F461029

General Info

Members Datasets Scaffolds Average Seq Length
538 259 514 237

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_20168|Ga0400490_20168_8902_9657
Length 251
Sequence MVCFSEVNSNLTLTKSHLAGMSQTDQKPLRPIRSYVLRQGRMTEGQQRAYESLWPRYGLALDSGTLDLSQQFDRNQPVTLEIGFGNGETLSQLASHHPELNFLGIEVHGPGVGHLMLQLAEQEIQNVRILKADAMELLRHHLEPGSLSRVLLYFPDPWHKRKHHKRRIVQDEFARLVYNALIPGGLLHMATDWHDYAVQMMSVLSAHPGFINQAGERNFSPRPDSRPLTKFEQRGERLGHGVWDMIFERRH

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
7 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738543009 Luteibacter sp. OK325 Isolate Unclassified
10 2739367700 Dyella sp. YR388 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
13 2867369537 Streptomyces sp. Z26 Isolate Unclassified
14 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
17 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
18 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
19 2919085039 Luteibacter sp. 1214 Isolate Unclassified
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
95 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
162 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
163 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
164 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
165 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
166 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
169 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
180 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
181 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 1.49
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.75
Nodule 0
Rhizoplane 2.23
Rhizosphere 63.01
Stem 0
Stem Tuber 0
Unclassified 21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000189 3300001904 Bacteria 11006
2 JGI24740J21852_10013677 3300001979 Bacteria 3018
3 JGI24739J22299_10001255 3300001989 Bacteria 9510
4 JGI24737J22298_10009655 3300001990 Bacteria 3200
5 JGI25156J39149_1029667 3300002705 Bacteria 831
6 JGI25156J39149_1031282 3300002705 Bacteria 794
7 JGI25162J39368_1000467 3300002737 Bacteria 31310
8 JGI25162J39368_1000470 3300002737 Bacteria 31129
9 JGI25157J39369_1000585 3300002741 Bacteria 21521
10 JGI25157J39369_1009669 3300002741 Bacteria 1290
11 JGI25157J39369_1020808 3300002741 Bacteria 782
12 JGI25163J39215_1000495 3300002771 Bacteria 11753
13 JGI25163J39215_1001475 3300002771 Bacteria 3805
14 JGI25163J39215_1001494 3300002771 Bacteria 3743
15 JGI25164J39214_1000075 3300002772 Bacteria 97713
16 JGI25165J46597_1000178 3300003214 Bacteria 97713
17 JGI25153J46596_10012029 3300003215 Bacteria 3776
18 rootH1_10065949 3300003316 Bacteria 1524
19 rootH1_10075931 3300003316 Bacteria 1864
20 rootH2_10011229 3300003320 Bacteria 34952
21 Ga0006562J51391_1030225 3300003578 Bacteria 9210
22 Ga0006562J51391_1030231 3300003578 Bacteria 5210
23 Ga0006562J51391_1149857 3300003578 Bacteria 4449
24 Ga0006562J51391_1149858 3300003578 Bacteria 4350
25 Ga0055538_1001976 3300003751 Bacteria 3349
26 Ga0055539_1002138 3300003752 Bacteria 3193
27 Ga0055533_1000536 3300003756 Bacteria 13582
28 Ga0055533_1009085 3300003756 Bacteria 1207
29 Ga0055525_1000055 3300003759 Bacteria 215181
30 Ga0055527_1000137 3300003760 Bacteria 52010
31 Ga0055527_1000145 3300003760 Bacteria 50249
32 Ga0055535_1000112 3300003761 Bacteria 87296
33 Ga0055535_1000144 3300003761 Bacteria 75043
34 Ga0055535_1000301 3300003761 Bacteria 50253
35 Ga0055535_1001839 3300003761 Bacteria 9106
36 Ga0055542_1000056 3300003762 Bacteria 167483
37 Ga0055542_1000154 3300003762 Bacteria 87295
38 Ga0055542_1000213 3300003762 Bacteria 70811
39 Ga0055542_1000332 3300003762 Bacteria 50253
40 Ga0055542_1000594 3300003762 Bacteria 31129
41 Ga0055529_1000153 3300003763 Bacteria 97713
42 Ga0055529_1000244 3300003763 Bacteria 66990
43 Ga0055529_1000389 3300003763 Bacteria 47286
44 Ga0055543_1012776 3300004625 Bacteria 1676
45 Ga0065165_1002521 3300005262 Bacteria 15251
46 Ga0065165_1014901 3300005262 Bacteria 2995
47 Ga0065715_10254653 3300005293 Bacteria 1139
48 Ga0070658_10003415 3300005327 Bacteria 13067
49 Ga0070666_10001529 3300005335 Bacteria 14037
50 Ga0070682_100003751 3300005337 Bacteria 8447
51 Ga0070682_100007154 3300005337 Bacteria 6285
52 Ga0070660_100096461 3300005339 Bacteria 2338
53 Ga0070660_100183385 3300005339 Bacteria 1694
54 Ga0070689_100003245 3300005340 Bacteria 10792
55 Ga0070661_100014028 3300005344 Bacteria 5636
56 Ga0070661_100103381 3300005344 Bacteria 2121
57 Ga0070688_100164872 3300005365 Bacteria 1525
58 Ga0070659_100001720 3300005366 Bacteria 15740
59 Ga0070659_100027924 3300005366 Bacteria 4352
60 Ga0070659_100042622 3300005366 Bacteria 3548
61 Ga0070714_100123114 3300005435 Bacteria 2309
62 Ga0070713_100017047 3300005436 Bacteria 5480
63 Ga0070700_100396964 3300005441 Bacteria 1036
64 Ga0070663_100273215 3300005455 Bacteria 1344
65 Ga0070681_10044587 3300005458 Bacteria 4440
66 Ga0070681_10055157 3300005458 Bacteria 3958
67 Ga0070679_100248385 3300005530 Bacteria 1736
68 Ga0070679_100323022 3300005530 Bacteria 1492
69 Ga0068853_100153977 3300005539 Bacteria 2070
70 Ga0070696_100001906 3300005546 Bacteria 13725
71 Ga0070696_100003675 3300005546 Bacteria 10227
72 Ga0070696_100063736 3300005546 Bacteria 2582
73 Ga0070693_100003911 3300005547 Bacteria 6986
74 Ga0070693_100025840 3300005547 Bacteria 3162
75 Ga0070693_100329228 3300005547 Bacteria 1039
76 Ga0068855_100011864 3300005563 Bacteria 10536
77 Ga0068855_100440359 3300005563 Bacteria 1423
78 Ga0068855_100508429 3300005563 Bacteria 1308
79 Ga0068855_100610411 3300005563 Bacteria 1175
80 Ga0068857_100000206 3300005577 Bacteria 38366
81 Ga0068857_100078516 3300005577 Bacteria 2946
82 Ga0068854_100015069 3300005578 Bacteria 5111
83 Ga0068854_100254497 3300005578 Bacteria 1404
84 Ga0068856_100000524 3300005614 Bacteria 42396
85 Ga0068856_100004476 3300005614 Bacteria 13905
86 Ga0068852_100235437 3300005616 Bacteria 1747
87 Ga0068851_10037211 3300005834 Bacteria 2439
88 Ga0068858_100089515 3300005842 Bacteria 2864
89 Ga0068858_100149125 3300005842 Bacteria 2198
90 Ga0068860_100150461 3300005843 Bacteria 2241
91 Ga0105240_10000868 3300009093 Bacteria 54479
92 Ga0105240_10001058 3300009093 Bacteria 48723
93 Ga0105240_10021448 3300009093 Bacteria 8589
94 Ga0105240_10062038 3300009093 Bacteria 4655
95 Ga0105240_10191365 3300009093 Bacteria 2406
96 Ga0105240_10563629 3300009093 Bacteria 1259
97 Ga0105241_10390140 3300009174 Bacteria 1219
98 Ga0105237_10000011 3300009545 Bacteria 307361
99 Ga0105237_10000036 3300009545 Bacteria 191142
100 Ga0105237_10421553 3300009545 Bacteria 1340
101 Ga0105238_10004912 3300009551 Bacteria 13230
102 Ga0105238_10041685 3300009551 Bacteria 4650
103 Ga0105238_10095806 3300009551 Bacteria 2954
104 Ga0105238_10145958 3300009551 Bacteria 2342
105 Ga0105238_10290866 3300009551 Bacteria 1616
106 Ga0105238_10426315 3300009551 Bacteria 1322
107 Ga0105238_10492027 3300009551 Bacteria 1226
108 Ga0105249_10129603 3300009553 Bacteria 2406
109 Ga0105147_102133 3300009982 Bacteria 1629
110 Ga0105239_10000027 3300010375 Bacteria 248028
111 Ga0105239_10004878 3300010375 Bacteria 15878
112 Ga0157314_1000079 3300012500 Bacteria 10184
113 Ga0157373_10011560 3300013100 Bacteria 6488
114 Ga0157373_10029897 3300013100 Bacteria 3923
115 Ga0157373_10049650 3300013100 Bacteria 2989
116 Ga0157373_10438050 3300013100 Bacteria 939
117 Ga0157371_10004612 3300013102 Bacteria 11960
118 Ga0157371_10005204 3300013102 Bacteria 11061
119 Ga0157371_10022743 3300013102 Bacteria 4586
120 Ga0157370_10000045 3300013104 Bacteria 127627
