F461133

General Info

Members Datasets Scaffolds Average Seq Length
539 358 1078 363

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000892|Ga0213875_100008928
Length 422
Sequence MNKLWQLRHGPRPPSQVAGTHGAIGSVAVSNGQTGQRRRRGPDLYGLAYRTVLRRLPPEGAHRAGFGLIRLAGSVPGGPVLLRRRFAPRDPVLRVRALGLDLPGPLGLAAGFDKDARGADALGALGFAFVEVGTVTAQPQPGNPQPRMFRLAADRALINRMGFNNEGAAVAAARLAGRAGLAWRGRFGRRGEPVAVGVNIGKTKVVPAERAIADYVASARLVAAVAAYVVVNVSSPNTPGLRDLQAVSTLRPLLGAVRAALDEAGTGRRVPLLVKIAPDLADGDVDAIADLALELGLDGIIATNTTIGRAGLASDPALVAAAGAGGLSGAPLRARALAVLRRLYARTGDRLVLIAAGGIGDADDAWERICAGATLVQAYTGFIYGGPGWPRQVQDGLARRVRAAGLTSIEQARGTGEPGGPS

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
132 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
133 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
247 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
248 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
254 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
255 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
256 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
257 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
258 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
259 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
260 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
261 2643221548 Streptomyces sp. Root55 Isolate Unclassified
262 2643221578 Streptomyces sp. Root63 Isolate Unclassified
263 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
264 2643221647 Streptomyces sp. Root369 Isolate Unclassified
265 2643221670 Streptomyces sp. Root431 Isolate Unclassified
266 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
267 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
268 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
269 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
270 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
271 2643221714 Streptomyces sp. Root264 Isolate Unclassified
272 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
273 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
274 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
275 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
276 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
277 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
278 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
279 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
280 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
281 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
282 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
283 2808606448 Streptomyces sp. 193411 Isolate Unclassified
284 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
285 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
286 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
287 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
288 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
289 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
290 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
291 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
292 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
293 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
294 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
295 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
296 2862574272 Streptomyces sp. AcE210 Isolate Nodule
297 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
298 2867369537 Streptomyces sp. Z26 Isolate Unclassified
299 2867428634 Streptomyces sp. RP5T Isolate Unclassified
300 2867475112 Streptomyces sp. TM32 Isolate Unclassified
301 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
302 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
303 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
304 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
305 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
306 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
307 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
308 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
309 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
310 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
311 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
312 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
313 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
314 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
315 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
316 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
317 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
318 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
319 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
320 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
321 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
322 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
323 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
324 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
325 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
326 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
327 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
328 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
329 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
330 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
331 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
332 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
333 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
334 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
335 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
336 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
