |
| 477 | 2862583745 | 2862574272 | Bacteria | 10567477 |
| 478 | 2863406998 | 2863404153 | Bacteria | 9672205 |
| 479 | 2867369828 | 2867369537 | Bacteria | 6501581 |
| 480 | 2867430053 | 2867428634 | Bacteria | 9590268 |
| 481 | 2867475692 | 2867475112 | Bacteria | 6909112 |
| 482 | 2868093255 | 2868088558 | Bacteria | 7609351 |
| 483 | 2870788319 | 2870782633 | Bacteria | 9624083 |
| 484 | 2873157706 | 2873151551 | Bacteria | 8625867 |
| 485 | 2873316279 | 2873314349 | Bacteria | 8512634 |
| 486 | 2875392667 | 2875391855 | Bacteria | 7600475 |
| 487 | 2877683420 | 2877676314 | Bacteria | 9512378 |
| 488 | 2884703665 | 2884693830 | Bacteria | 11273186 |
| 489 | 2895435217 | 2895427314 | Bacteria | 13147766 |
| 490 | 2895447345 | 2895442618 | Bacteria | 11027144 |
| 491 | 2912722427 | 2912715099 | Bacteria | 9460473 |
| 492 | 2912726131 | 2912723979 | Bacteria | 8557534 |
| 493 | 2912758865 | 2912757875 | Bacteria | 7940295 |
| 494 | 2918502494 | 2918501144 | Bacteria | 8668083 |
| 495 | 2919472219 | 2919468124 | Bacteria | 9133025 |
| 496 | 2935393597 | 2935390628 | Bacteria | 7043367 |
| 497 | 2946052047 | 2946045630 | Bacteria | 8527308 |
| 498 | 2946065545 | 2946064051 | Bacteria | 8957905 |
| 499 | 2946073905 | 2946072368 | Bacteria | 8999607 |
| 500 | 2947231864 | 2947224130 | Bacteria | 9938529 |
| 501 | 2954011098 | 2954002825 | Bacteria | 9173742 |
| 502 | 2954388667 | 2954380949 | Bacteria | 10050426 |
| 503 | 2954674457 | 2954673503 | Bacteria | 9685905 |
| 504 | 2954689675 | 2954682443 | Bacteria | 9862841 |
| 505 | 2954699458 | 2954691527 | Bacteria | 10720516 |
| 506 | 2954702760 | 2954701450 | Bacteria | 10834262 |
| 507 | 2954718398 | 2954711539 | Bacteria | 10867210 |
| 508 | 2954728368 | 2954721474 | Bacteria | 10456478 |
| 509 | 2954733441 | 2954731030 | Bacteria | 10243860 |
| 510 | 2954747264 | 2954740390 | Bacteria | 10229294 |
| 511 | 2954752324 | 2954749733 | Bacteria | 10366972 |
| 512 | 2954766379 | 2954759201 | Bacteria | 9358192 |
| 513 | 2966604443 | 2966598605 | Bacteria | 7676064 |
| 514 | 2990059602 | 2990059506 | Bacteria | 9321252 |
| 515 | 2990094514 | 2990088156 | Bacteria | 6657676 |
| 516 | 2997453984 | 2997451912 | Bacteria | 8492419 |
| 517 | 2997605700 | 2997600082 | Bacteria | 9896405 |
| 518 | 3006328040 | 3006321560 | Bacteria | 8247479 |
| 519 | 3006399566 | 3006393351 | Bacteria | 6615579 |
| 520 | 3006490468 | 3006486233 | Bacteria | 8157040 |
| 521 | 3006495127 | 3006493962 | Bacteria | 8825450 |
| 522 | 8008561287 | 8008558824 | Bacteria | 10610750 |
| 523 | 8008580775 | 8008574985 | Bacteria | 7815457 |
| 524 | 8023625001 | 8023623736 | Bacteria | 8593882 |
| 525 | 8025414836 | 8025413630 | Bacteria | 7014048 |
| 526 | 8025534183 | 8025530807 | Bacteria | 8495698 |