121 Ga0157370_10001442 3300013104 Bacteria 29400
122 Ga0157370_10001742 3300013104 Bacteria 26774
123 Ga0157370_10080985 3300013104 Bacteria 3056
124 Ga0157370_10091992 3300013104 Bacteria 2847
125 Ga0157370_10120606 3300013104 Bacteria 2448
126 Ga0157369_10005769 3300013105 Bacteria 14392
127 Ga0157369_10010507 3300013105 Bacteria 10538
128 Ga0157369_10376345 3300013105 Bacteria 1474
129 Ga0163162_10010764 3300013306 Bacteria 8897
130 Ga0163162_10465195 3300013306 Bacteria 1396
131 Ga0157372_10026145 3300013307 Bacteria 6351
132 Ga0157372_10061408 3300013307 Bacteria 4208
133 Ga0157372_10110842 3300013307 Bacteria 3143
134 Ga0182008_10002263 3300014497 Bacteria 12158
135 Ga0182008_10049293 3300014497 Bacteria 2090
136 Ga0157376_10003819 3300014969 Bacteria 10415
137 Ga0182006_1000556 3300015261 Bacteria 27959
138 Ga0182006_1000731 3300015261 Bacteria 22632
139 Ga0182006_1050168 3300015261 Bacteria 1608
140 Ga0182007_10051705 3300015262 Bacteria 1355
141 Ga0182005_1000113 3300015265 Bacteria 58004
142 Ga0182005_1008360 3300015265 Bacteria 3054
143 Ga0183369_1004 3300015685 Bacteria 539301
144 Ga0183368_1003 3300015687 Bacteria 1276390
145 Ga0163161_10029319 3300017792 Bacteria 3912
146 Ga0206356_11307117 3300020070 Bacteria 2919
147 Ga0206353_11632685 3300020082 Bacteria 2588
148 Ga0209435_105592 3300025206 Bacteria 1407
149 Ga0209760_101498 3300025207 Bacteria 2435
150 Ga0209784_100104 3300025224 Bacteria 98272
151 Ga0209674_100033 3300025226 Bacteria 423450
152 Ga0209674_100077 3300025226 Bacteria 206312
153 Ga0209674_100542 3300025226 Bacteria 15190
154 Ga0209672_100004 3300025228 Bacteria 1467504
155 Ga0209672_100022 3300025228 Bacteria 374313
156 Ga0209672_101785 3300025228 Bacteria 6633
157 Ga0209563_100076 3300025230 Bacteria 215269
158 Ga0207427_100070 3300025231 Bacteria 160908
159 Ga0207427_100427 3300025231 Bacteria 23649
160 Ga0209437_100005 3300025233 Bacteria 1071596
161 Ga0209437_100059 3300025233 Bacteria 355048
162 Ga0209437_100141 3300025233 Bacteria 166553
163 Ga0209437_105492 3300025233 Bacteria 2156
164 Ga0209258_100003 3300025242 Bacteria 1467504
165 Ga0209258_100004 3300025242 Bacteria 1376422
166 Ga0209258_100034 3300025242 Bacteria 437372
167 Ga0209258_100137 3300025242 Bacteria 167913
168 Ga0209258_100564 3300025242 Bacteria 32099
169 Ga0209646_1000849 3300025246 Bacteria 10240
170 Ga0209026_1000017 3300025250 Bacteria 385214
171 Ga0209026_1000087 3300025250 Bacteria 184044
172 Ga0209026_1000176 3300025250 Bacteria 97745
173 Ga0209026_1000944 3300025250 Bacteria 14626
174 Ga0209026_1000945 3300025250 Bacteria 14598
175 Ga0209677_102806 3300025253 Bacteria 6169
176 Ga0209148_1000001 3300025254 Bacteria 2545271
177 Ga0209148_1000002 3300025254 Bacteria 2399500
178 Ga0209148_1000025 3300025254 Bacteria 663262
179 Ga0209148_1000083 3300025254 Bacteria 270142
180 Ga0209148_1000137 3300025254 Bacteria 168097
181 Ga0209148_1002944 3300025254 Bacteria 5160
182 Ga0209759_1000581 3300025256 Bacteria 35995
183 Ga0209759_1011539 3300025256 Bacteria 2504
184 Ga0209759_1040442 3300025256 Bacteria 809
185 Ga0209129_1005245 3300025258 Bacteria 4683
186 Ga0209233_1000002 3300025261 Bacteria 2501366
187 Ga0209233_1000011 3300025261 Bacteria 1071611
188 Ga0209233_1000273 3300025261 Bacteria 73280
189 Ga0209233_1040647 3300025261 Bacteria 1010
190 Ga0209455_1000004 3300025272 Bacteria 1467504
191 Ga0209455_1000019 3300025272 Bacteria 705658
192 Ga0209455_1000084 3300025272 Bacteria 253164
193 Ga0209455_1000318 3300025272 Bacteria 47836
194 Ga0209455_1009615 3300025272 Bacteria 2525
195 Ga0209455_1020803 3300025272 Bacteria 1289
196 Ga0209758_1001923 3300025297 Bacteria 22600
197 Ga0209758_1049275 3300025297 Bacteria 1489
198 Ga0207426_1028934 3300025302 Bacteria 1833
199 Ga0207680_10000002 3300025903 Bacteria 1018646
200 Ga0207647_10000015 3300025904 Bacteria 138626
201 Ga0207647_10040235 3300025904 Bacteria 2945
202 Ga0207647_10051071 3300025904 Bacteria 2557
203 Ga0207705_10011574 3300025909 Bacteria 6378
204 Ga0207705_10018718 3300025909 Bacteria 4954
205 Ga0207654_10115427 3300025911 Bacteria 1677
206 Ga0207654_10133427 3300025911 Bacteria 1574
207 Ga0207707_10042285 3300025912 Bacteria 3978
208 Ga0207707_10134000 3300025912 Bacteria 2166
209 Ga0207707_10158000 3300025912 Bacteria 1982
210 Ga0207695_10000441 3300025913 Bacteria 90937
211 Ga0207695_10000743 3300025913 Bacteria 63072
212 Ga0207695_10000938 3300025913 Bacteria 52009
213 Ga0207695_10002762 3300025913 Bacteria 25579
214 Ga0207695_10034717 3300025913 Bacteria 5480
215 Ga0207671_10000011 3300025914 Bacteria 530349
216 Ga0207671_10001404 3300025914 Bacteria 28043
217 Ga0207660_10152487 3300025917 Bacteria 1777
218 Ga0207657_10043333 3300025919 Bacteria 3965
219 Ga0207657_10072939 3300025919 Bacteria 2902
220 Ga0207657_10140596 3300025919 Bacteria 1972
221 Ga0207657_10306659 3300025919 Bacteria 1257
222 Ga0207649_10072310 3300025920 Bacteria 2206
223 Ga0207694_10000109 3300025924 Bacteria 86216
224 Ga0207694_10027377 3300025924 Bacteria 4341
225 Ga0207694_10052712 3300025924 Bacteria 3153
226 Ga0207694_10084895 3300025924 Bacteria 2491
227 Ga0207694_10105864 3300025924 Bacteria 2233
228 Ga0207694_10193138 3300025924 Bacteria 1655
229 Ga0207694_10252240 3300025924 Bacteria 1444
230 Ga0207700_10013351 3300025928 Bacteria 5340
231 Ga0207664_10001631 3300025929 Bacteria 14777
232 Ga0207664_10629260 3300025929 Bacteria 964
233 Ga0207690_10003443 3300025932 Bacteria 9445
234 Ga0207690_10004600 3300025932 Bacteria 8157
235 Ga0207690_10015083 3300025932 Bacteria 4678
236 Ga0207690_10026807 3300025932 Bacteria 3633
237 Ga0207690_10030359 3300025932 Bacteria 3447
238 Ga0207690_10066171 3300025932 Bacteria 2474
239 Ga0207706_10566924 3300025933 Bacteria 977
240 Ga0207670_10010630 3300025936 Bacteria 5309
241 Ga0207667_10000224 3300025949 Bacteria 79334
242 Ga0207667_10000240 3300025949 Bacteria 76766
243 Ga0207667_10006504 3300025949 Bacteria 14138
244 Ga0207667_10072342 3300025949 Bacteria 3584
245 Ga0207667_10312456 3300025949 Bacteria 1605
246 Ga0207667_10574743 3300025949 Bacteria 1138
247 Ga0207668_10226770 3300025972 Bacteria 1504
248 Ga0207640_10000115 3300025981 Bacteria 60633
249 Ga0207640_10032467 3300025981 Bacteria 3238
250 Ga0207640_10440992 3300025981 Bacteria 1071
251 Ga0207639_10089462 3300026041 Bacteria 2460
252 Ga0207678_10018000 3300026067 Bacteria 6207
253 Ga0207678_10075860 3300026067 Bacteria 2880
254 Ga0207678_10170218 3300026067 Bacteria 1860
255 Ga0207678_10270513 3300026067 Bacteria 1457
256 Ga0207708_10173825 3300026075 Bacteria 1707
257 Ga0207702_10000717 3300026078 Bacteria 35600
258 Ga0207702_10001870 3300026078 Bacteria 20641
259 Ga0207674_10003554 3300026116 Bacteria 19020
260 Ga0207674_10049229 3300026116 Bacteria 4311
261 Ga0207674_10085030 3300026116 Bacteria 3160
262 Ga0207698_10303450 3300026142 Bacteria 1487
263 Ga0268266_10000004 3300028379 Bacteria 1495817
264 Ga0268264_10050853 3300028381 Bacteria 3452
265 Ga0316575_10039534 3300031665 Bacteria 1862
266 Ga0316579_10060337 3300031691 Bacteria 1784
267 Ga0316576_10003427 3300031727 Bacteria 9282
268 Ga0316578_10041528 3300031728 Bacteria 2664
269 Ga0316577_10354570 3300031733 Bacteria 833
270 Ga0307412_10002850 3300031911 Bacteria 9592
271 Ga0316580_10069305 3300032139 Bacteria 1080
272 Ga0307510_10012239 3300033180 Bacteria 10170
273 Ga0316596_1012750 3300033541 Bacteria 2071
274 Ga0316596_1037488 3300033541 Bacteria 1268
275 Ga0316574_0053262 3300035398 Bacteria 2525
276 Ga0316574_0138644 3300035398 Bacteria 1567
277 Ga0316582_0252074 3300036647 Bacteria 1210