337 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
338 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
339 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
340 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
341 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
342 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
343 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
344 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
345 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
346 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
347 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
348 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
349 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
350 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
351 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
352 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
353 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
354 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
355 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
356 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
357 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
358 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.96
Metatranscriptomes 0.37
Isolates 19.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0.74
Rhizoplane 0.19
Rhizosphere 77.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000892 3300021388 Bacteria 21840
2 JGI24746J21847_1000031 3300001977 Bacteria 13254
3 JGI25406J46586_10001754 3300003203 Bacteria 10200
4 JGI25160J50197_1006937 3300003354 Bacteria 4507
5 Ga0006562J51391_1085515 3300003578 Bacteria 2380
6 Ga0006562J51391_1085518 3300003578 Bacteria 1700
7 Ga0070658_10008171 3300005327 Bacteria 8412
8 Ga0070658_10089898 3300005327 Bacteria 2529
9 Ga0070683_100269659 3300005329 Bacteria 1619
10 Ga0068869_100121841 3300005334 Bacteria 1995
11 Ga0070680_100104476 3300005336 Bacteria 2354
12 Ga0070682_100089766 3300005337 Bacteria 2008
13 Ga0070689_100133804 3300005340 Bacteria 1990
14 Ga0070687_100066366 3300005343 Bacteria 1922
15 Ga0070661_100142545 3300005344 Bacteria 1807
16 Ga0070669_100013838 3300005353 Bacteria 5734
17 Ga0070659_100123776 3300005366 Bacteria 2097
18 Ga0070714_100057666 3300005435 Bacteria 3325
19 Ga0070714_100122001 3300005435 Bacteria 2319
20 Ga0070714_100225832 3300005435 Bacteria 1723
21 Ga0070708_100007779 3300005445 Bacteria 8588
22 Ga0070708_100039555 3300005445 Bacteria 4126
23 Ga0070678_100014093 3300005456 Bacteria 5031
24 Ga0068867_100050253 3300005459 Bacteria 3072
25 Ga0070685_10062037 3300005466 Bacteria 2191
26 Ga0070706_100052235 3300005467 Bacteria 3773
27 Ga0070707_100040545 3300005468 Bacteria 4455
28 Ga0070698_100029723 3300005471 Bacteria 5671
29 Ga0070698_100140101 3300005471 Bacteria 2370
30 Ga0068853_100038815 3300005539 Bacteria 4058
31 Ga0068853_100103820 3300005539 Bacteria 2516
32 Ga0070665_100032333 3300005548 Bacteria 5266
33 Ga0068855_100033196 3300005563 Bacteria 6161
34 Ga0068855_100073786 3300005563 Bacteria 3963
35 Ga0068854_100092696 3300005578 Bacteria 2250
36 Ga0068854_100132215 3300005578 Bacteria 1906
37 Ga0068856_100093917 3300005614 Bacteria 2986
38 Ga0070702_100062575 3300005615 Bacteria 2170
39 Ga0068852_100017250 3300005616 Bacteria 5662
40 Ga0068852_100115250 3300005616 Bacteria 2450
41 Ga0068852_100173942 3300005616 Bacteria 2020
42 Ga0068859_100274727 3300005617 Bacteria 1777
43 Ga0068864_100248217 3300005618 Bacteria 1651
44 Ga0068866_10136553 3300005718 Bacteria 1402
45 Ga0081455_10082915 3300005937 Bacteria 2621
46 Ga0081539_10000376 3300005985 Bacteria 97498
47 Ga0070717_10000032 3300006028 Bacteria 136233
48 Ga0075365_10032630 3300006038 Bacteria 3349
49 Ga0075368_10001295 3300006042 Bacteria 7929
50 Ga0075364_10010539 3300006051 Bacteria 5588
51 Ga0075429_100013448 3300006880 Bacteria 7099
52 Ga0075429_100025136 3300006880 Bacteria 5170
53 Ga0075429_100275906 3300006880 Bacteria 1472
54 Ga0097620_100274740 3300006931 Bacteria 1777
55 Ga0099826_10057660 3300006948 Bacteria 2552
56 Ga0105245_10000041 3300009098 Bacteria 142882
57 Ga0105238_10005281 3300009551 Bacteria 12773
58 Ga0099796_10066507 3300010159 Bacteria 1291
59 Ga0105239_10087569 3300010375 Bacteria 3433
60 Ga0157371_10228542 3300013102 Bacteria 1337
61 Ga0157369_10000908 3300013105 Bacteria 37806
62 Ga0157374_10003955 3300013296 Bacteria 12464
63 Ga0157378_10079821 3300013297 Bacteria 2955
64 Ga0163162_10086096 3300013306 Bacteria 3220
65 Ga0157372_10039286 3300013307 Bacteria 5222
66 Ga0163163_10098639 3300014325 Bacteria 2943
67 Ga0182008_10006324 3300014497 Bacteria 6634
68 Ga0182007_10000683 3300015262 Bacteria 19451
69 Ga0183367_1017 3300015688 Bacteria 126691
70 Ga0213876_10045007 3300021384 Bacteria 2334
71 Ga0213876_10080618 3300021384 Bacteria 1721
72 Ga0213875_10000073 3300021388 Bacteria 119027
73 Ga0213875_10000941 3300021388 Bacteria 20900
74 Ga0209758_1006346 3300025297 Bacteria 8559
75 Ga0207426_1003507 3300025302 Bacteria 8450
76 Ga0207426_1014365 3300025302 Bacteria 2901
77 Ga0207426_1019987 3300025302 Bacteria 2334
78 Ga0207713_1022573 3300025735 Bacteria 2982
79 Ga0207653_10007066 3300025885 Bacteria 3507
80 Ga0207710_10002798 3300025900 Bacteria 7967
81 Ga0207688_10011614 3300025901 Bacteria 4790
82 Ga0207647_10015266 3300025904 Bacteria 5271
83 Ga0207643_10156374 3300025908 Bacteria 1369
84 Ga0207705_10073846 3300025909 Bacteria 2475
85 Ga0207705_10308025 3300025909 Bacteria 1215
86 Ga0207684_10009915 3300025910 Bacteria 8399
87 Ga0207684_10023300 3300025910 Bacteria 5286
88 Ga0207695_10091095 3300025913 Bacteria 3064
89 Ga0207663_10114169 3300025916 Bacteria 1838
