metagRoot

F460913

General Info

Members	Datasets	Scaffolds	Average Seq Length
537	275	528	227

Family's Representative Sequence

Representative Sequence	3300021384\|Ga0213876_10006822\|Ga0213876_100068222
Length	254
Sequence	VSGNGSGERSEGRILVVDDERPIRRALAANLKARGYEVDAAGSGEEALDLAARHHPDVVLLDLGLPGIDGVEVIEGLRGWSRIPIIVLSARDAEAAKIAALDAGADDYVTKPFAMGELLARVRAALRRTVDGDAPSMIETAHFEVDLVAKRVRRDGEEIHLTPTEWHILEVLVRSPGRLVGQRQLLQEVWGPQYSTETNYLRLYLAQLRRKLEPEPSRPRYLITEPGMGYRFEPGDPPAVPDGAVSEEAARTRG

Samples

	Sample ID	Description	Type	Environment
1	2643221616	Leifsonia sp. Root227	Isolate	Unclassified
2	2643221617	Nocardioides sp. Root79	Isolate	Unclassified
3	2643221620	Nocardioides sp. Root240	Isolate	Unclassified
4	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
5	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
6	2857727296	Kocuria sp. R-72562	Isolate	Unclassified
7	2884763398	Leifsonia sp. PS1209	Isolate	Stem Tuber
8	2928153084	Leifsonia sp. 563	Isolate	Unclassified
9	2964326757	Planctomonas psychrotolerans J5903	Isolate	Rhizosphere
10	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
11	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
12	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
13	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
14	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
15	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
16	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
17	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
20	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
30	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
31	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
32	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
33	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
34	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
35	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
36	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
37	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
41	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
42	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
43	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
44	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
45	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
48	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
49	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
50	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
51	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
57	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
62	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
63	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
64	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
65	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
66	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
67	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
68	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
69	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
70	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
71	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
73	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
74	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
75	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
76	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
81	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
84	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
85	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
91	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
92	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
93	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
94	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
95	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
96	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
97	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
151	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
152	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
153	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
154	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
155	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
156	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
157	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
159	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
160	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
161	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
162	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
163	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
164	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
165	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
167	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
168	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
169	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
170	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
171	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
172	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
173	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
174	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
175	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
176	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
177	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
178	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
179	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
180	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
181	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
182	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
183	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
184	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
185	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
186	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
187	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
188	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
189	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
190	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
191	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
192	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
193	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
194	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
195	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
196	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
197	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
198	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
199	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
200	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
201	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
202	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
203	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
204	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
205	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
206	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
207	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
211	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
212	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
213	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
214	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
215	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
216	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
217	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
218	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
219	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
220	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
221	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
222	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
223	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
224	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
225	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
226	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
227	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
228	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
247	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
250	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
251	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
252	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
253	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
254	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
255	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
256	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
259	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
260	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
261	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
262	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
263	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
264	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
265	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
266	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
267	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
268	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
269	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
270	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
271	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
272	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
273	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
274	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
275	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.77
Metatranscriptomes	0.56
Isolates	1.68

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.66
Nodule	0
Rhizoplane	12.29
Rhizosphere	76.72
Stem	0
Stem Tuber	0.19
Unclassified	6.15