278 Ga0316582_0406893 3300036647 Bacteria 937
279 Ga0316584_0042708 3300036712 Bacteria 3379
280 Ga0395899_0087310 3300037312 Bacteria 2264
281 Ga0395899_0108215 3300037312 Bacteria 2000
282 Ga0395899_0147046 3300037312 Bacteria 1672
283 Ga0395899_0211269 3300037312 Bacteria 1348
284 Ga0395900_0000049 3300037418 Bacteria 226847
285 Ga0395900_0001436 3300037418 Bacteria 28442
286 Ga0395898_0000023 3300037466 Bacteria 379477
287 Ga0395898_0000110 3300037466 Bacteria 217100
288 Ga0395898_0010942 3300037466 Bacteria 9461
289 Ga0395898_0114596 3300037466 Bacteria 2583
290 Ga0395898_0419368 3300037466 Bacteria 1275
291 Ga0395901_0001147 3300038443 Bacteria 28066
292 Ga0395901_0002793 3300038443 Bacteria 17608
293 Ga0395901_0016735 3300038443 Bacteria 7471
294 Ga0395901_0165225 3300038443 Bacteria 2324
295 Ga0395901_0232261 3300038443 Bacteria 1925
296 Ga0395901_0361521 3300038443 Bacteria 1497
297 Ga0395901_0602558 3300038443 Bacteria 1107
298 Ga0400484_14564 3300038725 Bacteria 28798
299 Ga0400490_07722 3300038726 Bacteria 11849
300 Ga0400490_20168 3300038726 Bacteria 21157
301 Ga0400490_27164 3300038726 Bacteria 2993
302 Ga0400490_28918 3300038726 Bacteria 6275
303 Ga0400491_18452 3300038727 Bacteria 4635
304 Ga0400491_23834 3300038727 Bacteria 1685
305 Ga0400485_01673 3300038735 Bacteria 11106
306 Ga0400488_02478 3300038741 Bacteria 2896
307 Ga0400488_14383 3300038741 Bacteria 13219
308 Ga0400488_19806 3300038741 Bacteria 8174
309 Ga0400488_28601 3300038741 Bacteria 1018
310 Ga0400488_37047 3300038741 Bacteria 5720
311 Ga0400486_19285 3300038742 Bacteria 3461
312 Ga0400486_19286 3300038742 Bacteria 3712
313 Ga0400486_32675 3300038742 Bacteria 22022
314 Ga0400483_022947 3300039062 Bacteria 4784
315 Ga0400483_026660 3300039062 Bacteria 1232
316 Ga0400483_040947 3300039062 Bacteria 12683
317 Ga0400483_071977 3300039062 Bacteria 8745
318 Ga0400483_074848 3300039062 Bacteria 7626
319 Ga0400483_108526 3300039062 Unclassified 1530
320 Ga0400483_188582 3300039062 Bacteria 6214
321 Ga0400483_219939 3300039062 Bacteria 14250
322 Ga0400483_238681 3300039062 Bacteria 2355
323 Ga0400483_279935 3300039062 Bacteria 3366
324 Ga0400489_18784 3300039093 Bacteria 1111
325 Ga0400487_17506 3300039110 Bacteria 28809
326 Ga0400487_54617 3300039110 Bacteria 1593
327 Ga0400487_60361 3300039110 Bacteria 12827
328 Ga0400487_65521 3300039110 Bacteria 2249
329 Ga0439436_0000007 3300041404 Bacteria 120812
330 Ga0439465_0003807 3300041413 Bacteria 4922
331 Ga0451793_1067073 3300041452 Bacteria 2486
332 Ga0439445_0016827 3300042004 Bacteria 1803
333 Ga0450908_000082 3300042184 Bacteria 19349
334 Ga0439459_0035372 3300042438 Bacteria 1037
335 Ga0451577_0271330 3300042876 Bacteria 1536
336 Ga0466988_0056125 3300044536 Bacteria 2317
337 Ga0466969_0005638 3300044656 Bacteria 6656
338 Ga0466969_0093695 3300044656 Bacteria 1420
339 Ga0466975_0106437 3300044661 Bacteria 1993
340 Ga0466989_0089714 3300044663 Bacteria 1891
341 Ga0466982_0000001 3300044672 Bacteria 514662
342 Ga0466982_0000083 3300044672 Bacteria 24784
343 Ga0466966_0011055 3300044684 Bacteria 5991
344 Ga0466966_0047007 3300044684 Bacteria 2753
345 Ga0466961_0009199 3300044693 Bacteria 6290
346 Ga0466961_0010943 3300044693 Bacteria 5796
347 Ga0466961_0027090 3300044693 Bacteria 3684
348 Ga0466961_0117056 3300044693 Bacteria 1674
349 Ga0466961_0292205 3300044693 Bacteria 996
350 Ga0466971_0003222 3300044719 Bacteria 6964
351 Ga0466971_0005044 3300044719 Bacteria 5716
352 Ga0466971_0125359 3300044719 Bacteria 1190
353 Ga0466968_0002495 3300044735 Bacteria 6754
354 Ga0466968_0005952 3300044735 Bacteria 4572
355 Ga0466968_0073208 3300044735 Bacteria 1495
356 Ga0466970_0125999 3300044765 Bacteria 1404
357 Ga0466957_0091245 3300044842 Bacteria 1909
358 Ga0466960_0069248 3300044901 Bacteria 1752
359 Ga0466959_0000022 3300045049 Bacteria 125849
360 Ga0466959_0011063 3300045049 Bacteria 6475
361 Ga0466959_0012887 3300045049 Bacteria 6052
362 Ga0466959_0098822 3300045049 Bacteria 2090
363 Ga0451576_0000401 3300045051 Bacteria 101008
364 Ga0466958_0004682 3300045836 Bacteria 7260
365 Ga0466958_0047620 3300045836 Bacteria 2588
366 Ga0495617_000149 3300046452 Bacteria 44892
367 Ga0495617_000785 3300046452 Bacteria 15390
368 Ga0495638_0000071 3300046460 Bacteria 166300
369 Ga0495638_0000152 3300046460 Bacteria 109586
370 Ga0495638_0000378 3300046460 Bacteria 55320
371 Ga0495638_0001285 3300046460 Bacteria 23401
372 Ga0495638_0017990 3300046460 Bacteria 4703
373 Ga0495650_0000074 3300046471 Bacteria 251346
374 Ga0495650_0000112 3300046471 Bacteria 197339
375 Ga0495650_0000838 3300046471 Bacteria 37106
376 Ga0495584_0000591 3300046491 Bacteria 24427
377 Ga0495585_0000063 3300046492 Bacteria 109530
378 Ga0495585_0008265 3300046492 Bacteria 6318
379 Ga0495607_0000029 3300046501 Bacteria 155005
380 Ga0495607_0000061 3300046501 Bacteria 108427
381 Ga0495607_0029914 3300046501 Bacteria 3350
382 Ga0495583_0029269 3300046506 Bacteria 2696
383 Ga0495606_0000546 3300046507 Bacteria 60458
384 Ga0495606_0001622 3300046507 Bacteria 29369
385 Ga0495606_0005106 3300046507 Bacteria 12757
386 Ga0495610_0000944 3300046512 Bacteria 26960
387 Ga0495610_0007827 3300046512 Bacteria 7037
388 Ga0495616_0000128 3300046513 Bacteria 66249
389 Ga0495616_0009336 3300046513 Bacteria 5747
390 Ga0495620_0000218 3300046515 Bacteria 43335
391 Ga0495620_0001660 3300046515 Bacteria 13145
392 Ga0495631_0000098 3300046518 Bacteria 58396
393 Ga0495631_0000749 3300046518 Bacteria 20780
394 Ga0495631_0173961 3300046518 Bacteria 923
395 Ga0495632_0000014 3300046519 Bacteria 243913
396 Ga0495632_0003820 3300046519 Bacteria 10480
397 Ga0495632_0023324 3300046519 Bacteria 3306
398 Ga0495632_0138140 3300046519 Bacteria 1131
399 Ga0495643_0145634 3300046522 Bacteria 1177
400 Ga0495648_0000643 3300046524 Bacteria 37243
401 Ga0495648_0001982 3300046524 Bacteria 19461
402 Ga0495609_0014074 3300046538 Bacteria 3767
403 Ga0495622_0025937 3300046557 Bacteria 2738
404 Ga0495668_0104758 3300046616 Bacteria 1547
405 Ga0495611_0000003 3300046648 Bacteria 395679
406 Ga0495611_0000014 3300046648 Bacteria 130151
407 Ga0495611_0170446 3300046648 Bacteria 1017
408 Ga0495625_0000019 3300046660 Bacteria 298330
409 Ga0495625_0023863 3300046660 Bacteria 4666
410 Ga0495625_0170500 3300046660 Bacteria 1453
411 Ga0495661_0000703 3300046665 Bacteria 33156
412 Ga0495661_0060014 3300046665 Bacteria 2261
413 Ga0495588_0051171 3300046674 Bacteria 2127
414 Ga0495670_0004940 3300046691 Bacteria 6549
415 Ga0495670_0005491 3300046691 Bacteria 6221
416 Ga0495671_0000549 3300046692 Bacteria 28132
417 Ga0495649_0015836 3300046694 Bacteria 4285
418 Ga0495589_0000018 3300046794 Bacteria 204851
419 Ga0495660_0000122 3300046810 Bacteria 85116
420 Ga0495660_0000585 3300046810 Bacteria 29006
421 Ga0495683_0002990 3300047323 Bacteria 9972
422 Ga0495679_000017 3300047446 Bacteria 263230
423 Ga0495673_0000004 3300047469 Bacteria 1354526
424 Ga0495673_0000347 3300047469 Bacteria 58250
425 Ga0495673_0001611 3300047469 Bacteria 17516
426 Ga0495686_0000024 3300047472 Bacteria 400343
427 Ga0495686_0000409 3300047472 Bacteria 67869
428 Ga0495686_0009114 3300047472 Bacteria 7190
429 Ga0496100_0023508 3300048903 Bacteria 3745
430 Ga0496101_0001464 3300048904 Bacteria 14105
431 Ga0496101_0048998 3300048904 Bacteria 3037
432 Ga0496102_0268092 3300048905 Bacteria 1610
433 Ga0496104_0283594 3300048907 Bacteria 1569
434 Ga0496105_0004981 3300048908 Bacteria 10047
435 Ga0496107_0502367 3300048910 Bacteria 899
436 Ga0496113_0037709 3300048916 Bacteria 3549