90 Ga0207660_10216925 3300025917 Bacteria 1500
91 Ga0207657_10028408 3300025919 Bacteria 5103
92 Ga0207649_10107502 3300025920 Bacteria 1858
93 Ga0207694_10098421 3300025924 Bacteria 2316
94 Ga0207687_10000392 3300025927 Bacteria 29727
95 Ga0207664_10022012 3300025929 Bacteria 4751
96 Ga0207664_10115528 3300025929 Bacteria 2238
97 Ga0207690_10146970 3300025932 Bacteria 1744
98 Ga0207670_10065661 3300025936 Bacteria 2491
99 Ga0207670_10135038 3300025936 Bacteria 1812
100 Ga0207670_10278348 3300025936 Bacteria 1303
101 Ga0207689_10023572 3300025942 Bacteria 5162
102 Ga0207667_10247584 3300025949 Bacteria 1823
103 Ga0207667_10262886 3300025949 Bacteria 1764
104 Ga0207667_10336919 3300025949 Bacteria 1540
105 Ga0207712_10021343 3300025961 Bacteria 4252
106 Ga0207703_10152385 3300026035 Bacteria 2017
107 Ga0207639_10084997 3300026041 Bacteria 2515
108 Ga0207639_10088647 3300026041 Bacteria 2470
109 Ga0207708_10062716 3300026075 Bacteria 2839
110 Ga0207708_10199031 3300026075 Bacteria 1598
111 Ga0207702_10048220 3300026078 Bacteria 3591
112 Ga0207641_10065028 3300026088 Bacteria 3119
113 Ga0207648_10057606 3300026089 Bacteria 3390
114 Ga0207683_10007465 3300026121 Bacteria 9377
115 Ga0207698_10009594 3300026142 Bacteria 6180
116 Ga0209813_10000503 3300027866 Bacteria 9212
117 Ga0268264_10361034 3300028381 Bacteria 1385
118 Ga0307517_10019126 3300028786 Bacteria 8814
119 Ga0307515_10002608 3300028794 Bacteria 38833
120 Ga0307515_10051008 3300028794 Bacteria 6181
121 Ga0265338_10061013 3300028800 Bacteria 3307
122 Ga0307511_10004900 3300030521 Bacteria 13659
123 Ga0307511_10092747 3300030521 Bacteria 2034
124 Ga0307512_10001963 3300030522 Bacteria 27453
125 Ga0307512_10137212 3300030522 Bacteria 1510
126 Ga0265332_10003874 3300031238 Bacteria 7145
127 Ga0265340_10005169 3300031247 Bacteria 7255
128 Ga0307513_10090705 3300031456 Bacteria 3116
129 Ga0307513_10215213 3300031456 Bacteria 1748
130 Ga0307513_10218960 3300031456 Bacteria 1727
131 Ga0307509_10000014 3300031507 Bacteria 276789
132 Ga0307509_10036124 3300031507 Bacteria 5414
133 Ga0307509_10086976 3300031507 Bacteria 3212
134 Ga0307509_10118889 3300031507 Bacteria 2625
135 Ga0307509_10149742 3300031507 Bacteria 2252
136 Ga0307508_10003886 3300031616 Bacteria 14869
137 Ga0307508_10227006 3300031616 Bacteria 1466
138 Ga0307514_10003022 3300031649 Bacteria 16626
139 Ga0316579_10000161 3300031691 Bacteria 19214
140 Ga0307516_10004071 3300031730 Bacteria 18297
141 Ga0307516_10017536 3300031730 Bacteria 7462
142 Ga0307516_10019788 3300031730 Bacteria 6963
143 Ga0307518_10107010 3300031838 Bacteria 1996
144 Ga0307406_10005617 3300031901 Bacteria 6857
145 Ga0307412_10131955 3300031911 Bacteria 1816
146 Ga0307416_100039000 3300032002 Bacteria 3672
147 Ga0307510_10019180 3300033180 Bacteria 8025
148 Ga0307510_10055554 3300033180 Bacteria 4134
149 Ga0307510_10057316 3300033180 Bacteria 4044
150 Ga0373949_0000704 3300035090 Bacteria 10855
151 Ga0373961_0000024 3300035241 Bacteria 97889
152 Ga0373925_0116449 3300037068 Bacteria 2070
153 Ga0395899_0028112 3300037312 Bacteria 4236
154 Ga0395899_0090479 3300037312 Bacteria 2219
155 Ga0395900_0014660 3300037418 Bacteria 7994
156 Ga0395900_0061529 3300037418 Bacteria 3860
157 Ga0395898_0061502 3300037466 Bacteria 3648
158 Ga0395905_0238894 3300037471 Bacteria 1698
159 Ga0436364_0290389 3300037853 Bacteria 159315
160 Ga0436364_0390119 3300037853 Bacteria 23235
161 Ga0436364_0778436 3300037853 Bacteria 42655
162 Ga0436364_0798736 3300037853 Bacteria 130922
163 Ga0436364_0874499 3300037853 Bacteria 22688
164 Ga0436364_0967991 3300037853 Bacteria 1627
165 Ga0436364_1520720 3300037853 Bacteria 3379
166 Ga0395901_0075962 3300038443 Bacteria 3505
167 Ga0395901_0146770 3300038443 Bacteria 2479
168 Ga0395901_0416003 3300038443 Bacteria 1379
169 Ga0436365_0600614 3300039437 Bacteria 5346
170 Ga0436365_1316248 3300039437 Bacteria 2590
171 Ga0436363_0407644 3300039450 Bacteria 1584
172 Ga0439436_0001570 3300041404 Bacteria 6650
173 Ga0439436_0005183 3300041404 Bacteria 3997
174 Ga0451833_1025771 3300041491 Bacteria 13112
175 Ga0451837_1532308 3300041494 Bacteria 2007
176 Ga0451853_0427650 3300041512 Bacteria 2707
177 Ga0451853_0459326 3300041512 Bacteria 3035
178 Ga0439442_007772 3300042002 Bacteria 2163
179 Ga0439448_0011741 3300042005 Bacteria 2612
180 Ga0439449_0020868 3300042007 Bacteria 2454
181 Ga0439454_001259 3300042011 Bacteria 2380
182 Ga0439455_0007951 3300042012 Bacteria 2260
183 Ga0439457_007177 3300042014 Bacteria 2688
184 Ga0450894_000076 3300042131 Bacteria 15727
185 Ga0450898_001492 3300042134 Bacteria 3096
186 Ga0450903_000046 3300042138 Bacteria 24085
187 Ga0450906_000281 3300042145 Bacteria 10126
188 Ga0439458_0006218 3300042157 Bacteria 2664
189 Ga0439458_0028100 3300042157 Bacteria 1330
190 Ga0450908_008941 3300042184 Bacteria 1869
191 Ga0450901_001209 3300042533 Bacteria 2993
192 Ga0451577_0074692 3300042876 Bacteria 3023
193 Ga0466969_0010080 3300044656 Bacteria 5012
194 Ga0466972_0002673 3300044658 Bacteria 8821
195 Ga0466972_0013123 3300044658 Bacteria 4163
196 Ga0466965_0007210 3300044683 Bacteria 5096
197 Ga0466966_0000230 3300044684 Bacteria 37271
198 Ga0466966_0005404 3300044684 Bacteria 8394
199 Ga0466966_0007053 3300044684 Bacteria 7443
200 Ga0466961_0000512 3300044693 Bacteria 24646
201 Ga0466961_0018359 3300044693 Bacteria 4498
202 Ga0466961_0021854 3300044693 Bacteria 4116
203 Ga0466963_0000103 3300044694 Bacteria 30319
204 Ga0466963_0001976 3300044694 Bacteria 11260
205 Ga0466963_0004004 3300044694 Bacteria 8521
206 Ga0466963_0111108 3300044694 Bacteria 1881
207 Ga0466963_0165353 3300044694 Bacteria 1541
208 Ga0466964_0002590 3300044706 Bacteria 6460
209 Ga0453684_0275432 3300044712 Bacteria 1921