| 527 | 8047894821 | 8047893842 | Bacteria | 11723082 |
| 528 | 8048130377 | 8048127548 | Bacteria | 11053136 |
| 529 | 8048364228 | 8048356638 | Bacteria | 11044339 |
| 530 | 8048371840 | 8048369669 | Bacteria | 11666822 |
| 531 | 8048380773 | 8048379754 | Bacteria | 11877923 |
| 532 | 8048408140 | 8048406513 | Bacteria | 8936924 |
| 533 | 8054163839 | 8054160619 | Bacteria | 7783213 |
| 534 | 8055070183 | 8055066027 | Bacteria | 9479577 |
| 535 | 8055177891 | 8055172936 | Bacteria | 9305943 |
| 536 | 8056037719 | 8056037122 | Bacteria | 3854319 |
| 537 | 8056449974 | 8056447290 | Bacteria | 7680491 |
| 538 | 8056670559 | 8056667051 | Bacteria | 6953971 |
| 539 | 8056835728 | 8056829672 | Bacteria | 9045328 |
| 540 | Ga0213875_10000892 | |||
| 541 | JGI24746J21847_1000031 | |||
| 542 | JGI25406J46586_10001754 | |||
| 543 | JGI25160J50197_1006937 | |||
| 544 | Ga0006562J51391_1085515 | |||
| 545 | Ga0006562J51391_1085518 | |||
| 546 | Ga0070658_10008171 | |||
| 547 | Ga0070658_10089898 | |||
| 548 | Ga0070683_100269659 | |||
| 549 | Ga0068869_100121841 | |||
| 550 | Ga0070680_100104476 | |||
| 551 | Ga0070682_100089766 | |||
| 552 | Ga0070689_100133804 | |||
| 553 | Ga0070687_100066366 | |||
| 554 | Ga0070661_100142545 | |||
| 555 | Ga0070669_100013838 | |||
| 556 | Ga0070659_100123776 | |||
| 557 | Ga0070714_100057666 | |||
| 558 | Ga0070714_100122001 | |||
| 559 | Ga0070714_100225832 | |||
| 560 | Ga0070708_100007779 | |||
| 561 | Ga0070708_100039555 | |||
| 562 | Ga0070678_100014093 | |||
| 563 | Ga0068867_100050253 | |||
| 564 | Ga0070685_10062037 | |||
| 565 | Ga0070706_100052235 | |||
| 566 | Ga0070707_100040545 | |||
| 567 | Ga0070698_100029723 | |||
| 568 | Ga0070698_100140101 | |||
| 569 | Ga0068853_100038815 | |||
| 570 | Ga0068853_100103820 | |||
| 571 | Ga0070665_100032333 | |||
| 572 | Ga0068855_100033196 | |||
| 573 | Ga0068855_100073786 | |||
| 574 | Ga0068854_100092696 | |||
| 575 | Ga0068854_100132215 | |||
| 576 | Ga0068856_100093917 | |||
| 577 | Ga0070702_100062575 | |||
| 578 | Ga0068852_100017250 | |||
| 579 | Ga0068852_100115250 | |||
| 580 | Ga0068852_100173942 | |||
| 581 | Ga0068859_100274727 | |||
| 582 | Ga0068864_100248217 | |||
| 583 | Ga0068866_10136553 | |||
| 584 | Ga0081455_10082915 | |||
| 585 | Ga0081539_10000376 | |||
| 586 | Ga0070717_10000032 | |||
| 587 | Ga0075365_10032630 | |||
| 588 | Ga0075368_10001295 | |||
| 589 | Ga0075364_10010539 | |||
| 590 | Ga0075429_100013448 | |||
| 591 | Ga0075429_100025136 | |||
| 592 | Ga0075429_100275906 | |||
| 593 | Ga0097620_100274740 | |||
| 594 | Ga0099826_10057660 | |||
| 595 | Ga0105245_10000041 | |||
| 596 | Ga0105238_10005281 | |||
| 597 | Ga0099796_10066507 | |||
| 598 | Ga0105239_10087569 | |||
| 599 | Ga0157371_10228542 | |||
| 600 | Ga0157369_10000908 | |||