437 Ga0496115_0000008 3300048918 Bacteria 237485
438 Ga0496115_0000366 3300048918 Bacteria 37567
439 Ga0496115_0058091 3300048918 Bacteria 3112
440 Ga0496116_0087966 3300048919 Bacteria 1900
441 Ga0496116_0185725 3300048919 Bacteria 1107
442 Ga0496117_0016445 3300048920 Bacteria 6245
443 Ga0496117_0052233 3300048920 Bacteria 2881
444 Ga0496117_0072274 3300048920 Bacteria 2307
445 Ga0496118_0001137 3300048921 Bacteria 40981
446 Ga0496118_0002106 3300048921 Bacteria 27904
447 Ga0496118_0003206 3300048921 Bacteria 20878
448 Ga0496118_0004111 3300048921 Bacteria 17615
449 Ga0496118_0067959 3300048921 Bacteria 2591
450 Ga0496118_0185333 3300048921 Bacteria 1252
451 Ga0496119_0000235 3300048922 Bacteria 77921
452 Ga0496119_0009595 3300048922 Bacteria 8263
453 Ga0496119_0045574 3300048922 Bacteria 2747
454 Ga0496120_0000208 3300048923 Bacteria 100328
455 Ga0496120_0000282 3300048923 Bacteria 85605
456 Ga0496121_0000109 3300048924 Bacteria 187307
457 Ga0496121_0000480 3300048924 Bacteria 77305
458 Ga0496121_0000708 3300048924 Bacteria 61851
459 Ga0496121_0003276 3300048924 Bacteria 23241
460 Ga0496121_0033300 3300048924 Bacteria 4666
461 Ga0496121_0049169 3300048924 Bacteria 3579
462 Ga0496121_0199357 3300048924 Bacteria 1428
463 Ga0496121_0220434 3300048924 Bacteria 1336
464 Ga0496121_0241791 3300048924 Bacteria 1257
465 Ga0496122_0011366 3300048925 Bacteria 9025
466 Ga0496123_0004298 3300048926 Bacteria 15128
467 Ga0496123_0078655 3300048926 Bacteria 2019
468 Ga0496124_0000245 3300048927 Bacteria 104910
469 Ga0496125_0000118 3300048928 Bacteria 176551
470 Ga0496125_0021779 3300048928 Bacteria 5964
471 Ga0496126_0001680 3300048929 Bacteria 33123
472 Ga0496126_0009111 3300048929 Bacteria 10598
473 Ga0496126_0039239 3300048929 Bacteria 4396
474 Ga0496126_0049199 3300048929 Bacteria 3849
475 Ga0495678_000210 3300049459 Bacteria 68186
476 Ga0495678_044542 3300049459 Bacteria 1754
477 Ga0495682_0000746 3300049460 Bacteria 21023
478 Ga0495682_0001629 3300049460 Bacteria 11554
479 Ga0495682_0078303 3300049460 Bacteria 1189
480 Ga0501032_0036312 3300049569 Bacteria 3364
481 Ga0501032_0352953 3300049569 Bacteria 947
482 Ga0501033_0001213 3300049570 Bacteria 23160
483 Ga0501033_0025106 3300049570 Bacteria 4490
484 Ga0501034_0087686 3300049571 Bacteria 3111
485 Ga0501034_0124348 3300049571 Bacteria 2565
486 Ga0501037_0338870 3300049573 Bacteria 1039
487 Ga0501037_0417720 3300049573 Bacteria 918
488 Ga0501042_0474318 3300049578 Bacteria 908
489 Ga0501043_0022547 3300049579 Bacteria 4937
490 Ga0501043_0025717 3300049579 Bacteria 4618
491 Ga0501043_0222419 3300049579 Bacteria 1460
492 Ga0501043_0432167 3300049579 Bacteria 991
493 Ga0501043_0602293 3300049579 Bacteria 811
494 Ga0501046_0003546 3300049580 Bacteria 14294
495 Ga0501046_0222630 3300049580 Bacteria 1396
496 Ga0501047_0004745 3300049581 Bacteria 12781
497 Ga0501047_0312688 3300049581 Bacteria 1411
498 Ga0501047_0428457 3300049581 Bacteria 1154
499 Ga0501047_0660322 3300049581 Bacteria 864
500 Ga0501048_0009611 3300049582 Bacteria 7256
501 Ga0501070_0087812 3300049586 Bacteria 2574
502 Ga0501070_0220283 3300049586 Bacteria 1556
503 Ga0501035_0040280 3300049822 Bacteria 4223
504 Ga0501035_0044886 3300049822 Bacteria 3977
505 Ga0501035_0600952 3300049822 Bacteria 896
506 Ga0501044_0180877 3300049823 Bacteria 2075
507 Ga0501044_0368515 3300049823 Bacteria 1353
508 Ga0501044_0638729 3300049823 Bacteria 954
509 Ga0500643_000029 3300053087 Bacteria 211149
510 Ga0500555_000067 3300053103 Bacteria 52543
511 Ga0500645_000177 3300053730 Bacteria 50147
512 Ga0466962_0000447 3300061719 Bacteria 17893
513 Ga0466962_0015872 3300061719 Bacteria 3634
514 Ga0466962_0024392 3300061719 Bacteria 2905

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0138644 Ga0316574_0138644_465_1166 209
2 3300039062 Ga0400483_108526 Ga0400483_108526_727_1356 209
3 3300005441 Ga0070700_100396964 Ga0070700_1003969642 210
4 3300026075 Ga0207708_10173825 Ga0207708_101738252 210
5 3300033541 Ga0316596_1012750 Ga0316596_10127502 210
6 3300036647 Ga0316582_0252074 Ga0316582_0252074_518_1150 210
7 3300038735 Ga0400485_01673 Ga0400485_01673_7812_8444 210
8 3300038741 Ga0400488_28601 Ga0400488_28601_77_709 210
9 3300038741 Ga0400488_37047 Ga0400488_37047_4637_5269 210
10 3300038742 Ga0400486_32675 Ga0400486_32675_18686_19318 210
11 3300039110 Ga0400487_17506 Ga0400487_17506_9547_10179 210
12 3300039110 Ga0400487_60361 Ga0400487_60361_2691_3323 210
13 3300031665 Ga0316575_10039534 Ga0316575_100395342 212
14 3300038725 Ga0400484_14564 Ga0400484_14564_14128_14826 212
15 3300031727 Ga0316576_10003427 Ga0316576_100034273 215
16 3300036712 Ga0316584_0042708 Ga0316584_0042708_1198_1851 215
17 3300005293 Ga0065715_10254653 Ga0065715_102546531 216
18 3300038727 Ga0400491_18452 Ga0400491_18452_3435_4130 216
19 3300005530 Ga0070679_100323022 Ga0070679_1003230222 218
20 3300013100 Ga0157373_10438050 Ga0157373_104380502 218
21 3300013104 Ga0157370_10091992 Ga0157370_100919922 218
22 3300005546 Ga0070696_100063736 Ga0070696_1000637362 221
23 3300042004 Ga0439445_0016827 Ga0439445_0016827_625_1359 224
24 3300039062 Ga0400483_071977 Ga0400483_071977_6703_7383 225
25 3300039093 Ga0400489_18784 Ga0400489_18784_316_996 225
26 iso_pu_bacteria 2894414249 2894417141 225
27 3300038726 Ga0400490_27164 Ga0400490_27164_959_1642 226
28 3300038727 Ga0400491_23834 Ga0400491_23834_733_1416 226
29 3300038741 Ga0400488_02478 Ga0400488_02478_2051_2734 226
30 3300038742 Ga0400486_19285 Ga0400486_19285_1503_2186 226
31 3300038742 Ga0400486_19286 Ga0400486_19286_1503_2186 226
32 3300039110 Ga0400487_65521 Ga0400487_65521_117_800 226
33 3300039062 Ga0400483_022947 Ga0400483_022947_1217_1906 227
34 3300039062 Ga0400483_040947 Ga0400483_040947_8725_9414 227
35 3300039062 Ga0400483_219939 Ga0400483_219939_6730_7419 227
36 3300039062 Ga0400483_238681 Ga0400483_238681_1105_1794 227
37 3300009982 Ga0105147_102133 Ga0105147_1021332 228
38 3300038726 Ga0400490_07722 Ga0400490_07722_6525_7235 228
39 3300038726 Ga0400490_28918 Ga0400490_28918_4452_5144 228
40 3300038741 Ga0400488_14383 Ga0400488_14383_11758_12468 228
41 3300038741 Ga0400488_19806 Ga0400488_19806_5526_6218 228
42 3300039062 Ga0400483_026660 Ga0400483_026660_272_964 228
43 3300039062 Ga0400483_074848 Ga0400483_074848_5631_6320 228
44 3300039062 Ga0400483_188582 Ga0400483_188582_1958_2647 228
45 3300039062 Ga0400483_279935 Ga0400483_279935_1275_1985 228
46 3300039110 Ga0400487_54617 Ga0400487_54617_146_856 228
47 3300038443 Ga0395901_0002793 Ga0395901_0002793_948_1643 229
48 3300038726 Ga0400490_20168 Ga0400490_20168_8902_9657 229
49 iso_pu_bacteria 2643221685 2644478850 229
50 iso_pu_bacteria 2818991440 2819566298 229
51 iso_pu_bacteria 2904463128 2904466574 229
52 iso_pu_bacteria 2939611941 2939613038 229
53 3300003320 rootH2_10011229 rootH2_1001122916 230
54 3300005327 Ga0070658_10003415 Ga0070658_100034158 230
55 3300005335 Ga0070666_10001529 Ga0070666_100015299 230
56 3300005339 Ga0070660_100183385 Ga0070660_1001833852 230
57 3300005344 Ga0070661_100014028 Ga0070661_1000140288 230
58 3300005366 Ga0070659_100027924 Ga0070659_1000279243 230
59 3300005842 Ga0068858_100149125 Ga0068858_1001491252 230
60 3300005843 Ga0068860_100150461 Ga0068860_1001504612 230
61 3300009551 Ga0105238_10004912 Ga0105238_1000491211 230
62 3300013100 Ga0157373_10029897 Ga0157373_100298972 230
63 3300013306 Ga0163162_10010764 Ga0163162_100107642 230
64 3300025903 Ga0207680_10000002 Ga0207680_10000002155 230
65 3300025909 Ga0207705_10011574 Ga0207705_100115742 230
66 3300025909 Ga0207705_10018718 Ga0207705_100187182 230