210 Ga0466971_0000923 3300044719 Bacteria 12058
211 Ga0466971_0083388 3300044719 Bacteria 1459
212 Ga0466968_0022692 3300044735 Bacteria 2552
213 Ga0466970_0000790 3300044765 Bacteria 15275
214 Ga0466957_0000043 3300044842 Bacteria 46532
215 Ga0466957_0002744 3300044842 Bacteria 9526
216 Ga0466957_0047651 3300044842 Bacteria 2604
217 Ga0466960_0001086 3300044901 Bacteria 9773
218 Ga0466960_0143629 3300044901 Bacteria 1270
219 Ga0466959_0000959 3300045049 Bacteria 17152
220 Ga0466959_0058258 3300045049 Bacteria 2813
221 Ga0466959_0118935 3300045049 Bacteria 1880
222 Ga0466958_0000096 3300045836 Bacteria 27471
223 Ga0466958_0001366 3300045836 Bacteria 11542
224 Ga0466958_0061357 3300045836 Bacteria 2290
225 Ga0466967_0007319 3300045976 Bacteria 7949
226 Ga0466967_0095359 3300045976 Bacteria 2711
227 Ga0466967_0123948 3300045976 Bacteria 2391
228 Ga0466967_0389002 3300045976 Bacteria 1355
229 Ga0495617_004108 3300046452 Bacteria 5338
230 Ga0495592_0005445 3300046454 Bacteria 9398
231 Ga0495592_0035258 3300046454 Bacteria 3770
232 Ga0495592_0086454 3300046454 Bacteria 2258
233 Ga0495603_0000385 3300046455 Bacteria 24132
234 Ga0495603_0004799 3300046455 Bacteria 8079
235 Ga0495603_0014411 3300046455 Bacteria 4781
236 Ga0495603_0035563 3300046455 Bacteria 2991
237 Ga0495603_0055003 3300046455 Bacteria 2358
238 Ga0495629_0023749 3300046459 Bacteria 4367
239 Ga0495629_0024309 3300046459 Bacteria 4313
240 Ga0495629_0025949 3300046459 Bacteria 4163
241 Ga0495629_0036258 3300046459 Bacteria 3482
242 Ga0495629_0050282 3300046459 Bacteria 2919
243 Ga0495629_0068687 3300046459 Bacteria 2473
244 Ga0495638_0057880 3300046460 Bacteria 2403
245 Ga0495651_0006927 3300046462 Bacteria 8665
246 Ga0495651_0025601 3300046462 Bacteria 4594
247 Ga0495605_0006939 3300046474 Bacteria 6468
248 Ga0495639_0025409 3300046475 Bacteria 2612
249 Ga0495662_0013223 3300046476 Bacteria 4017
250 Ga0495662_0019753 3300046476 Bacteria 3259
251 Ga0495662_0022564 3300046476 Bacteria 3039
252 Ga0495662_0026573 3300046476 Bacteria 2794
253 Ga0495664_0003910 3300046477 Bacteria 8130
254 Ga0495594_0011889 3300046499 Bacteria 4528
255 Ga0495594_0016656 3300046499 Bacteria 3874
256 Ga0495594_0035947 3300046499 Bacteria 2700
257 Ga0495594_0037786 3300046499 Bacteria 2635
258 Ga0495594_0056702 3300046499 Bacteria 2162
259 Ga0495607_0005439 3300046501 Bacteria 9120
260 Ga0495607_0017238 3300046501 Bacteria 4643
261 Ga0495583_0033484 3300046506 Bacteria 2471
262 Ga0495583_0068857 3300046506 Bacteria 1559
263 Ga0495606_0018422 3300046507 Bacteria 5234
264 Ga0495616_0023893 3300046513 Bacteria 3284
265 Ga0495618_0026619 3300046514 Bacteria 3598
266 Ga0495618_0127959 3300046514 Bacteria 1626
267 Ga0495620_0018147 3300046515 Bacteria 3489
268 Ga0495620_0024737 3300046515 Bacteria 2851
269 Ga0495628_0175252 3300046516 Bacteria 1624
270 Ga0495630_0082663 3300046517 Bacteria 2424
271 Ga0495637_0076695 3300046520 Bacteria 1339
272 Ga0495643_0002273 3300046522 Bacteria 15532
273 Ga0495666_0007665 3300046526 Bacteria 5401
274 Ga0495652_0007948 3300046529 Bacteria 9738
275 Ga0495652_0012194 3300046529 Bacteria 7762
276 Ga0495652_0046677 3300046529 Bacteria 3717
277 Ga0495640_0064996 3300046533 Bacteria 2465
278 Ga0495640_0068885 3300046533 Bacteria 2380
279 Ga0495587_0003207 3300046536 Bacteria 10929
280 Ga0495645_0077824 3300046543 Bacteria 2384
281 Ga0495622_0058236 3300046557 Bacteria 1789
282 Ga0495622_0084631 3300046557 Bacteria 1459
283 Ga0495668_0009145 3300046616 Bacteria 6104
284 Ga0495634_0003004 3300046642 Bacteria 13731
285 Ga0495634_0006104 3300046642 Bacteria 9181
286 Ga0495625_0006692 3300046660 Bacteria 10224
287 Ga0495625_0022129 3300046660 Bacteria 4879
288 Ga0495625_0103482 3300046660 Bacteria 1953
289 Ga0495635_0011210 3300046663 Bacteria 6284
290 Ga0495635_0019909 3300046663 Bacteria 4676
291 Ga0495635_0149644 3300046663 Bacteria 1589
292 Ga0495661_0047594 3300046665 Bacteria 2610
293 Ga0495588_0016271 3300046674 Bacteria 3593
294 Ga0495588_0078749 3300046674 Bacteria 1719
295 Ga0495657_0009949 3300046675 Bacteria 7176
296 Ga0495657_0031486 3300046675 Bacteria 3707
297 Ga0495657_0050453 3300046675 Bacteria 2797
298 Ga0495599_0054967 3300046678 Bacteria 2494
299 Ga0495623_0021810 3300046679 Bacteria 4137
300 Ga0495623_0140773 3300046679 Bacteria 1435
301 Ga0495646_0102867 3300046680 Bacteria 1635
302 Ga0495613_0004494 3300046689 Bacteria 10453
303 Ga0495613_0007075 3300046689 Bacteria 8351
304 Ga0495613_0023924 3300046689 Bacteria 4550
305 Ga0495613_0092145 3300046689 Bacteria 2194
306 Ga0495613_0140827 3300046689 Bacteria 1723
307 Ga0495589_0007765 3300046794 Bacteria 5614
308 Ga0495589_0012355 3300046794 Bacteria 4423
309 Ga0495589_0025534 3300046794 Bacteria 2998
310 Ga0495589_0033119 3300046794 Bacteria 2596
311 Ga0495600_0034386 3300046809 Bacteria 3290
312 Ga0495581_0011839 3300047315 Bacteria 5049
313 Ga0495604_0004411 3300047317 Bacteria 11139
314 Ga0495604_0011150 3300047317 Bacteria 7135
315 Ga0495604_0106034 3300047317 Bacteria 2056
316 Ga0495636_0053367 3300047318 Bacteria 1697
317 Ga0495674_0002204 3300047319 Bacteria 19154
318 Ga0495672_0053138 3300047320 Bacteria 2375
319 Ga0495676_0001761 3300047321 Bacteria 18907
320 Ga0495676_0022644 3300047321 Bacteria 5462
321 Ga0495676_0039155 3300047321 Bacteria 3929
322 Ga0495676_0042629 3300047321 Bacteria 3722
323 Ga0495676_0088896 3300047321 Bacteria 2315
324 Ga0495680_0035410 3300047322 Bacteria 4021
325 Ga0495683_0000945 3300047323 Bacteria 20440
326 Ga0495687_002181 3300047443 Bacteria 16294
327 Ga0495687_004425 3300047443 Bacteria 9508
328 Ga0495687_016456 3300047443 Bacteria 3718
329 Ga0495687_032451 3300047443 Bacteria 2382
330 Ga0495685_010538 3300047447 Bacteria 3102