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10003055	3300002067	Bacteria	5742
2	JGI25164J39214_1000419	3300002772	Bacteria	24049
3	JGI25165J46597_1000004	3300003214	Bacteria	667510
4	Ga0055527_1000001	3300003760	Bacteria	850044
5	Ga0055529_1000019	3300003763	Bacteria	332786
6	Ga0070658_10164911	3300005327	Bacteria	1860
7	Ga0070658_10224598	3300005327	Bacteria	1589
8	Ga0070690_100080176	3300005330	Bacteria	2135
9	Ga0070666_10037222	3300005335	Bacteria	3234
10	Ga0070680_100277323	3300005336	Bacteria	1420
11	Ga0070660_100003028	3300005339	Bacteria	11568
12	Ga0070660_100497579	3300005339	Bacteria	1014
13	Ga0070689_100223703	3300005340	Bacteria	1545
14	Ga0070691_10049909	3300005341	Bacteria	1995
15	Ga0070661_100540989	3300005344	Bacteria	936
16	Ga0070692_10145367	3300005345	Bacteria	1346
17	Ga0070668_100580509	3300005347	Bacteria	979
18	Ga0070669_100000127	3300005353	Bacteria	69910
19	Ga0070671_100003133	3300005355	Bacteria	12882
20	Ga0070671_100004712	3300005355	Bacteria	10834
21	Ga0070671_100026974	3300005355	Bacteria	4725
22	Ga0070671_100085349	3300005355	Bacteria	2641
23	Ga0070659_100017697	3300005366	Bacteria	5367
24	Ga0070659_100079547	3300005366	Bacteria	2616
25	Ga0070667_100078154	3300005367	Bacteria	2826
26	Ga0070667_100382490	3300005367	Bacteria	1279
27	Ga0070667_100395219	3300005367	Bacteria	1258
28	Ga0070709_10289113	3300005434	Bacteria	1194
29	Ga0070714_100096765	3300005435	Bacteria	2594
30	Ga0070714_100107150	3300005435	Bacteria	2470
31	Ga0070714_100231716	3300005435	Bacteria	1702
32	Ga0070713_100042744	3300005436	Bacteria	3701
33	Ga0070713_100185636	3300005436	Bacteria	1871
34	Ga0070713_100404127	3300005436	Bacteria	1276
35	Ga0070710_10000789	3300005437	Bacteria	15176
36	Ga0070711_100120666	3300005439	Bacteria	1938
37	Ga0070705_100100203	3300005440	Bacteria	1827
38	Ga0070708_100044913	3300005445	Bacteria	3889
39	Ga0070678_100052591	3300005456	Bacteria	2958
40	Ga0070681_10391224	3300005458	Bacteria	1301
41	Ga0070707_100014368	3300005468	Bacteria	7420
42	Ga0070707_100217641	3300005468	Bacteria	1861
43	Ga0070698_100018435	3300005471	Bacteria	7349
44	Ga0070698_100034690	3300005471	Bacteria	5221
45	Ga0070698_100170304	3300005471	Bacteria	2119
46	Ga0068853_100037225	3300005539	Bacteria	4140
47	Ga0068853_100067440	3300005539	Bacteria	3109
48	Ga0070672_100533943	3300005543	Bacteria	1017
49	Ga0070672_100549383	3300005543	Bacteria	1003
50	Ga0070686_100247486	3300005544	Bacteria	1301
51	Ga0070695_100101475	3300005545	Bacteria	1939
52	Ga0070696_100151427	3300005546	Bacteria	1703
53	Ga0070693_100064399	3300005547	Bacteria	2140
54	Ga0070665_100099153	3300005548	Bacteria	2918
55	Ga0070665_100111491	3300005548	Bacteria	2738
56	Ga0068855_100013417	3300005563	Bacteria	9880
57	Ga0068855_100051303	3300005563	Bacteria	4859
58	Ga0068855_100231654	3300005563	Bacteria	2068
59	Ga0068855_100324151	3300005563	Bacteria	1702
60	Ga0068855_100386399	3300005563	Bacteria	1536
61	Ga0070664_100229133	3300005564	Bacteria	1665
62	Ga0068857_100241500	3300005577	Bacteria	1654
63	Ga0068854_100109602	3300005578	Bacteria	2080
64	Ga0068856_100044459	3300005614	Bacteria	4372
65	Ga0068856_100055600	3300005614	Bacteria	3906
66	Ga0068856_100085353	3300005614	Bacteria	3136
67	Ga0068856_100142479	3300005614	Bacteria	2404
68	Ga0068856_100236938	3300005614	Bacteria	1840
69	Ga0070702_100007235	3300005615	Bacteria	5305