67 3300025919 Ga0207657_10306659 Ga0207657_103066591 230
68 3300025920 Ga0207649_10072310 Ga0207649_100723102 230
69 3300025924 Ga0207694_10000109 Ga0207694_100001097 230
70 3300025932 Ga0207690_10004600 Ga0207690_100046006 230
71 3300025932 Ga0207690_10015083 Ga0207690_100150832 230
72 3300025933 Ga0207706_10566924 Ga0207706_105669241 230
73 3300025949 Ga0207667_10072342 Ga0207667_100723422 230
74 3300025949 Ga0207667_10574743 Ga0207667_105747432 230
75 3300028379 Ga0268266_10000004 Ga0268266_10000004162 230
76 3300028381 Ga0268264_10050853 Ga0268264_100508532 230
77 3300031728 Ga0316578_10041528 Ga0316578_100415282 230
78 3300031733 Ga0316577_10354570 Ga0316577_103545701 230
79 3300032139 Ga0316580_10069305 Ga0316580_100693052 230
80 3300033180 Ga0307510_10012239 Ga0307510_100122396 230
81 3300033541 Ga0316596_1037488 Ga0316596_10374882 230
82 3300035398 Ga0316574_0053262 Ga0316574_0053262_672_1373 230
83 3300036647 Ga0316582_0406893 Ga0316582_0406893_153_854 230
84 3300037418 Ga0395900_0001436 Ga0395900_0001436_2614_3312 230
85 3300037466 Ga0395898_0010942 Ga0395898_0010942_8653_9351 230
86 3300038443 Ga0395901_0001147 Ga0395901_0001147_8034_8732 230
87 3300046471 Ga0495650_0000074 Ga0495650_0000074_148127_148822 230
88 iso_pu_bacteria 2537561836 2538834753 230
89 iso_pu_bacteria 2643221562 2643829248 230
90 iso_pu_bacteria 2895395659 2895396173 230
91 3300003752 Ga0055539_1002138 Ga0055539_10021383 231
92 3300003756 Ga0055533_1009085 Ga0055533_10090851 231
93 3300003760 Ga0055527_1000145 Ga0055527_100014526 231
94 3300003761 Ga0055535_1000301 Ga0055535_100030126 231
95 3300003762 Ga0055542_1000332 Ga0055542_100033226 231
96 3300003763 Ga0055529_1000244 Ga0055529_100024437 231
97 3300005435 Ga0070714_100123114 Ga0070714_1001231142 231
98 3300005614 Ga0068856_100000524 Ga0068856_1000005249 231
99 3300005614 Ga0068856_100004476 Ga0068856_1000044768 231
100 3300013104 Ga0157370_10080985 Ga0157370_100809854 231
101 3300013105 Ga0157369_10010507 Ga0157369_100105074 231
102 3300025226 Ga0209674_100077 Ga0209674_100077184 231
103 3300025226 Ga0209674_100542 Ga0209674_1005424 231
104 3300025228 Ga0209672_100022 Ga0209672_100022194 231
105 3300025242 Ga0209258_100004 Ga0209258_100004186 231
106 3300025253 Ga0209677_102806 Ga0209677_1028066 231
107 3300025254 Ga0209148_1000083 Ga0209148_100008370 231
108 3300025272 Ga0209455_1000084 Ga0209455_100008470 231
109 3300026078 Ga0207702_10000717 Ga0207702_1000071710 231
110 3300026078 Ga0207702_10001870 Ga0207702_100018709 231
111 3300031691 Ga0316579_10060337 Ga0316579_100603372 231
112 3300037312 Ga0395899_0147046 Ga0395899_0147046_420_1118 231
113 3300037418 Ga0395900_0000049 Ga0395900_0000049_67469_68167 231
114 3300037466 Ga0395898_0000110 Ga0395898_0000110_183844_184542 231
115 3300037466 Ga0395898_0419368 Ga0395898_0419368_432_1130 231
116 3300038443 Ga0395901_0165225 Ga0395901_0165225_1052_1753 231
117 3300038443 Ga0395901_0232261 Ga0395901_0232261_1035_1733 231
118 3300038443 Ga0395901_0361521 Ga0395901_0361521_463_1164 231
119 3300038443 Ga0395901_0602558 Ga0395901_0602558_217_915 231
120 3300044656 Ga0466969_0093695 Ga0466969_0093695_516_1214 231
121 3300044661 Ga0466975_0106437 Ga0466975_0106437_892_1590 231
122 3300044684 Ga0466966_0047007 Ga0466966_0047007_1904_2602 231
123 3300044693 Ga0466961_0009199 Ga0466961_0009199_356_1054 231
124 3300044693 Ga0466961_0027090 Ga0466961_0027090_207_905 231
125 3300044693 Ga0466961_0292205 Ga0466961_0292205_176_874 231
126 3300044719 Ga0466971_0125359 Ga0466971_0125359_461_1159 231
127 3300044735 Ga0466968_0073208 Ga0466968_0073208_664_1362 231
128 3300044765 Ga0466970_0125999 Ga0466970_0125999_483_1181 231
129 3300045049 Ga0466959_0000022 Ga0466959_0000022_56012_56710 231
130 3300045049 Ga0466959_0098822 Ga0466959_0098822_278_976 231
131 3300049570 Ga0501033_0001213 Ga0501033_0001213_4910_5605 231
132 3300049581 Ga0501047_0428457 Ga0501047_0428457_121_816 231
133 iso_pu_bacteria 2593339239 2595450289 231
134 iso_pu_bacteria 2884338543 2884339153 231
135 3300002705 JGI25156J39149_1031282 JGI25156J39149_10312821 232
136 3300002741 JGI25157J39369_1020808 JGI25157J39369_10208081 232
137 3300003759 Ga0055525_1000055 Ga0055525_100005579 232
138 3300003760 Ga0055527_1000137 Ga0055527_100013715 232
139 3300003761 Ga0055535_1000112 Ga0055535_100011237 232
140 3300003761 Ga0055535_1001839 Ga0055535_10018393 232
141 3300003762 Ga0055542_1000056 Ga0055542_1000056104 232
142 3300003762 Ga0055542_1000154 Ga0055542_100015437 232
143 3300003763 Ga0055529_1000389 Ga0055529_10003899 232
144 3300005337 Ga0070682_100003751 Ga0070682_1000037512 232
145 3300005339 Ga0070660_100096461 Ga0070660_1000964612 232
146 3300005366 Ga0070659_100042622 Ga0070659_1000426223 232
147 3300005458 Ga0070681_10055157 Ga0070681_100551572 232
148 3300005530 Ga0070679_100248385 Ga0070679_1002483852 232
149 3300005539 Ga0068853_100153977 Ga0068853_1001539772 232
150 3300005546 Ga0070696_100001906 Ga0070696_1000019063 232
151 3300005546 Ga0070696_100003675 Ga0070696_1000036751 232
152 3300005547 Ga0070693_100025840 Ga0070693_1000258404 232
153 3300005547 Ga0070693_100329228 Ga0070693_1003292282 232
154 3300005563 Ga0068855_100011864 Ga0068855_1000118648 232
155 3300005563 Ga0068855_100508429 Ga0068855_1005084292 232
156 3300005577 Ga0068857_100078516 Ga0068857_1000785163 232
157 3300009093 Ga0105240_10000868 Ga0105240_1000086835 232
158 3300009093 Ga0105240_10001058 Ga0105240_1000105831 232
159 3300009093 Ga0105240_10062038 Ga0105240_100620382 232
160 3300009174 Ga0105241_10390140 Ga0105241_103901401 232
161 3300009545 Ga0105237_10000036 Ga0105237_10000036130 232
162 3300009545 Ga0105237_10421553 Ga0105237_104215531 232
163 3300009551 Ga0105238_10095806 Ga0105238_100958062 232
164 3300009551 Ga0105238_10290866 Ga0105238_102908662 232
165 3300009551 Ga0105238_10426315 Ga0105238_104263152 232
166 3300009551 Ga0105238_10492027 Ga0105238_104920272 232
167 3300010375 Ga0105239_10000027 Ga0105239_10000027148 232
168 3300013100 Ga0157373_10011560 Ga0157373_100115606 232
169 3300013100 Ga0157373_10049650 Ga0157373_100496502 232
170 3300013102 Ga0157371_10004612 Ga0157371_100046129 232
171 3300013307 Ga0157372_10026145 Ga0157372_100261452 232
172 3300013307 Ga0157372_10061408 Ga0157372_100614082 232
173 3300013307 Ga0157372_10110842 Ga0157372_101108422 232
174 3300020070 Ga0206356_11307117 Ga0206356_113071175 232
175 3300020082 Ga0206353_11632685 Ga0206353_116326854 232
176 3300025228 Ga0209672_100004 Ga0209672_1000041087 232
177 3300025228 Ga0209672_101785 Ga0209672_1017852 232
178 3300025230 Ga0209563_100076 Ga0209563_10007679 232
179 3300025242 Ga0209258_100003 Ga0209258_1000031087 232
180 3300025242 Ga0209258_100137 Ga0209258_10013751 232
181 3300025250 Ga0209026_1000087 Ga0209026_100008787 232
182 3300025250 Ga0209026_1000944 Ga0209026_10009444 232
183 3300025254 Ga0209148_1000025 Ga0209148_1000025391 232
184 3300025254 Ga0209148_1000137 Ga0209148_100013751 232
185 3300025256 Ga0209759_1040442 Ga0209759_10404421 232
186 3300025272 Ga0209455_1000004 Ga0209455_10000041087 232
187 3300025272 Ga0209455_1000318 Ga0209455_100031825 232
188 3300025272 Ga0209455_1020803 Ga0209455_10208031 232
189 3300025904 Ga0207647_10051071 Ga0207647_100510714 232
190 3300025911 Ga0207654_10115427 Ga0207654_101154272 232
191 3300025911 Ga0207654_10133427 Ga0207654_101334271 232
192 3300025912 Ga0207707_10134000 Ga0207707_101340001 232
193 3300025912 Ga0207707_10158000 Ga0207707_101580001 232
194 3300025913 Ga0207695_10000441 Ga0207695_1000044138 232