331 Ga0495685_026091 3300047447 Bacteria 2011
332 Ga0495681_0025946 3300047470 Bacteria 3060
333 Ga0495684_0077000 3300047471 Bacteria 2533
334 Ga0495686_0014657 3300047472 Bacteria 5391
335 Ga0495686_0046721 3300047472 Bacteria 2735
336 Ga0495593_0008603 3300047673 Bacteria 5935
337 Ga0495593_0039430 3300047673 Bacteria 2546
338 Ga0496123_0024000 3300048926 Bacteria 4651
339 Ga0496124_0178068 3300048927 Bacteria 1639
340 Ga0496125_0212071 3300048928 Bacteria 1257
341 Ga0495678_013192 3300049459 Bacteria 3890
342 Ga0501031_0031986 3300049568 Bacteria 3431
343 Ga0501031_0137043 3300049568 Bacteria 1599
344 Ga0501032_0039533 3300049569 Bacteria 3208
345 Ga0501032_0051886 3300049569 Bacteria 2764
346 Ga0501032_0077532 3300049569 Bacteria 2212
347 Ga0501033_0003296 3300049570 Bacteria 13343
348 Ga0501033_0015639 3300049570 Bacteria 5753
349 Ga0501033_0021306 3300049570 Bacteria 4889
350 Ga0501033_0031613 3300049570 Bacteria 3976
351 Ga0501033_0033690 3300049570 Bacteria 3845
352 Ga0501034_0002413 3300049571 Bacteria 22626
353 Ga0501034_0019134 3300049571 Bacteria 7012
354 Ga0501034_0021321 3300049571 Bacteria 6606
355 Ga0501034_0023035 3300049571 Bacteria 6346
356 Ga0501034_0029263 3300049571 Bacteria 5600
357 Ga0501036_0002141 3300049572 Bacteria 15410
358 Ga0501036_0009642 3300049572 Bacteria 7944
359 Ga0501036_0019715 3300049572 Bacteria 5662
360 Ga0501036_0038834 3300049572 Bacteria 4030
361 Ga0501036_0146964 3300049572 Bacteria 1988
362 Ga0501037_0008190 3300049573 Bacteria 7662
363 Ga0501037_0057069 3300049573 Bacteria 2851
364 Ga0501038_0005643 3300049574 Bacteria 11609
365 Ga0501038_0024412 3300049574 Bacteria 5394
366 Ga0501038_0040864 3300049574 Bacteria 4047
367 Ga0501038_0137207 3300049574 Bacteria 2003
368 Ga0501038_0211459 3300049574 Bacteria 1551
369 Ga0501039_0069947 3300049575 Bacteria 2726
370 Ga0501042_0001137 3300049578 Bacteria 15342
371 Ga0501042_0013805 3300049578 Bacteria 5502
372 Ga0501042_0113915 3300049578 Bacteria 1947
373 Ga0501043_0038571 3300049579 Bacteria 3756
374 Ga0501046_0002489 3300049580 Bacteria 17261
375 Ga0501046_0007834 3300049580 Bacteria 9371
376 Ga0501046_0206518 3300049580 Bacteria 1460
377 Ga0501047_0000182 3300049581 Bacteria 76846
378 Ga0501047_0010642 3300049581 Bacteria 8695
379 Ga0501047_0017296 3300049581 Bacteria 6904
380 Ga0501047_0035909 3300049581 Bacteria 4788
381 Ga0501047_0043008 3300049581 Bacteria 4364
382 Ga0501047_0178398 3300049581 Bacteria 1991
383 Ga0501048_0009275 3300049582 Bacteria 7391
384 Ga0501070_0004986 3300049586 Bacteria 11330
385 Ga0501070_0012026 3300049586 Bacteria 7304
386 Ga0501070_0017784 3300049586 Bacteria 5969
387 Ga0501070_0177003 3300049586 Bacteria 1756
388 Ga0501070_0227949 3300049586 Bacteria 1527
389 Ga0501073_0042426 3300049589 Bacteria 3211
390 Ga0501074_0008200 3300049590 Bacteria 7572
391 Ga0501077_0015687 3300049593 Bacteria 4771
392 Ga0501225_0006849 3300049705 Bacteria 3324
393 Ga0501080_0209990 3300049742 Bacteria 1784
394 Ga0501083_0000027 3300049744 Bacteria 117605
395 Ga0501083_0019295 3300049744 Bacteria 4749
396 Ga0501035_0002470 3300049822 Bacteria 18053
397 Ga0501035_0002656 3300049822 Bacteria 17390
398 Ga0501035_0010494 3300049822 Bacteria 8584
399 Ga0501035_0020532 3300049822 Bacteria 6067
400 Ga0501035_0090028 3300049822 Bacteria 2701
401 Ga0501035_0279490 3300049822 Bacteria 1411
402 Ga0501044_0001722 3300049823 Bacteria 25608
403 Ga0501044_0042008 3300049823 Bacteria 4759
404 Ga0501044_0043533 3300049823 Bacteria 4663
405 Ga0501044_0113990 3300049823 Bacteria 2709
406 Ga0501044_0114078 3300049823 Bacteria 2708
407 Ga0501044_0162155 3300049823 Bacteria 2211
408 Ga0501044_0205142 3300049823 Bacteria 1928
409 Ga0501045_0087496 3300049824 Bacteria 2301
410 nmdc:mga03n38_88649_c1 3300050490 Bacteria 1468
411 nmdc:mga00v17_8115_c1 3300050491 Bacteria 5635
412 nmdc:mga0k408_170092_c1 3300050493 Bacteria 1299
413 nmdc:mga06z11_4361_c1 3300050494 Bacteria 5565
414 nmdc:mga04h51_438_c1 3300050495 Bacteria 10010
415 nmdc:mga07m45_100471_c1 3300050496 Bacteria 1661
416 nmdc:mga09592_22697_c1 3300050508 Bacteria 5178
417 nmdc:mga09592_23081_c1 3300050508 Bacteria 5135
418 nmdc:mga09592_73379_c1 3300050508 Bacteria 2907
419 nmdc:mga0qj67_18818_c1 3300050509 Bacteria 5267
420 nmdc:mga08x19_110950_c1 3300050514 Bacteria 1829
421 Ga0495612_0027629 3300053078 Bacteria 2282
422 Ga0495612_0031644 3300053078 Bacteria 2134
423 Ga0500566_0009248 3300053094 Bacteria 5829
424 Ga0500640_012540 3300053095 Bacteria 3483
425 Ga0500555_006503 3300053103 Bacteria 3321
426 Ga0500597_061357 3300053120 Bacteria 1616
427 Ga0500614_009385 3300053123 Bacteria 2087
428 Ga0500568_0009617 3300053139 Bacteria 4580
429 Ga0501082_0310092 3300060353 Bacteria 1374
430 Ga0466962_0000688 3300061719 Bacteria 15035
431 Ga0466962_0000852 3300061719 Bacteria 13804
432 Ga0466962_0018210 3300061719 Bacteria 3379
433 Ga0466962_0047721 3300061719 Bacteria 2046
434 2515852055 2515154155 Bacteria 7985436
435 2547406504 2547132111 Bacteria 8013147
436 2554259571 2554235005 Bacteria 6457341
437 2585300367 2582581312 Bacteria 7308206
438 2585303503 2582581313 Bacteria 10042643
439 2585316986 2582581314 Bacteria 11452267
440 2616695596 2616644814 Bacteria 11555299
441 2616900850 2616644941 Bacteria 8510691
442 2643760239 2643221548 Bacteria 8053412
443 2643904463 2643221578 Bacteria 9213798
444 2643946576 2643221587 Bacteria 7586415
445 2644267994 2643221647 Bacteria 10741251
446 2644389072 2643221670 Bacteria 6497041
447 2644406269 2643221673 Bacteria 9196637
448 2644434380 2643221677 Bacteria 7584031
449 2644443670 2643221678 Bacteria 9540101
450 2644455888 2643221681 Bacteria 3707866
451 2644460065 2643221682 Bacteria 6743283
452 2644629600 2643221714 Bacteria 9015452