| 601 | Ga0157374_10003955 | |||
| 602 | Ga0157378_10079821 | |||
| 603 | Ga0163162_10086096 | |||
| 604 | Ga0157372_10039286 | |||
| 605 | Ga0163163_10098639 | |||
| 606 | Ga0182008_10006324 | |||
| 607 | Ga0182007_10000683 | |||
| 608 | Ga0183367_1017 | |||
| 609 | Ga0213876_10045007 | |||
| 610 | Ga0213876_10080618 | |||
| 611 | Ga0213875_10000073 | |||
| 612 | Ga0213875_10000941 | |||
| 613 | Ga0209758_1006346 | |||
| 614 | Ga0207426_1003507 | |||
| 615 | Ga0207426_1014365 | |||
| 616 | Ga0207426_1019987 | |||
| 617 | Ga0207713_1022573 | |||
| 618 | Ga0207653_10007066 | |||
| 619 | Ga0207710_10002798 | |||
| 620 | Ga0207688_10011614 | |||
| 621 | Ga0207647_10015266 | |||
| 622 | Ga0207643_10156374 | |||
| 623 | Ga0207705_10073846 | |||
| 624 | Ga0207705_10308025 | |||
| 625 | Ga0207684_10009915 | |||
| 626 | Ga0207684_10023300 | |||
| 627 | Ga0207695_10091095 | |||
| 628 | Ga0207663_10114169 | |||
| 629 | Ga0207660_10216925 | |||
| 630 | Ga0207657_10028408 | |||
| 631 | Ga0207649_10107502 | |||
| 632 | Ga0207694_10098421 | |||
| 633 | Ga0207687_10000392 | |||
| 634 | Ga0207664_10022012 | |||
| 635 | Ga0207664_10115528 | |||
| 636 | Ga0207690_10146970 | |||
| 637 | Ga0207670_10065661 | |||
| 638 | Ga0207670_10135038 | |||
| 639 | Ga0207670_10278348 | |||
| 640 | Ga0207689_10023572 | |||
| 641 | Ga0207667_10247584 | |||
| 642 | Ga0207667_10262886 | |||
| 643 | Ga0207667_10336919 | |||
| 644 | Ga0207712_10021343 | |||
| 645 | Ga0207703_10152385 | |||
| 646 | Ga0207639_10084997 | |||
| 647 | Ga0207639_10088647 | |||
| 648 | Ga0207708_10062716 | |||
| 649 | Ga0207708_10199031 | |||
| 650 | Ga0207702_10048220 | |||
| 651 | Ga0207641_10065028 | |||
| 652 | Ga0207648_10057606 | |||
| 653 | Ga0207683_10007465 | |||
| 654 | Ga0207698_10009594 | |||
| 655 | Ga0209813_10000503 | |||
| 656 | Ga0268264_10361034 | |||
| 657 | Ga0307517_10019126 | |||
| 658 | Ga0307515_10002608 | |||
| 659 | Ga0307515_10051008 | |||
| 660 | Ga0265338_10061013 | |||
| 661 | Ga0307511_10004900 | |||
| 662 | Ga0307511_10092747 | |||
| 663 | Ga0307512_10001963 | |||
| 664 | Ga0307512_10137212 | |||
| 665 | Ga0265332_10003874 | |||
| 666 | Ga0265340_10005169 | |||
| 667 | Ga0307513_10090705 | |||
| 668 | Ga0307513_10215213 | |||
| 669 | Ga0307513_10218960 | |||
| 670 | Ga0307509_10000014 | |||
| 671 | Ga0307509_10036124 | |||
| 672 | Ga0307509_10086976 | |||
| 673 | Ga0307509_10118889 | |||
| 674 | Ga0307509_10149742 | |||
| 675 | Ga0307508_10003886 | |||
| 676 | Ga0307508_10227006 | |||
| 677 | Ga0307514_10003022 | |||
| 678 | Ga0316579_10000161 | |||
| 679 | Ga0307516_10004071 | |||
| 680 | Ga0307516_10017536 | |||
| 681 | Ga0307516_10019788 | |||
| 682 | Ga0307518_10107010 | |||
| 683 | Ga0307406_10005617 | |||
| 684 | Ga0307412_10131955 | |||