195 3300025913 Ga0207695_10000743 Ga0207695_1000074330 232
196 3300025913 Ga0207695_10000938 Ga0207695_1000093811 232
197 3300025914 Ga0207671_10001404 Ga0207671_100014041 232
198 3300025917 Ga0207660_10152487 Ga0207660_101524872 232
199 3300025919 Ga0207657_10043333 Ga0207657_100433332 232
200 3300025919 Ga0207657_10072939 Ga0207657_100729392 232
201 3300025919 Ga0207657_10140596 Ga0207657_101405962 232
202 3300025924 Ga0207694_10193138 Ga0207694_101931381 232
203 3300025924 Ga0207694_10252240 Ga0207694_102522401 232
204 3300025932 Ga0207690_10026807 Ga0207690_100268072 232
205 3300025932 Ga0207690_10030359 Ga0207690_100303592 232
206 3300025932 Ga0207690_10066171 Ga0207690_100661712 232
207 3300025949 Ga0207667_10006504 Ga0207667_1000650413 232
208 3300025949 Ga0207667_10312456 Ga0207667_103124562 232
209 3300026041 Ga0207639_10089462 Ga0207639_100894621 232
210 3300026067 Ga0207678_10018000 Ga0207678_100180002 232
211 3300026116 Ga0207674_10049229 Ga0207674_100492294 232
212 3300026116 Ga0207674_10085030 Ga0207674_100850303 232
213 3300037312 Ga0395899_0087310 Ga0395899_0087310_720_1424 232
214 3300037466 Ga0395898_0000023 Ga0395898_0000023_139407_140111 232
215 3300042438 Ga0439459_0035372 Ga0439459_0035372_15_722 232
216 3300042876 Ga0451577_0271330 Ga0451577_0271330_575_1273 232
217 3300046471 Ga0495650_0000112 Ga0495650_0000112_19772_20491 232
218 3300048904 Ga0496101_0048998 Ga0496101_0048998_678_1376 232
219 3300048905 Ga0496102_0268092 Ga0496102_0268092_609_1322 232
220 3300048907 Ga0496104_0283594 Ga0496104_0283594_72_770 232
221 3300048908 Ga0496105_0004981 Ga0496105_0004981_3882_4580 232
222 3300048910 Ga0496107_0502367 Ga0496107_0502367_134_832 232
223 3300048918 Ga0496115_0058091 Ga0496115_0058091_1846_2544 232
224 3300048919 Ga0496116_0087966 Ga0496116_0087966_805_1509 232
225 3300048920 Ga0496117_0072274 Ga0496117_0072274_1066_1764 232
226 3300048921 Ga0496118_0002106 Ga0496118_0002106_4538_5242 232
227 3300048921 Ga0496118_0003206 Ga0496118_0003206_16074_16772 232
228 3300048922 Ga0496119_0000235 Ga0496119_0000235_26617_27315 232
229 3300048922 Ga0496119_0009595 Ga0496119_0009595_2383_3081 232
230 3300048923 Ga0496120_0000208 Ga0496120_0000208_72781_73479 232
231 3300048923 Ga0496120_0000282 Ga0496120_0000282_36717_37415 232
232 3300048924 Ga0496121_0000480 Ga0496121_0000480_28203_28901 232
233 3300048924 Ga0496121_0033300 Ga0496121_0033300_3403_4101 232
234 3300048929 Ga0496126_0001680 Ga0496126_0001680_31010_31708 232
235 3300048929 Ga0496126_0009111 Ga0496126_0009111_8371_9069 232
236 3300049569 Ga0501032_0352953 Ga0501032_0352953_201_899 232
237 3300049578 Ga0501042_0474318 Ga0501042_0474318_28_726 232
238 3300049579 Ga0501043_0432167 Ga0501043_0432167_122_820 232
239 3300049579 Ga0501043_0602293 Ga0501043_0602293_19_717 232
240 3300049580 Ga0501046_0222630 Ga0501046_0222630_603_1301 232
241 3300049581 Ga0501047_0660322 Ga0501047_0660322_102_800 232
242 3300049822 Ga0501035_0040280 Ga0501035_0040280_3237_3959 232
243 3300049822 Ga0501035_0600952 Ga0501035_0600952_85_783 232
244 iso_pu_bacteria 2718218334 2721025817 232
245 iso_pu_bacteria 2734482264 2735834215 232
246 iso_pu_bacteria 2842918807 2842920641 232
247 iso_pu_bacteria 2919404418 2919406835 232
248 iso_pu_bacteria 2953994433 2953995921 232
249 3300003316 rootH1_10075931 rootH1_100759312 233
250 3300005262 Ga0065165_1014901 Ga0065165_10149012 233
251 3300005337 Ga0070682_100007154 Ga0070682_1000071542 233
252 3300005366 Ga0070659_100001720 Ga0070659_1000017202 233
253 3300005458 Ga0070681_10044587 Ga0070681_100445872 233
254 3300005563 Ga0068855_100440359 Ga0068855_1004403592 233
255 3300005578 Ga0068854_100015069 Ga0068854_1000150692 233
256 3300005578 Ga0068854_100254497 Ga0068854_1002544972 233
257 3300009093 Ga0105240_10191365 Ga0105240_101913651 233
258 3300009093 Ga0105240_10563629 Ga0105240_105636292 233
259 3300009551 Ga0105238_10145958 Ga0105238_101459582 233
260 3300013104 Ga0157370_10001742 Ga0157370_100017423 233
261 3300015685 Ga0183369_1004 Ga0183369_100425 233
262 3300025297 Ga0209758_1049275 Ga0209758_10492752 233
263 3300025912 Ga0207707_10042285 Ga0207707_100422852 233
264 3300025913 Ga0207695_10034717 Ga0207695_100347177 233
265 3300025924 Ga0207694_10052712 Ga0207694_100527122 233
266 3300025932 Ga0207690_10003443 Ga0207690_100034435 233
267 3300025949 Ga0207667_10000224 Ga0207667_1000022471 233
268 3300025981 Ga0207640_10000115 Ga0207640_1000011516 233
269 3300025981 Ga0207640_10032467 Ga0207640_100324672 233
270 3300037312 Ga0395899_0108215 Ga0395899_0108215_56_763 233
271 3300037312 Ga0395899_0211269 Ga0395899_0211269_247_954 233
272 3300044536 Ga0466988_0056125 Ga0466988_0056125_1330_2034 233
273 3300044656 Ga0466969_0005638 Ga0466969_0005638_1424_2128 233
274 3300044663 Ga0466989_0089714 Ga0466989_0089714_848_1552 233
275 3300044684 Ga0466966_0011055 Ga0466966_0011055_1620_2324 233
276 3300044693 Ga0466961_0010943 Ga0466961_0010943_1425_2129 233
277 3300044693 Ga0466961_0117056 Ga0466961_0117056_205_912 233
278 3300044719 Ga0466971_0003222 Ga0466971_0003222_325_1029 233
279 3300044842 Ga0466957_0091245 Ga0466957_0091245_407_1150 233
280 3300045049 Ga0466959_0011063 Ga0466959_0011063_4517_5224 233
281 3300045049 Ga0466959_0012887 Ga0466959_0012887_2825_3529 233
282 3300045836 Ga0466958_0004682 Ga0466958_0004682_5611_6318 233
283 3300045836 Ga0466958_0047620 Ga0466958_0047620_1850_2557 233
284 3300048919 Ga0496116_0185725 Ga0496116_0185725_95_829 233
285 3300049569 Ga0501032_0036312 Ga0501032_0036312_1439_2143 233
286 3300049571 Ga0501034_0087686 Ga0501034_0087686_305_1009 233
287 3300049573 Ga0501037_0417720 Ga0501037_0417720_69_773 233
288 3300049579 Ga0501043_0022547 Ga0501043_0022547_3947_4651 233
289 3300049580 Ga0501046_0003546 Ga0501046_0003546_11508_12212 233
290 3300049581 Ga0501047_0312688 Ga0501047_0312688_475_1179 233
291 3300049823 Ga0501044_0368515 Ga0501044_0368515_391_1107 233
292 3300049823 Ga0501044_0638729 Ga0501044_0638729_141_845 233
293 3300061719 Ga0466962_0015872 Ga0466962_0015872_725_1429 233
294 3300061719 Ga0466962_0024392 Ga0466962_0024392_526_1233 233
295 iso_pu_bacteria 2739367700 2739732579 233
296 iso_pu_bacteria 2884411467 2884412684 233
297 iso_pu_bacteria 2919085039 2919086171 233
298 iso_pu_bacteria 2928963466 2928965311 233
299 3300001979 JGI24740J21852_10013677 JGI24740J21852_100136771 234
300 3300001989 JGI24739J22299_10001255 JGI24739J22299_100012556 234
301 3300001990 JGI24737J22298_10009655 JGI24737J22298_100096553 234
302 3300003215 JGI25153J46596_10012029 JGI25153J46596_100120294 234
303 3300003578 Ga0006562J51391_1149857 Ga0006562J51391_11498574 234
304 3300003578 Ga0006562J51391_1149858 Ga0006562J51391_11498582 234
305 3300003756 Ga0055533_1000536 Ga0055533_10005362 234
306 3300005455 Ga0070663_100273215 Ga0070663_1002732152 234
307 3300005563 Ga0068855_100610411 Ga0068855_1006104112 234
308 3300005577 Ga0068857_100000206 Ga0068857_10000020610 234
309 3300005616 Ga0068852_100235437 Ga0068852_1002354372 234
310 3300005834 Ga0068851_10037211 Ga0068851_100372112 234
311 3300005842 Ga0068858_100089515 Ga0068858_1000895152 234
312 3300009093 Ga0105240_10021448 Ga0105240_100214484 234
313 3300009545 Ga0105237_10000011 Ga0105237_10000011181 234
314 3300009553 Ga0105249_10129603 Ga0105249_101296032 234
315 3300010375 Ga0105239_10004878 Ga0105239_100048789 234
316 3300012500 Ga0157314_1000079 Ga0157314_100007911 234
317 3300013102 Ga0157371_10022743 Ga0157371_100227432 234
318 3300013105 Ga0157369_10376345 Ga0157369_103763452 234