453 2645720874 2643221961 Bacteria 3919167
454 2645723879 2643221962 Bacteria 3874254
455 2676475919 2675903058 Bacteria 6822861
456 2676490633 2675903060 Bacteria 10051191
457 2729906039 2728369276 Bacteria 5610032
458 2784586723 2784132148 Bacteria 8627943
459 2785345763 2784746763 Bacteria 9783172
460 2785367126 2784746768 Bacteria 10036182
461 2786668174 2786546132 Bacteria 10419719
462 2808847632 2808606359 Bacteria 9866990
463 2808918366 2808606375 Bacteria 9466072
464 2809230290 2808606448 Bacteria 8656184
465 2811846942 2808606982 Bacteria 7791042
466 2812360343 2811994879 Bacteria 9313447
467 2812482443 2811994917 Bacteria 7761064
468 2819696342 2818991463 Bacteria 7948711
469 2827630481 2827628540 Bacteria 6858585
470 2844855356 2844852863 Bacteria 3849151
471 2852637686 2852635781 Bacteria 8251373
472 2862186275 2862178590 Bacteria 8583590
473 2862289686 2862281513 Bacteria 9621493
474 2862292440 2862290372 Bacteria 7471434
475 2862386384 2862382967 Bacteria 10317375
476 2862510393 2862507626 Bacteria 9425308
477 2862583745 2862574272 Bacteria 10567477
478 2863406998 2863404153 Bacteria 9672205
479 2867369828 2867369537 Bacteria 6501581
480 2867430053 2867428634 Bacteria 9590268
481 2867475692 2867475112 Bacteria 6909112
482 2868093255 2868088558 Bacteria 7609351
483 2870788319 2870782633 Bacteria 9624083
484 2873157706 2873151551 Bacteria 8625867
485 2873316279 2873314349 Bacteria 8512634
486 2875392667 2875391855 Bacteria 7600475
487 2877683420 2877676314 Bacteria 9512378
488 2884703665 2884693830 Bacteria 11273186
489 2895435217 2895427314 Bacteria 13147766
490 2895447345 2895442618 Bacteria 11027144
491 2912722427 2912715099 Bacteria 9460473
492 2912726131 2912723979 Bacteria 8557534
493 2912758865 2912757875 Bacteria 7940295
494 2918502494 2918501144 Bacteria 8668083
495 2919472219 2919468124 Bacteria 9133025
496 2935393597 2935390628 Bacteria 7043367
497 2946052047 2946045630 Bacteria 8527308
498 2946065545 2946064051 Bacteria 8957905
499 2946073905 2946072368 Bacteria 8999607
500 2947231864 2947224130 Bacteria 9938529
501 2954011098 2954002825 Bacteria 9173742
502 2954388667 2954380949 Bacteria 10050426
503 2954674457 2954673503 Bacteria 9685905
504 2954689675 2954682443 Bacteria 9862841
505 2954699458 2954691527 Bacteria 10720516
506 2954702760 2954701450 Bacteria 10834262
507 2954718398 2954711539 Bacteria 10867210
508 2954728368 2954721474 Bacteria 10456478
509 2954733441 2954731030 Bacteria 10243860
510 2954747264 2954740390 Bacteria 10229294
511 2954752324 2954749733 Bacteria 10366972
512 2954766379 2954759201 Bacteria 9358192
513 2966604443 2966598605 Bacteria 7676064
514 2990059602 2990059506 Bacteria 9321252
515 2990094514 2990088156 Bacteria 6657676
516 2997453984 2997451912 Bacteria 8492419
517 2997605700 2997600082 Bacteria 9896405
518 3006328040 3006321560 Bacteria 8247479
519 3006399566 3006393351 Bacteria 6615579
520 3006490468 3006486233 Bacteria 8157040
521 3006495127 3006493962 Bacteria 8825450
522 8008561287 8008558824 Bacteria 10610750
523 8008580775 8008574985 Bacteria 7815457
524 8023625001 8023623736 Bacteria 8593882
525 8025414836 8025413630 Bacteria 7014048
526 8025534183 8025530807 Bacteria 8495698
527 8047894821 8047893842 Bacteria 11723082
528 8048130377 8048127548 Bacteria 11053136
529 8048364228 8048356638 Bacteria 11044339
530 8048371840 8048369669 Bacteria 11666822
531 8048380773 8048379754 Bacteria 11877923
532 8048408140 8048406513 Bacteria 8936924
533 8054163839 8054160619 Bacteria 7783213
534 8055070183 8055066027 Bacteria 9479577
535 8055177891 8055172936 Bacteria 9305943
536 8056037719 8056037122 Bacteria 3854319
537 8056449974 8056447290 Bacteria 7680491
538 8056670559 8056667051 Bacteria 6953971
539 8056835728 8056829672 Bacteria 9045328
540 Ga0213875_10000892
541 JGI24746J21847_1000031
542 JGI25406J46586_10001754
543 JGI25160J50197_1006937
544 Ga0006562J51391_1085515
545 Ga0006562J51391_1085518
546 Ga0070658_10008171
547 Ga0070658_10089898
548 Ga0070683_100269659
549 Ga0068869_100121841
550 Ga0070680_100104476
551 Ga0070682_100089766
552 Ga0070689_100133804
553 Ga0070687_100066366
554 Ga0070661_100142545
555 Ga0070669_100013838
556 Ga0070659_100123776
557 Ga0070714_100057666
558 Ga0070714_100122001
559 Ga0070714_100225832
560 Ga0070708_100007779
561 Ga0070708_100039555
562 Ga0070678_100014093
563 Ga0068867_100050253
564 Ga0070685_10062037
565 Ga0070706_100052235
566 Ga0070707_100040545
567 Ga0070698_100029723
568 Ga0070698_100140101
569 Ga0068853_100038815
570 Ga0068853_100103820
571 Ga0070665_100032333
572 Ga0068855_100033196
573 Ga0068855_100073786
574 Ga0068854_100092696
575 Ga0068854_100132215
576 Ga0068856_100093917
577 Ga0070702_100062575
578 Ga0068852_100017250
579 Ga0068852_100115250
580 Ga0068852_100173942
581 Ga0068859_100274727
582 Ga0068864_100248217
583 Ga0068866_10136553
584 Ga0081455_10082915
585 Ga0081539_10000376
586 Ga0070717_10000032
587 Ga0075365_10032630
588 Ga0075368_10001295
589 Ga0075364_10010539
590 Ga0075429_100013448
591 Ga0075429_100025136
592 Ga0075429_100275906
593 Ga0097620_100274740
594 Ga0099826_10057660
595 Ga0105245_10000041
596 Ga0105238_10005281
597 Ga0099796_10066507
598 Ga0105239_10087569
599 Ga0157371_10228542
600 Ga0157369_10000908
601 Ga0157374_10003955
602 Ga0157378_10079821
603 Ga0163162_10086096
604 Ga0157372_10039286
605 Ga0163163_10098639
606 Ga0182008_10006324
607 Ga0182007_10000683
608 Ga0183367_1017
609 Ga0213876_10045007
610 Ga0213876_10080618
611 Ga0213875_10000073
612 Ga0213875_10000941
613 Ga0209758_1006346
614 Ga0207426_1003507
615 Ga0207426_1014365
616 Ga0207426_1019987
617 Ga0207713_1022573
618 Ga0207653_10007066
619 Ga0207710_10002798
620 Ga0207688_10011614
621 Ga0207647_10015266