| 685 | Ga0307416_100039000 | |||
| 686 | Ga0307510_10019180 | |||
| 687 | Ga0307510_10055554 | |||
| 688 | Ga0307510_10057316 | |||
| 689 | Ga0373949_0000704 | |||
| 690 | Ga0373961_0000024 | |||
| 691 | Ga0373925_0116449 | |||
| 692 | Ga0395899_0028112 | |||
| 693 | Ga0395899_0090479 | |||
| 694 | Ga0395900_0014660 | |||
| 695 | Ga0395900_0061529 | |||
| 696 | Ga0395898_0061502 | |||
| 697 | Ga0395905_0238894 | |||
| 698 | Ga0436364_0290389 | |||
| 699 | Ga0436364_0390119 | |||
| 700 | Ga0436364_0778436 | |||
| 701 | Ga0436364_0798736 | |||
| 702 | Ga0436364_0874499 | |||
| 703 | Ga0436364_0967991 | |||
| 704 | Ga0436364_1520720 | |||
| 705 | Ga0395901_0075962 | |||
| 706 | Ga0395901_0146770 | |||
| 707 | Ga0395901_0416003 | |||
| 708 | Ga0436365_0600614 | |||
| 709 | Ga0436365_1316248 | |||
| 710 | Ga0436363_0407644 | |||
| 711 | Ga0439436_0001570 | |||
| 712 | Ga0439436_0005183 | |||
| 713 | Ga0451833_1025771 | |||
| 714 | Ga0451837_1532308 | |||
| 715 | Ga0451853_0427650 | |||
| 716 | Ga0451853_0459326 | |||
| 717 | Ga0439442_007772 | |||
| 718 | Ga0439448_0011741 | |||
| 719 | Ga0439449_0020868 | |||
| 720 | Ga0439454_001259 | |||
| 721 | Ga0439455_0007951 | |||
| 722 | Ga0439457_007177 | |||
| 723 | Ga0450894_000076 | |||
| 724 | Ga0450898_001492 | |||
| 725 | Ga0450903_000046 | |||
| 726 | Ga0450906_000281 | |||
| 727 | Ga0439458_0006218 | |||
| 728 | Ga0439458_0028100 | |||
| 729 | Ga0450908_008941 | |||
| 730 | Ga0450901_001209 | |||
| 731 | Ga0451577_0074692 | |||
| 732 | Ga0466969_0010080 | |||
| 733 | Ga0466972_0002673 | |||
| 734 | Ga0466972_0013123 | |||
| 735 | Ga0466965_0007210 | |||
| 736 | Ga0466966_0000230 | |||
| 737 | Ga0466966_0005404 | |||
| 738 | Ga0466966_0007053 | |||
| 739 | Ga0466961_0000512 | |||
| 740 | Ga0466961_0018359 | |||
| 741 | Ga0466961_0021854 | |||
| 742 | Ga0466963_0000103 | |||
| 743 | Ga0466963_0001976 | |||
| 744 | Ga0466963_0004004 | |||
| 745 | Ga0466963_0111108 | |||
| 746 | Ga0466963_0165353 | |||
| 747 | Ga0466964_0002590 | |||
| 748 | Ga0453684_0275432 | |||
| 749 | Ga0466971_0000923 | |||
| 750 | Ga0466971_0083388 | |||
| 751 | Ga0466968_0022692 | |||
| 752 | Ga0466970_0000790 | |||
| 753 | Ga0466957_0000043 | |||
| 754 | Ga0466957_0002744 | |||
| 755 | Ga0466957_0047651 | |||
| 756 | Ga0466960_0001086 | |||
| 757 | Ga0466960_0143629 | |||
| 758 | Ga0466959_0000959 | |||
| 759 | Ga0466959_0058258 | |||
| 760 | Ga0466959_0118935 | |||
| 761 | Ga0466958_0000096 | |||
| 762 | Ga0466958_0001366 | |||
| 763 | Ga0466958_0061357 | |||
| 764 | Ga0466967_0007319 | |||
| 765 | Ga0466967_0095359 | |||
| 766 | Ga0466967_0123948 | |||
| 767 | Ga0466967_0389002 | |||
| 768 | Ga0495617_004108 | |||
| 769 | Ga0495592_0005445 | |||
| 770 | Ga0495592_0035258 | |||
| 771 | Ga0495592_0086454 | |||