319 3300015687 Ga0183368_1003 Ga0183368_1003156 234
320 3300025226 Ga0209674_100033 Ga0209674_100033169 234
321 3300025242 Ga0209258_100564 Ga0209258_1005644 234
322 3300025258 Ga0209129_1005245 Ga0209129_10052454 234
323 3300025297 Ga0209758_1001923 Ga0209758_100192318 234
324 3300025904 Ga0207647_10040235 Ga0207647_100402352 234
325 3300025913 Ga0207695_10002762 Ga0207695_1000276210 234
326 3300025914 Ga0207671_10000011 Ga0207671_10000011178 234
327 3300025924 Ga0207694_10105864 Ga0207694_101058642 234
328 3300025949 Ga0207667_10000240 Ga0207667_1000024025 234
329 3300025981 Ga0207640_10440992 Ga0207640_104409922 234
330 3300026067 Ga0207678_10270513 Ga0207678_102705132 234
331 3300026116 Ga0207674_10003554 Ga0207674_1000355411 234
332 3300026142 Ga0207698_10303450 Ga0207698_103034502 234
333 3300037466 Ga0395898_0114596 Ga0395898_0114596_1212_2009 234
334 3300038443 Ga0395901_0016735 Ga0395901_0016735_5855_6652 234
335 3300046460 Ga0495638_0000071 Ga0495638_0000071_154465_155193 234
336 3300048916 Ga0496113_0037709 Ga0496113_0037709_1158_1865 234
337 3300048918 Ga0496115_0000008 Ga0496115_0000008_220988_221695 234
338 3300048928 Ga0496125_0000118 Ga0496125_0000118_151409_152113 234
339 3300049570 Ga0501033_0025106 Ga0501033_0025106_3457_4191 234
340 3300049571 Ga0501034_0124348 Ga0501034_0124348_968_1702 234
341 3300049573 Ga0501037_0338870 Ga0501037_0338870_195_929 234
342 3300049579 Ga0501043_0025717 Ga0501043_0025717_321_1055 234
343 3300049581 Ga0501047_0004745 Ga0501047_0004745_7888_8622 234
344 3300049586 Ga0501070_0087812 Ga0501070_0087812_666_1400 234
345 3300049822 Ga0501035_0044886 Ga0501035_0044886_2955_3689 234
346 3300049823 Ga0501044_0180877 Ga0501044_0180877_1125_1859 234
347 iso_pu_bacteria 2593339238 2595447534 234
348 iso_pu_bacteria 2687453130 2687584457 234
349 iso_pu_bacteria 2941471342 2941471924 234
350 3300003316 rootH1_10065949 rootH1_100659492 235
351 3300044672 Ga0466982_0000001 Ga0466982_0000001_2041_2748 235
352 3300044719 Ga0466971_0005044 Ga0466971_0005044_309_1016 235
353 3300044735 Ga0466968_0005952 Ga0466968_0005952_163_870 235
354 3300044901 Ga0466960_0069248 Ga0466960_0069248_923_1630 235
355 3300047472 Ga0495686_0000024 Ga0495686_0000024_337517_338224 235
356 3300048920 Ga0496117_0052233 Ga0496117_0052233_1913_2620 235
357 3300048921 Ga0496118_0001137 Ga0496118_0001137_9501_10208 235
358 3300061719 Ga0466962_0000447 Ga0466962_0000447_1340_2047 235
359 3300003578 Ga0006562J51391_1030225 Ga0006562J51391_10302255 236
360 3300003578 Ga0006562J51391_1030231 Ga0006562J51391_10302313 236
361 3300004625 Ga0055543_1012776 Ga0055543_10127762 236
362 3300005262 Ga0065165_1002521 Ga0065165_10025218 236
363 3300005340 Ga0070689_100003245 Ga0070689_10000324511 236
364 3300005344 Ga0070661_100103381 Ga0070661_1001033812 236
365 3300013104 Ga0157370_10120606 Ga0157370_101206062 236
366 3300013306 Ga0163162_10465195 Ga0163162_104651952 236
367 3300014497 Ga0182008_10002263 Ga0182008_100022632 236
368 3300015261 Ga0182006_1000556 Ga0182006_100055615 236
369 3300015261 Ga0182006_1000731 Ga0182006_100073116 236
370 3300015261 Ga0182006_1050168 Ga0182006_10501682 236
371 3300015262 Ga0182007_10051705 Ga0182007_100517052 236
372 3300015265 Ga0182005_1008360 Ga0182005_10083602 236
373 3300017792 Ga0163161_10029319 Ga0163161_100293193 236
374 3300025254 Ga0209148_1002944 Ga0209148_10029442 236
375 3300025302 Ga0207426_1028934 Ga0207426_10289342 236
376 3300025924 Ga0207694_10027377 Ga0207694_100273772 236
377 3300025929 Ga0207664_10001631 Ga0207664_100016314 236
378 3300025936 Ga0207670_10010630 Ga0207670_100106306 236
379 3300026067 Ga0207678_10075860 Ga0207678_100758603 236
380 3300026067 Ga0207678_10170218 Ga0207678_101702182 236
381 3300031911 Ga0307412_10002850 Ga0307412_100028503 236
382 3300041404 Ga0439436_0000007 Ga0439436_0000007_57444_58169 236
383 3300041413 Ga0439465_0003807 Ga0439465_0003807_2294_3019 236
384 3300041452 Ga0451793_1067073 Ga0451793_1067073_21_776 236
385 3300042184 Ga0450908_000082 Ga0450908_000082_16813_17538 236
386 3300044672 Ga0466982_0000083 Ga0466982_0000083_19574_20287 236
387 3300044735 Ga0466968_0002495 Ga0466968_0002495_1158_1889 236
388 3300045051 Ga0451576_0000401 Ga0451576_0000401_44316_45065 236
389 3300046452 Ga0495617_000149 Ga0495617_000149_34082_34810 236
390 3300046452 Ga0495617_000785 Ga0495617_000785_4025_4750 236
391 3300046460 Ga0495638_0001285 Ga0495638_0001285_11534_12259 236
392 3300046460 Ga0495638_0017990 Ga0495638_0017990_3689_4414 236
393 3300046471 Ga0495650_0000838 Ga0495650_0000838_23588_24313 236
394 3300046491 Ga0495584_0000591 Ga0495584_0000591_8133_8858 236
395 3300046492 Ga0495585_0000063 Ga0495585_0000063_95949_96674 236
396 3300046492 Ga0495585_0008265 Ga0495585_0008265_4225_4950 236
397 3300046501 Ga0495607_0000029 Ga0495607_0000029_34040_34765 236
398 3300046501 Ga0495607_0000061 Ga0495607_0000061_29124_29837 236
399 3300046501 Ga0495607_0029914 Ga0495607_0029914_590_1303 236
400 3300046506 Ga0495583_0029269 Ga0495583_0029269_642_1367 236
401 3300046507 Ga0495606_0000546 Ga0495606_0000546_23561_24286 236
402 3300046507 Ga0495606_0005106 Ga0495606_0005106_6342_7067 236
403 3300046512 Ga0495610_0000944 Ga0495610_0000944_24180_24905 236
404 3300046512 Ga0495610_0007827 Ga0495610_0007827_3756_4481 236
405 3300046513 Ga0495616_0000128 Ga0495616_0000128_36176_36901 236
406 3300046513 Ga0495616_0009336 Ga0495616_0009336_2666_3391 236
407 3300046515 Ga0495620_0000218 Ga0495620_0000218_40567_41295 236
408 3300046515 Ga0495620_0001660 Ga0495620_0001660_1903_2628 236
409 3300046518 Ga0495631_0000098 Ga0495631_0000098_11991_12716 236
410 3300046518 Ga0495631_0000749 Ga0495631_0000749_12838_13563 236
411 3300046518 Ga0495631_0173961 Ga0495631_0173961_173_901 236
412 3300046519 Ga0495632_0003820 Ga0495632_0003820_9330_10055 236
413 3300046519 Ga0495632_0023324 Ga0495632_0023324_1106_1831 236
414 3300046519 Ga0495632_0138140 Ga0495632_0138140_41_766 236
415 3300046522 Ga0495643_0145634 Ga0495643_0145634_104_829 236
416 3300046524 Ga0495648_0000643 Ga0495648_0000643_12956_13681 236
417 3300046524 Ga0495648_0001982 Ga0495648_0001982_12626_13351 236
418 3300046538 Ga0495609_0014074 Ga0495609_0014074_1373_2098 236
419 3300046616 Ga0495668_0104758 Ga0495668_0104758_482_1207 236
420 3300046648 Ga0495611_0000003 Ga0495611_0000003_72909_73634 236
421 3300046648 Ga0495611_0000014 Ga0495611_0000014_100062_100787 236
422 3300046648 Ga0495611_0170446 Ga0495611_0170446_186_911 236
423 3300046660 Ga0495625_0000019 Ga0495625_0000019_233016_233741 236
424 3300046660 Ga0495625_0170500 Ga0495625_0170500_387_1115 236
425 3300046665 Ga0495661_0000703 Ga0495661_0000703_12913_13638 236
426 3300046665 Ga0495661_0060014 Ga0495661_0060014_1183_1908 236
427 3300046691 Ga0495670_0004940 Ga0495670_0004940_1734_2459 236
428 3300046691 Ga0495670_0005491 Ga0495670_0005491_4295_5020 236
429 3300046692 Ga0495671_0000549 Ga0495671_0000549_21215_21940 236
430 3300046694 Ga0495649_0015836 Ga0495649_0015836_160_885 236
431 3300046794 Ga0495589_0000018 Ga0495589_0000018_170074_170799 236
432 3300046810 Ga0495660_0000122 Ga0495660_0000122_63376_64101 236
433 3300046810 Ga0495660_0000585 Ga0495660_0000585_13568_14311 236
434 3300047323 Ga0495683_0002990 Ga0495683_0002990_1426_2151 236
435 3300047446 Ga0495679_000017 Ga0495679_000017_189579_190304 236
436 3300047469 Ga0495673_0000004 Ga0495673_0000004_889641_890384 236
437 3300047469 Ga0495673_0000347 Ga0495673_0000347_52100_52825 236
438 3300047469 Ga0495673_0001611 Ga0495673_0001611_1088_1813 236