70	Ga0068852_100002583	3300005616	Bacteria	12498
71	Ga0068859_100104143	3300005617	Bacteria	2896
72	Ga0068859_100152594	3300005617	Bacteria	2386
73	Ga0068864_100205471	3300005618	Bacteria	1811
74	Ga0068864_100397766	3300005618	Bacteria	1309
75	Ga0068863_100027312	3300005841	Bacteria	5443
76	Ga0068863_100617681	3300005841	Bacteria	1074
77	Ga0068858_100001051	3300005842	Bacteria	28526
78	Ga0068858_100176441	3300005842	Bacteria	2016
79	Ga0068860_100039777	3300005843	Bacteria	4497
80	Ga0068860_100330405	3300005843	Bacteria	1497
81	Ga0068860_100331051	3300005843	Bacteria	1496
82	Ga0068862_100085123	3300005844	Bacteria	2747
83	Ga0068862_100203562	3300005844	Bacteria	1786
84	Ga0081455_10000107	3300005937	Bacteria	93186
85	Ga0081455_10003258	3300005937	Bacteria	18798
86	Ga0081455_10047949	3300005937	Bacteria	3695
87	Ga0081455_10049986	3300005937	Bacteria	3599
88	Ga0081540_1000095	3300005983	Bacteria	92795
89	Ga0081540_1002819	3300005983	Bacteria	14076
90	Ga0081540_1095287	3300005983	Bacteria	1297
91	Ga0070717_10024953	3300006028	Bacteria	4749
92	Ga0070717_10031447	3300006028	Bacteria	4271
93	Ga0070717_10045411	3300006028	Bacteria	3591
94	Ga0075364_10018206	3300006051	Bacteria	4396
95	Ga0070716_100248844	3300006173	Bacteria	1210
96	Ga0070712_100000007	3300006175	Bacteria	157653
97	Ga0070712_100016403	3300006175	Bacteria	4785
98	Ga0070712_100077780	3300006175	Bacteria	2392
99	Ga0075369_10062958	3300006186	Bacteria	1622
100	Ga0068871_100026636	3300006358	Bacteria	4514
101	Ga0075433_10518363	3300006852	Bacteria	1049
102	Ga0075434_100082700	3300006871	Bacteria	3208
103	Ga0068865_100019428	3300006881	Bacteria	4397
104	Ga0097620_100104146	3300006931	Bacteria	2896
105	Ga0097620_100152607	3300006931	Bacteria	2386
106	Ga0075435_100066519	3300007076	Bacteria	2932
107	Ga0105240_10037190	3300009093	Bacteria	6257
108	Ga0105240_10472112	3300009093	Bacteria	1400
109	Ga0105245_10006684	3300009098	Bacteria	10121
110	Ga0105245_10008786	3300009098	Bacteria	8811
111	Ga0105247_10086115	3300009101	Bacteria	1988
112	Ga0114129_10010532	3300009147	Bacteria	13184
113	Ga0114129_10235351	3300009147	Bacteria	2464
114	Ga0105241_10129011	3300009174	Bacteria	2045
115	Ga0105241_10277010	3300009174	Bacteria	1431
116	Ga0105242_10036318	3300009176	Bacteria	3952
117	Ga0105248_10112654	3300009177	Bacteria	3068
118	Ga0105248_10186705	3300009177	Bacteria	2336
119	Ga0105248_10239054	3300009177	Bacteria	2044
120	Ga0105248_10586996	3300009177	Bacteria	1257
121	Ga0105237_10219341	3300009545	Bacteria	1902
122	Ga0105237_10379996	3300009545	Bacteria	1417
123	Ga0105237_10552659	3300009545	Bacteria	1158
124	Ga0105238_10083383	3300009551	Bacteria	3186
125	Ga0105238_10641236	3300009551	Bacteria	1072
126	Ga0105238_11085462	3300009551	Bacteria	823
127	Ga0105239_10010166	3300010375	Bacteria	10543
128	Ga0105239_10015644	3300010375	Bacteria	8399
129	Ga0157370_10013795	3300013104	Bacteria	8301
130	Ga0157369_10015786	3300013105	Bacteria	8510
131	Ga0157369_10106522	3300013105	Bacteria	2983
132	Ga0157369_10314634	3300013105	Bacteria	1628
133	Ga0157369_11039452	3300013105	Bacteria	838
134	Ga0157374_10130858	3300013296	Bacteria	2429
135	Ga0163162_10009368	3300013306	Bacteria	9524
136	Ga0157372_10493401	3300013307	Bacteria	1428
137	Ga0157375_11648918	3300013308	Bacteria	759
138	Ga0163163_10097698	3300014325	Bacteria	2957
139	Ga0163163_10808785	3300014325	Bacteria	1001