| 772 | Ga0495603_0000385 | |||
| 773 | Ga0495603_0004799 | |||
| 774 | Ga0495603_0014411 | |||
| 775 | Ga0495603_0035563 | |||
| 776 | Ga0495603_0055003 | |||
| 777 | Ga0495629_0023749 | |||
| 778 | Ga0495629_0024309 | |||
| 779 | Ga0495629_0025949 | |||
| 780 | Ga0495629_0036258 | |||
| 781 | Ga0495629_0050282 | |||
| 782 | Ga0495629_0068687 | |||
| 783 | Ga0495638_0057880 | |||
| 784 | Ga0495651_0006927 | |||
| 785 | Ga0495651_0025601 | |||
| 786 | Ga0495605_0006939 | |||
| 787 | Ga0495639_0025409 | |||
| 788 | Ga0495662_0013223 | |||
| 789 | Ga0495662_0019753 | |||
| 790 | Ga0495662_0022564 | |||
| 791 | Ga0495662_0026573 | |||
| 792 | Ga0495664_0003910 | |||
| 793 | Ga0495594_0011889 | |||
| 794 | Ga0495594_0016656 | |||
| 795 | Ga0495594_0035947 | |||
| 796 | Ga0495594_0037786 | |||
| 797 | Ga0495594_0056702 | |||
| 798 | Ga0495607_0005439 | |||
| 799 | Ga0495607_0017238 | |||
| 800 | Ga0495583_0033484 | |||
| 801 | Ga0495583_0068857 | |||
| 802 | Ga0495606_0018422 | |||
| 803 | Ga0495616_0023893 | |||
| 804 | Ga0495618_0026619 | |||
| 805 | Ga0495618_0127959 | |||
| 806 | Ga0495620_0018147 | |||
| 807 | Ga0495620_0024737 | |||
| 808 | Ga0495628_0175252 | |||
| 809 | Ga0495630_0082663 | |||
| 810 | Ga0495637_0076695 | |||
| 811 | Ga0495643_0002273 | |||
| 812 | Ga0495666_0007665 | |||
| 813 | Ga0495652_0007948 | |||
| 814 | Ga0495652_0012194 | |||
| 815 | Ga0495652_0046677 | |||
| 816 | Ga0495640_0064996 | |||
| 817 | Ga0495640_0068885 | |||
| 818 | Ga0495587_0003207 | |||
| 819 | Ga0495645_0077824 | |||
| 820 | Ga0495622_0058236 | |||
| 821 | Ga0495622_0084631 | |||
| 822 | Ga0495668_0009145 | |||
| 823 | Ga0495634_0003004 | |||
| 824 | Ga0495634_0006104 | |||
| 825 | Ga0495625_0006692 | |||
| 826 | Ga0495625_0022129 | |||
| 827 | Ga0495625_0103482 | |||
| 828 | Ga0495635_0011210 | |||
| 829 | Ga0495635_0019909 | |||
| 830 | Ga0495635_0149644 | |||
| 831 | Ga0495661_0047594 | |||
| 832 | Ga0495588_0016271 | |||
| 833 | Ga0495588_0078749 | |||
| 834 | Ga0495657_0009949 | |||
| 835 | Ga0495657_0031486 | |||
| 836 | Ga0495657_0050453 | |||
| 837 | Ga0495599_0054967 | |||
| 838 | Ga0495623_0021810 | |||
| 839 | Ga0495623_0140773 | |||
| 840 | Ga0495646_0102867 | |||
| 841 | Ga0495613_0004494 | |||
| 842 | Ga0495613_0007075 | |||
| 843 | Ga0495613_0023924 | |||
| 844 | Ga0495613_0092145 | |||
| 845 | Ga0495613_0140827 | |||
| 846 | Ga0495589_0007765 | |||
| 847 | Ga0495589_0012355 | |||
| 848 | Ga0495589_0025534 | |||
| 849 | Ga0495589_0033119 | |||
| 850 | Ga0495600_0034386 | |||
| 851 | Ga0495581_0011839 | |||
| 852 | Ga0495604_0004411 | |||
| 853 | Ga0495604_0011150 | |||
| 854 | Ga0495604_0106034 | |||
| 855 | Ga0495636_0053367 | |||
| 856 | Ga0495674_0002204 | |||
| 857 | Ga0495672_0053138 | |||
| 858 | Ga0495676_0001761 | |||