622 Ga0207643_10156374
623 Ga0207705_10073846
624 Ga0207705_10308025
625 Ga0207684_10009915
626 Ga0207684_10023300
627 Ga0207695_10091095
628 Ga0207663_10114169
629 Ga0207660_10216925
630 Ga0207657_10028408
631 Ga0207649_10107502
632 Ga0207694_10098421
633 Ga0207687_10000392
634 Ga0207664_10022012
635 Ga0207664_10115528
636 Ga0207690_10146970
637 Ga0207670_10065661
638 Ga0207670_10135038
639 Ga0207670_10278348
640 Ga0207689_10023572
641 Ga0207667_10247584
642 Ga0207667_10262886
643 Ga0207667_10336919
644 Ga0207712_10021343
645 Ga0207703_10152385
646 Ga0207639_10084997
647 Ga0207639_10088647
648 Ga0207708_10062716
649 Ga0207708_10199031
650 Ga0207702_10048220
651 Ga0207641_10065028
652 Ga0207648_10057606
653 Ga0207683_10007465
654 Ga0207698_10009594
655 Ga0209813_10000503
656 Ga0268264_10361034
657 Ga0307517_10019126
658 Ga0307515_10002608
659 Ga0307515_10051008
660 Ga0265338_10061013
661 Ga0307511_10004900
662 Ga0307511_10092747
663 Ga0307512_10001963
664 Ga0307512_10137212
665 Ga0265332_10003874
666 Ga0265340_10005169
667 Ga0307513_10090705
668 Ga0307513_10215213
669 Ga0307513_10218960
670 Ga0307509_10000014
671 Ga0307509_10036124
672 Ga0307509_10086976
673 Ga0307509_10118889
674 Ga0307509_10149742
675 Ga0307508_10003886
676 Ga0307508_10227006
677 Ga0307514_10003022
678 Ga0316579_10000161
679 Ga0307516_10004071
680 Ga0307516_10017536
681 Ga0307516_10019788
682 Ga0307518_10107010
683 Ga0307406_10005617
684 Ga0307412_10131955
685 Ga0307416_100039000
686 Ga0307510_10019180
687 Ga0307510_10055554
688 Ga0307510_10057316
689 Ga0373949_0000704
690 Ga0373961_0000024
691 Ga0373925_0116449
692 Ga0395899_0028112
693 Ga0395899_0090479
694 Ga0395900_0014660
695 Ga0395900_0061529
696 Ga0395898_0061502
697 Ga0395905_0238894
698 Ga0436364_0290389
699 Ga0436364_0390119
700 Ga0436364_0778436
701 Ga0436364_0798736
702 Ga0436364_0874499
703 Ga0436364_0967991
704 Ga0436364_1520720
705 Ga0395901_0075962
706 Ga0395901_0146770
707 Ga0395901_0416003
708 Ga0436365_0600614
709 Ga0436365_1316248
710 Ga0436363_0407644
711 Ga0439436_0001570
712 Ga0439436_0005183
713 Ga0451833_1025771
714 Ga0451837_1532308
715 Ga0451853_0427650
716 Ga0451853_0459326
717 Ga0439442_007772
718 Ga0439448_0011741
719 Ga0439449_0020868
720 Ga0439454_001259
721 Ga0439455_0007951
722 Ga0439457_007177
723 Ga0450894_000076
724 Ga0450898_001492
725 Ga0450903_000046
726 Ga0450906_000281
727 Ga0439458_0006218
728 Ga0439458_0028100
729 Ga0450908_008941
730 Ga0450901_001209
731 Ga0451577_0074692
732 Ga0466969_0010080
733 Ga0466972_0002673
734 Ga0466972_0013123
735 Ga0466965_0007210
736 Ga0466966_0000230
737 Ga0466966_0005404
738 Ga0466966_0007053
739 Ga0466961_0000512
740 Ga0466961_0018359
741 Ga0466961_0021854
742 Ga0466963_0000103
743 Ga0466963_0001976
744 Ga0466963_0004004
745 Ga0466963_0111108
746 Ga0466963_0165353
747 Ga0466964_0002590
748 Ga0453684_0275432
749 Ga0466971_0000923
750 Ga0466971_0083388
751 Ga0466968_0022692
752 Ga0466970_0000790
753 Ga0466957_0000043
754 Ga0466957_0002744
755 Ga0466957_0047651
756 Ga0466960_0001086
757 Ga0466960_0143629
758 Ga0466959_0000959
759 Ga0466959_0058258
760 Ga0466959_0118935
761 Ga0466958_0000096
762 Ga0466958_0001366
763 Ga0466958_0061357
764 Ga0466967_0007319
765 Ga0466967_0095359
766 Ga0466967_0123948
767 Ga0466967_0389002
768 Ga0495617_004108
769 Ga0495592_0005445
770 Ga0495592_0035258
771 Ga0495592_0086454
772 Ga0495603_0000385
773 Ga0495603_0004799
774 Ga0495603_0014411
775 Ga0495603_0035563
776 Ga0495603_0055003
777 Ga0495629_0023749
778 Ga0495629_0024309
779 Ga0495629_0025949
780 Ga0495629_0036258
781 Ga0495629_0050282
782 Ga0495629_0068687
783 Ga0495638_0057880
784 Ga0495651_0006927
785 Ga0495651_0025601
786 Ga0495605_0006939
787 Ga0495639_0025409
788 Ga0495662_0013223
789 Ga0495662_0019753
790 Ga0495662_0022564
791 Ga0495662_0026573
792 Ga0495664_0003910
793 Ga0495594_0011889
794 Ga0495594_0016656
795 Ga0495594_0035947
796 Ga0495594_0037786
797 Ga0495594_0056702
798 Ga0495607_0005439
799 Ga0495607_0017238
800 Ga0495583_0033484
801 Ga0495583_0068857
802 Ga0495606_0018422
803 Ga0495616_0023893
804 Ga0495618_0026619
805 Ga0495618_0127959
806 Ga0495620_0018147
807 Ga0495620_0024737
808 Ga0495628_0175252
809 Ga0495630_0082663
810 Ga0495637_0076695
811 Ga0495643_0002273
812 Ga0495666_0007665
813 Ga0495652_0007948
814 Ga0495652_0012194
815 Ga0495652_0046677
816 Ga0495640_0064996
817 Ga0495640_0068885
818 Ga0495587_0003207
819 Ga0495645_0077824
820 Ga0495622_0058236
821 Ga0495622_0084631
822 Ga0495668_0009145
823 Ga0495634_0003004
824 Ga0495634_0006104
825 Ga0495625_0006692
826 Ga0495625_0022129
827 Ga0495625_0103482
828 Ga0495635_0011210
829 Ga0495635_0019909
830 Ga0495635_0149644
831 Ga0495661_0047594
832 Ga0495588_0016271
833 Ga0495588_0078749
834 Ga0495657_0009949
835 Ga0495657_0031486
836 Ga0495657_0050453
837 Ga0495599_0054967
838 Ga0495623_0021810
839 Ga0495623_0140773
840 Ga0495646_0102867
841 Ga0495613_0004494
842 Ga0495613_0007075
843 Ga0495613_0023924
844 Ga0495613_0092145
845 Ga0495613_0140827
846 Ga0495589_0007765
847 Ga0495589_0012355
848 Ga0495589_0025534
849 Ga0495589_0033119
850 Ga0495600_0034386
851 Ga0495581_0011839
852 Ga0495604_0004411
853 Ga0495604_0011150
854 Ga0495604_0106034
855 Ga0495636_0053367
856 Ga0495674_0002204
857 Ga0495672_0053138
858 Ga0495676_0001761
859 Ga0495676_0022644
860 Ga0495676_0039155
861 Ga0495676_0042629
862 Ga0495676_0088896
863 Ga0495680_0035410
864 Ga0495683_0000945
865 Ga0495687_002181
866 Ga0495687_004425
867 Ga0495687_016456
868 Ga0495687_032451
869 Ga0495685_010538
870 Ga0495685_026091
871 Ga0495681_0025946
872 Ga0495684_0077000
873 Ga0495686_0014657
874 Ga0495686_0046721
875 Ga0495593_0008603
876 Ga0495593_0039430
877 Ga0496123_0024000
878 Ga0496124_0178068