439 3300047472 Ga0495686_0000409 Ga0495686_0000409_28298_29023 236
440 3300047472 Ga0495686_0009114 Ga0495686_0009114_1612_2337 236
441 3300048903 Ga0496100_0023508 Ga0496100_0023508_178_891 236
442 3300048904 Ga0496101_0001464 Ga0496101_0001464_10902_11615 236
443 3300048921 Ga0496118_0185333 Ga0496118_0185333_44_757 236
444 3300048922 Ga0496119_0045574 Ga0496119_0045574_920_1645 236
445 3300048924 Ga0496121_0000708 Ga0496121_0000708_2031_2774 236
446 3300048924 Ga0496121_0003276 Ga0496121_0003276_19198_19923 236
447 3300048924 Ga0496121_0049169 Ga0496121_0049169_147_875 236
448 3300048924 Ga0496121_0220434 Ga0496121_0220434_147_875 236
449 3300048924 Ga0496121_0241791 Ga0496121_0241791_236_976 236
450 3300048925 Ga0496122_0011366 Ga0496122_0011366_356_1069 236
451 3300048926 Ga0496123_0078655 Ga0496123_0078655_952_1665 236
452 3300049459 Ga0495678_000210 Ga0495678_000210_34056_34781 236
453 3300049460 Ga0495682_0000746 Ga0495682_0000746_9103_9828 236
454 3300049460 Ga0495682_0001629 Ga0495682_0001629_3020_3745 236
455 3300053087 Ga0500643_000029 Ga0500643_000029_72832_73557 236
456 3300053103 Ga0500555_000067 Ga0500555_000067_22532_23257 236
457 3300053730 Ga0500645_000177 Ga0500645_000177_7370_8095 236
458 iso_pu_bacteria 2738543009 2739225630 236
459 3300002705 JGI25156J39149_1029667 JGI25156J39149_10296671 237
460 3300002737 JGI25162J39368_1000467 JGI25162J39368_10004678 237
461 3300002737 JGI25162J39368_1000470 JGI25162J39368_100047028 237
462 3300002741 JGI25157J39369_1000585 JGI25157J39369_100058524 237
463 3300002741 JGI25157J39369_1009669 JGI25157J39369_10096691 237
464 3300002771 JGI25163J39215_1000495 JGI25163J39215_10004951 237
465 3300002771 JGI25163J39215_1001475 JGI25163J39215_10014754 237
466 3300002771 JGI25163J39215_1001494 JGI25163J39215_10014941 237
467 3300002772 JGI25164J39214_1000075 JGI25164J39214_10000752 237
468 3300003214 JGI25165J46597_1000178 JGI25165J46597_100017890 237
469 3300003751 Ga0055538_1001976 Ga0055538_10019761 237
470 3300003761 Ga0055535_1000144 Ga0055535_100014467 237
471 3300003762 Ga0055542_1000213 Ga0055542_100021325 237
472 3300003762 Ga0055542_1000594 Ga0055542_100059428 237
473 3300003763 Ga0055529_1000153 Ga0055529_100015390 237
474 3300005365 Ga0070688_100164872 Ga0070688_1001648722 237
475 3300005436 Ga0070713_100017047 Ga0070713_1000170472 237
476 3300005547 Ga0070693_100003911 Ga0070693_1000039115 237
477 3300009551 Ga0105238_10041685 Ga0105238_100416852 237
478 3300013102 Ga0157371_10005204 Ga0157371_100052042 237
479 3300013104 Ga0157370_10000045 Ga0157370_1000004570 237
480 3300014497 Ga0182008_10049293 Ga0182008_100492932 237
481 3300014969 Ga0157376_10003819 Ga0157376_100038192 237
482 3300015265 Ga0182005_1000113 Ga0182005_100011338 237
483 3300025207 Ga0209760_101498 Ga0209760_1014981 237
484 3300025224 Ga0209784_100104 Ga0209784_1001041 237
485 3300025231 Ga0207427_100070 Ga0207427_10007086 237
486 3300025231 Ga0207427_100427 Ga0207427_1004276 237
487 3300025233 Ga0209437_100005 Ga0209437_100005626 237
488 3300025233 Ga0209437_100059 Ga0209437_100059144 237
489 3300025233 Ga0209437_100141 Ga0209437_1001418 237
490 3300025233 Ga0209437_105492 Ga0209437_1054922 237
491 3300025242 Ga0209258_100034 Ga0209258_10003431 237
492 3300025246 Ga0209646_1000849 Ga0209646_100084911 237
493 3300025250 Ga0209026_1000017 Ga0209026_1000017180 237
494 3300025250 Ga0209026_1000176 Ga0209026_100017686 237
495 3300025250 Ga0209026_1000945 Ga0209026_10009456 237
496 3300025254 Ga0209148_1000001 Ga0209148_1000001673 237
497 3300025254 Ga0209148_1000002 Ga0209148_1000002772 237
498 3300025256 Ga0209759_1000581 Ga0209759_10005811 237
499 3300025256 Ga0209759_1011539 Ga0209759_10115393 237
500 3300025261 Ga0209233_1000002 Ga0209233_10000021558 237
501 3300025261 Ga0209233_1000011 Ga0209233_1000011316 237
502 3300025261 Ga0209233_1000273 Ga0209233_100027334 237
503 3300025261 Ga0209233_1040647 Ga0209233_10406471 237
504 3300025272 Ga0209455_1000019 Ga0209455_10000191 237
505 3300025272 Ga0209455_1009615 Ga0209455_10096151 237
506 3300025924 Ga0207694_10084895 Ga0207694_100848952 237
507 3300025928 Ga0207700_10013351 Ga0207700_100133512 237
508 3300025929 Ga0207664_10629260 Ga0207664_106292601 237
509 3300025972 Ga0207668_10226770 Ga0207668_102267701 237
510 3300046460 Ga0495638_0000152 Ga0495638_0000152_32744_33469 237
511 3300046460 Ga0495638_0000378 Ga0495638_0000378_19797_20516 237
512 3300046507 Ga0495606_0001622 Ga0495606_0001622_27178_27903 237
513 3300046557 Ga0495622_0025937 Ga0495622_0025937_38_763 237
514 3300046660 Ga0495625_0023863 Ga0495625_0023863_3677_4402 237
515 3300046674 Ga0495588_0051171 Ga0495588_0051171_210_941 237
516 3300048918 Ga0496115_0000366 Ga0496115_0000366_24676_25401 237
517 3300048921 Ga0496118_0067959 Ga0496118_0067959_1211_1927 237
518 3300048924 Ga0496121_0199357 Ga0496121_0199357_640_1365 237
519 3300048926 Ga0496123_0004298 Ga0496123_0004298_12679_13407 237
520 3300048927 Ga0496124_0000245 Ga0496124_0000245_6689_7417 237
521 3300048929 Ga0496126_0049199 Ga0496126_0049199_259_984 237
522 3300049459 Ga0495678_044542 Ga0495678_044542_219_944 237
523 3300049460 Ga0495682_0078303 Ga0495682_0078303_277_1002 237
524 3300049579 Ga0501043_0222419 Ga0501043_0222419_356_1090 237
525 3300049582 Ga0501048_0009611 Ga0501048_0009611_5692_6426 237
526 iso_pu_bacteria 2867369537 2867372101 237
527 3300001904 JGI24736J21556_1000189 JGI24736J21556_100018911 238
528 3300013104 Ga0157370_10001442 Ga0157370_100014422 238
529 3300013105 Ga0157369_10005769 Ga0157369_1000576912 238
530 3300025206 Ga0209435_105592 Ga0209435_1055921 238
531 3300025904 Ga0207647_10000015 Ga0207647_1000001575 238
532 3300046519 Ga0495632_0000014 Ga0495632_0000014_174628_175350 238
533 3300048920 Ga0496117_0016445 Ga0496117_0016445_5352_6068 238
534 3300048921 Ga0496118_0004111 Ga0496118_0004111_3236_3952 238
535 3300048924 Ga0496121_0000109 Ga0496121_0000109_51740_52456 238
536 3300048928 Ga0496125_0021779 Ga0496125_0021779_3369_4085 238
537 3300048929 Ga0496126_0039239 Ga0496126_0039239_1759_2475 238
538 3300049586 Ga0501070_0220283 Ga0501070_0220283_289_1020 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

75

245

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.9649 36 238
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.946 36 238
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.9404 36 238
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.9183 36 238
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.8644 33 236
ID Description Score Start End Superfamily
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9648 36 238 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.946 36 238 3.40.50.150
af_P9WFY9_38_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.917 29 238 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9079 63 235 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8728 65 116 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5E6NLH3-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9912 52 236 GO:0008176
GO:0043527
AF-A0A2E4LHA7-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9857 64 236 GO:0008176
GO:0043527
AF-A0A5E5QLR1-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9854 32 236 GO:0008176
GO:0043527
AF-A0A523JT18-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9847 24 237 GO:0008176
GO:0043527
AF-A0A661G9S3-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9844 29 238 GO:0008176
GO:0043527

Feature Viewer

pLDDT pTM Quality
89.5 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map