| 859 | Ga0495676_0022644 | |||
| 860 | Ga0495676_0039155 | |||
| 861 | Ga0495676_0042629 | |||
| 862 | Ga0495676_0088896 | |||
| 863 | Ga0495680_0035410 | |||
| 864 | Ga0495683_0000945 | |||
| 865 | Ga0495687_002181 | |||
| 866 | Ga0495687_004425 | |||
| 867 | Ga0495687_016456 | |||
| 868 | Ga0495687_032451 | |||
| 869 | Ga0495685_010538 | |||
| 870 | Ga0495685_026091 | |||
| 871 | Ga0495681_0025946 | |||
| 872 | Ga0495684_0077000 | |||
| 873 | Ga0495686_0014657 | |||
| 874 | Ga0495686_0046721 | |||
| 875 | Ga0495593_0008603 | |||
| 876 | Ga0495593_0039430 | |||
| 877 | Ga0496123_0024000 | |||
| 878 | Ga0496124_0178068 | |||
| 879 | Ga0496125_0212071 | |||
| 880 | Ga0495678_013192 | |||
| 881 | Ga0501031_0031986 | |||
| 882 | Ga0501031_0137043 | |||
| 883 | Ga0501032_0039533 | |||
| 884 | Ga0501032_0051886 | |||
| 885 | Ga0501032_0077532 | |||
| 886 | Ga0501033_0003296 | |||
| 887 | Ga0501033_0015639 | |||
| 888 | Ga0501033_0021306 | |||
| 889 | Ga0501033_0031613 | |||
| 890 | Ga0501033_0033690 | |||
| 891 | Ga0501034_0002413 | |||
| 892 | Ga0501034_0019134 | |||
| 893 | Ga0501034_0021321 | |||
| 894 | Ga0501034_0023035 | |||
| 895 | Ga0501034_0029263 | |||
| 896 | Ga0501036_0002141 | |||
| 897 | Ga0501036_0009642 | |||
| 898 | Ga0501036_0019715 | |||
| 899 | Ga0501036_0038834 | |||
| 900 | Ga0501036_0146964 | |||
| 901 | Ga0501037_0008190 | |||
| 902 | Ga0501037_0057069 | |||
| 903 | Ga0501038_0005643 | |||
| 904 | Ga0501038_0024412 | |||
| 905 | Ga0501038_0040864 | |||
| 906 | Ga0501038_0137207 | |||
| 907 | Ga0501038_0211459 | |||
| 908 | Ga0501039_0069947 | |||
| 909 | Ga0501042_0001137 | |||
| 910 | Ga0501042_0013805 | |||
| 911 | Ga0501042_0113915 | |||
| 912 | Ga0501043_0038571 | |||
| 913 | Ga0501046_0002489 | |||
| 914 | Ga0501046_0007834 | |||
| 915 | Ga0501046_0206518 | |||
| 916 | Ga0501047_0000182 | |||
| 917 | Ga0501047_0010642 | |||
| 918 | Ga0501047_0017296 | |||
| 919 | Ga0501047_0035909 | |||
| 920 | Ga0501047_0043008 | |||
| 921 | Ga0501047_0178398 | |||
| 922 | Ga0501048_0009275 | |||
| 923 | Ga0501070_0004986 | |||
| 924 | Ga0501070_0012026 | |||
| 925 | Ga0501070_0017784 | |||
| 926 | Ga0501070_0177003 | |||
| 927 | Ga0501070_0227949 | |||
| 928 | Ga0501073_0042426 | |||
| 929 | Ga0501074_0008200 | |||
| 930 | Ga0501077_0015687 | |||
| 931 | Ga0501225_0006849 | |||
| 932 | Ga0501080_0209990 | |||
| 933 | Ga0501083_0000027 | |||
| 934 | Ga0501083_0019295 | |||
| 935 | Ga0501035_0002470 | |||
| 936 | Ga0501035_0002656 | |||
| 937 | Ga0501035_0010494 | |||
| 938 | Ga0501035_0020532 | |||
| 939 | Ga0501035_0090028 | |||
| 940 | Ga0501035_0279490 | |||
| 941 | Ga0501044_0001722 | |||
| 942 | Ga0501044_0042008 | |||
| 943 | Ga0501044_0043533 | |||
| 944 | Ga0501044_0113990 | |||
| 945 | Ga0501044_0114078 | |||