879 Ga0496125_0212071
880 Ga0495678_013192
881 Ga0501031_0031986
882 Ga0501031_0137043
883 Ga0501032_0039533
884 Ga0501032_0051886
885 Ga0501032_0077532
886 Ga0501033_0003296
887 Ga0501033_0015639
888 Ga0501033_0021306
889 Ga0501033_0031613
890 Ga0501033_0033690
891 Ga0501034_0002413
892 Ga0501034_0019134
893 Ga0501034_0021321
894 Ga0501034_0023035
895 Ga0501034_0029263
896 Ga0501036_0002141
897 Ga0501036_0009642
898 Ga0501036_0019715
899 Ga0501036_0038834
900 Ga0501036_0146964
901 Ga0501037_0008190
902 Ga0501037_0057069
903 Ga0501038_0005643
904 Ga0501038_0024412
905 Ga0501038_0040864
906 Ga0501038_0137207
907 Ga0501038_0211459
908 Ga0501039_0069947
909 Ga0501042_0001137
910 Ga0501042_0013805
911 Ga0501042_0113915
912 Ga0501043_0038571
913 Ga0501046_0002489
914 Ga0501046_0007834
915 Ga0501046_0206518
916 Ga0501047_0000182
917 Ga0501047_0010642
918 Ga0501047_0017296
919 Ga0501047_0035909
920 Ga0501047_0043008
921 Ga0501047_0178398
922 Ga0501048_0009275
923 Ga0501070_0004986
924 Ga0501070_0012026
925 Ga0501070_0017784
926 Ga0501070_0177003
927 Ga0501070_0227949
928 Ga0501073_0042426
929 Ga0501074_0008200
930 Ga0501077_0015687
931 Ga0501225_0006849
932 Ga0501080_0209990
933 Ga0501083_0000027
934 Ga0501083_0019295
935 Ga0501035_0002470
936 Ga0501035_0002656
937 Ga0501035_0010494
938 Ga0501035_0020532
939 Ga0501035_0090028
940 Ga0501035_0279490
941 Ga0501044_0001722
942 Ga0501044_0042008
943 Ga0501044_0043533
944 Ga0501044_0113990
945 Ga0501044_0114078
946 Ga0501044_0162155
947 Ga0501044_0205142
948 Ga0501045_0087496
949 nmdc:mga03n38_88649_c1
950 nmdc:mga00v17_8115_c1
951 nmdc:mga0k408_170092_c1
952 nmdc:mga06z11_4361_c1
953 nmdc:mga04h51_438_c1
954 nmdc:mga07m45_100471_c1
955 nmdc:mga09592_22697_c1
956 nmdc:mga09592_23081_c1
957 nmdc:mga09592_73379_c1
958 nmdc:mga0qj67_18818_c1
959 nmdc:mga08x19_110950_c1
960 Ga0495612_0027629
961 Ga0495612_0031644
962 Ga0500566_0009248
963 Ga0500640_012540
964 Ga0500555_006503
965 Ga0500597_061357
966 Ga0500614_009385
967 Ga0500568_0009617
968 Ga0501082_0310092
969 Ga0466962_0000688
970 Ga0466962_0000852
971 Ga0466962_0018210
972 Ga0466962_0047721
973 2515852055
974 2547406504
975 2554259571
976 2585300367
977 2585303503
978 2585316986
979 2616695596
980 2616900850
981 2643760239
982 2643904463
983 2643946576
984 2644267994
985 2644389072
986 2644406269
987 2644434380
988 2644443670
989 2644455888
990 2644460065
991 2644629600
992 2645720874
993 2645723879
994 2676475919
995 2676490633
996 2729906039
997 2784586723
998 2785345763
999 2785367126
1000 2786668174
1001 2808847632
1002 2808918366
1003 2809230290
1004 2811846942
1005 2812360343
1006 2812482443
1007 2819696342
1008 2827630481
1009 2844855356
1010 2852637686
1011 2862186275
1012 2862289686
1013 2862292440
1014 2862386384
1015 2862510393
1016 2862583745
1017 2863406998
1018 2867369828
1019 2867430053
1020 2867475692
1021 2868093255
1022 2870788319
1023 2873157706
1024 2873316279
1025 2875392667
1026 2877683420
1027 2884703665
1028 2895435217
1029 2895447345
1030 2912722427
1031 2912726131
1032 2912758865
1033 2918502494
1034 2919472219
1035 2935393597
1036 2946052047
1037 2946065545
1038 2946073905
1039 2947231864
1040 2954011098
1041 2954388667
1042 2954674457
1043 2954689675
1044 2954699458
1045 2954702760
1046 2954718398
1047 2954728368
1048 2954733441
1049 2954747264
1050 2954752324
1051 2954766379
1052 2966604443
1053 2990059602
1054 2990094514
1055 2997453984
1056 2997605700
1057 3006328040
1058 3006399566
1059 3006490468
1060 3006495127
1061 8008561287
1062 8008580775
1063 8023625001
1064 8025414836
1065 8025534183
1066 8047894821
1067 8048130377
1068 8048364228
1069 8048371840
1070 8048380773
1071 8048408140
1072 8054163839
1073 8055070183
1074 8055177891
1075 8056037719
1076 8056449974
1077 8056670559
1078 8056835728

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

92

401

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofw-assembly2.cif.gz_B crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis 0.9631 8 359
8ofw-assembly1.cif.gz_A crystal structure of the full-length dihydroorotate dehydrogenase from mycobacterium tuberculosis 0.9603 8 361
6b8s-assembly1.cif.gz_A crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn 0.9516 3 358
6b8s-assembly2.cif.gz_B crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn 0.9502 3 358
6b8s-assembly1.cif.gz_A crystal structure of dihydroorotate dehydrogenase from helicobacter pylori with bound fmn 0.9433 3 358
ID Description Score Start End Superfamily
af_P9WHL1_31_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9684 34 361 3.20.20.70
af_P9WHL1_31_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9625 34 361 3.20.20.70
6b8sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9516 3 358 3.20.20.70
af_Q2FV30_1_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9443 7 359 3.20.20.70
6b8sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9434 3 358 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A699WN18-F1-model_v4 Dihydroorotate dehydrogenase (quinone), mitochondrial (EC 1.3.5.2) 0.9884 72 196 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A5M3VZ38-F1-model_v4 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (DHOdehase) (DHOD) (DHODase) (Dihydroorotate oxidase) 0.9858 28 359 GO:0005737
GO:0005886
GO:0006207
GO:0044205
GO:0106430
AF-A0A3B9V6S3-F1-model_v4 Quinone-dependent dihydroorotate dehydrogenase 0.9858 272 359 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-T0YW00-F1-model_v4 Dihydroorotate dehydrogenase, classes 1 and 2 0.9773 151 360 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A7C7KX49-F1-model_v4 Dihydroorotate dehydrogenase (Quinone) 0.9765 269 361 GO:0004152
GO:0005737
GO:0006207
GO:0044205

Map