| 946 | Ga0501044_0162155 | |||
| 947 | Ga0501044_0205142 | |||
| 948 | Ga0501045_0087496 | |||
| 949 | nmdc:mga03n38_88649_c1 | |||
| 950 | nmdc:mga00v17_8115_c1 | |||
| 951 | nmdc:mga0k408_170092_c1 | |||
| 952 | nmdc:mga06z11_4361_c1 | |||
| 953 | nmdc:mga04h51_438_c1 | |||
| 954 | nmdc:mga07m45_100471_c1 | |||
| 955 | nmdc:mga09592_22697_c1 | |||
| 956 | nmdc:mga09592_23081_c1 | |||
| 957 | nmdc:mga09592_73379_c1 | |||
| 958 | nmdc:mga0qj67_18818_c1 | |||
| 959 | nmdc:mga08x19_110950_c1 | |||
| 960 | Ga0495612_0027629 | |||
| 961 | Ga0495612_0031644 | |||
| 962 | Ga0500566_0009248 | |||
| 963 | Ga0500640_012540 | |||
| 964 | Ga0500555_006503 | |||
| 965 | Ga0500597_061357 | |||
| 966 | Ga0500614_009385 | |||
| 967 | Ga0500568_0009617 | |||
| 968 | Ga0501082_0310092 | |||
| 969 | Ga0466962_0000688 | |||
| 970 | Ga0466962_0000852 | |||
| 971 | Ga0466962_0018210 | |||
| 972 | Ga0466962_0047721 | |||
| 973 | 2515852055 | |||
| 974 | 2547406504 | |||
| 975 | 2554259571 | |||
| 976 | 2585300367 | |||
| 977 | 2585303503 | |||
| 978 | 2585316986 | |||
| 979 | 2616695596 | |||
| 980 | 2616900850 | |||
| 981 | 2643760239 | |||
| 982 | 2643904463 | |||
| 983 | 2643946576 | |||
| 984 | 2644267994 | |||
| 985 | 2644389072 | |||
| 986 | 2644406269 | |||
| 987 | 2644434380 | |||
| 988 | 2644443670 | |||
| 989 | 2644455888 | |||
| 990 | 2644460065 | |||
| 991 | 2644629600 | |||
| 992 | 2645720874 | |||
| 993 | 2645723879 | |||
| 994 | 2676475919 | |||
| 995 | 2676490633 | |||
| 996 | 2729906039 | |||
| 997 | 2784586723 | |||
| 998 | 2785345763 | |||
| 999 | 2785367126 | |||
| 1000 | 2786668174 | |||
| 1001 | 2808847632 | |||
| 1002 | 2808918366 | |||
| 1003 | 2809230290 | |||
| 1004 | 2811846942 | |||
| 1005 | 2812360343 | |||
| 1006 | 2812482443 | |||
| 1007 | 2819696342 | |||
| 1008 | 2827630481 | |||
| 1009 | 2844855356 | |||
| 1010 | 2852637686 | |||
| 1011 | 2862186275 | |||
| 1012 | 2862289686 | |||
| 1013 | 2862292440 | |||
| 1014 | 2862386384 | |||
| 1015 | 2862510393 | |||
| 1016 | 2862583745 | |||
| 1017 | 2863406998 | |||
| 1018 | 2867369828 | |||
| 1019 | 2867430053 | |||
| 1020 | 2867475692 | |||
| 1021 | 2868093255 | |||
| 1022 | 2870788319 | |||
| 1023 | 2873157706 | |||
| 1024 | 2873316279 | |||
| 1025 | 2875392667 | |||
| 1026 | 2877683420 | |||
| 1027 | 2884703665 | |||
| 1028 | 2895435217 | |||
| 1029 | 2895447345 | |||
| 1030 | 2912722427 | |||
| 1031 | 2912726131 | |||
| 1032 | 2912758865 | |||
| 1033 | 2918502494 | |||
| 1034 | 2919472219 | |||
| 1035 | 2935393597 | |||
| 1036 | 2946052047 | |||
| 1037 | 2946065545 | |||
| 1038 | 2946073905 | |||
| 1039 | 2947231864 | |||
| 1040 | 2954011098 | |||
| 1041 | 2954388667 | |||
| 1042 | 2954674457 | |||
| 1043 | 2954689675 | |||
| 1044 | 2954699458 | |||
| 1045 | 2954702760 | |||
| 1046 | 2954718398 | |||
| 1047 | 2954728368 | |||
| 1048 | 2954733441 | |||
| 1049 | 2954747264 | |||
| 1050 | 2954752324 | |||
| 1051 | 2954766379 | |||
| 1052 | 2966604443 | |||
| 1053 | 2990059602 | |||
| 1054 | 2990094514 | |||
| 1055 | 2997453984 | |||
| 1056 | 2997605700 | |||
| 1057 | 3006328040 | |||
| 1058 | 3006399566 | |||
| 1059 | 3006490468 | |||
| 1060 | 3006495127 | |||
| 1061 | 8008561287 | |||
| 1062 | 8008580775 | |||
| 1063 | 8023625001 | |||
| 1064 | 8025414836 | |||
| 1065 | 8025534183 | |||
| 1066 | 8047894821 | |||
| 1067 | 8048130377 | |||
| 1068 | 8048364228 | |||
| 1069 | 8048371840 | |||
| 1070 | 8048380773 | |||
| 1071 | 8048408140 | |||
| 1072 | 8054163839 | |||
| 1073 | 8055070183 | |||
| 1074 | 8055177891 | |||
| 1075 | 8056037719 | |||
| 1076 | 8056449974 | |||
| 1077 | 8056670559 | |||
| 1078 | 8056835728 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ofw-assembly2.cif.gz_B | crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis | 0.9631 | 8 | 359 |
| 8ofw-assembly1.cif.gz_A | crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis | 0.9603 | 8 | 361 |
| 6b8s-assembly1.cif.gz_A | crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn | 0.9516 | 3 | 358 |
| 6b8s-assembly2.cif.gz_B | crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn | 0.9502 | 3 | 358 |
| 6b8s-assembly1.cif.gz_A | crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn | 0.9433 | 3 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHL1_31_353_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9684 | 34 | 361 | 3.20.20.70 |
| af_P9WHL1_31_353_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9625 | 34 | 361 | 3.20.20.70 |
| 6b8sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9516 | 3 | 358 | 3.20.20.70 |
| af_Q2FV30_1_354_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9443 | 7 | 359 | 3.20.20.70 |
| 6b8sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9434 | 3 | 358 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A699WN18-F1-model_v4 | Dihydroorotate dehydrogenase (quinone), mitochondrial (EC 1.3.5.2) | 0.9884 | 72 | 196 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
| AF-A0A5M3VZ38-F1-model_v4 | Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (DHOD) (DHODase) (Dihydroorotate oxidase) | 0.9858 | 28 | 359 |
GO:0005737
GO:0005886 GO:0006207 GO:0044205 GO:0106430 |
| AF-A0A3B9V6S3-F1-model_v4 | Quinone-dependent dihydroorotate dehydrogenase | 0.9858 | 272 | 359 |
GO:0004152
GO:0005737 GO:0006207 GO:0044205 |
| AF-T0YW00-F1-model_v4 | Dihydroorotate dehydrogenase, classes 1 and 2 | 0.9773 | 151 | 360 |
GO:0004152
GO:0005737 GO:0006207 GO:0044205 |
| AF-A0A7C7KX49-F1-model_v4 | Dihydroorotate dehydrogenase (Quinone) | 0.9765 | 269 | 361 |
GO:0004152
GO:0005737 GO:0006207 GO:0044205 |