140	Ga0157379_10197633	3300014968	Bacteria	1818
141	Ga0157376_10549898	3300014969	Bacteria	1142
142	Ga0206351_10696167	3300020077	Bacteria	1363
143	Ga0206350_10161877	3300020080	Bacteria	1593
144	Ga0206353_10380448	3300020082	Bacteria	6920
145	Ga0213876_10006822	3300021384	Bacteria	6232
146	Ga0213876_10143837	3300021384	Bacteria	1268
147	Ga0213875_10000186	3300021388	Bacteria	63592
148	Ga0213875_10004089	3300021388	Bacteria	8115
149	Ga0213875_10035148	3300021388	Bacteria	2365
150	Ga0213875_10140524	3300021388	Bacteria	1130
151	Ga0209672_100006	3300025228	Bacteria	1004497
152	Ga0209147_100699	3300025229	Bacteria	17130
153	Ga0207427_100010	3300025231	Bacteria	648610
154	Ga0209437_100216	3300025233	Bacteria	106353
155	Ga0209258_101354	3300025242	Bacteria	8916
156	Ga0209677_100608	3300025253	Bacteria	19222
157	Ga0209148_1000015	3300025254	Bacteria	850103
158	Ga0209233_1000001	3300025261	Bacteria	2992747
159	Ga0209455_1000013	3300025272	Bacteria	850103
160	Ga0209455_1002099	3300025272	Bacteria	7959
161	Ga0207692_10001955	3300025898	Bacteria	7850
162	Ga0207688_10003537	3300025901	Bacteria	8523
163	Ga0207647_10080738	3300025904	Bacteria	1950
164	Ga0207647_10095342	3300025904	Bacteria	1771
165	Ga0207647_10104677	3300025904	Bacteria	1677
166	Ga0207654_10570077	3300025911	Bacteria	806
167	Ga0207695_10053059	3300025913	Bacteria	4243
168	Ga0207695_10702034	3300025913	Bacteria	892
169	Ga0207671_10008311	3300025914	Bacteria	8824
170	Ga0207671_10030861	3300025914	Bacteria	3995
171	Ga0207693_10023674	3300025915	Bacteria	4873
172	Ga0207693_10029381	3300025915	Bacteria	4342
173	Ga0207663_10608643	3300025916	Bacteria	859
174	Ga0207660_10174507	3300025917	Bacteria	1666
175	Ga0207657_10008380	3300025919	Bacteria	10499
176	Ga0207657_10277957	3300025919	Bacteria	1330
177	Ga0207646_10048731	3300025922	Bacteria	3797
178	Ga0207646_10053895	3300025922	Bacteria	3598
179	Ga0207681_10000187	3300025923	Bacteria	50363
180	Ga0207694_10103581	3300025924	Bacteria	2257
181	Ga0207694_10349947	3300025924	Bacteria	1223
182	Ga0207687_10050908	3300025927	Bacteria	2885
183	Ga0207700_10096017	3300025928	Bacteria	2352
184	Ga0207700_10669012	3300025928	Bacteria	926
185	Ga0207664_10095898	3300025929	Bacteria	2441
186	Ga0207664_10148414	3300025929	Bacteria	1990
187	Ga0207644_10000353	3300025931	Bacteria	29799
188	Ga0207644_10084907	3300025931	Bacteria	2347
189	Ga0207690_10073914	3300025932	Bacteria	2359
190	Ga0207690_10601193	3300025932	Bacteria	898
191	Ga0207706_10089275	3300025933	Bacteria	2710
192	Ga0207686_10037717	3300025934	Bacteria	2918
193	Ga0207709_10029597	3300025935	Bacteria	3178
194	Ga0207665_10000830	3300025939	Bacteria	20902
195	Ga0207665_10039320	3300025939	Bacteria	3154
196	Ga0207691_10156828	3300025940	Bacteria	1999
197	Ga0207691_10491398	3300025940	Bacteria	1043
198	Ga0207711_10043263	3300025941	Bacteria	3840
199	Ga0207711_10272144	3300025941	Bacteria	1558
200	Ga0207711_10483598	3300025941	Bacteria	1153
201	Ga0207689_10036774	3300025942	Bacteria	4064
202	Ga0207667_10008467	3300025949	Bacteria	12215
203	Ga0207667_10037395	3300025949	Bacteria	5189
204	Ga0207667_10149706	3300025949	Bacteria	2402
205	Ga0207667_10243870	3300025949	Bacteria	1839
206	Ga0207667_10729305	3300025949	Bacteria	992
207	Ga0207651_10038655	3300025960	Bacteria	3139
208	Ga0207712_10081330	3300025961	Bacteria	2359
209	Ga0207712_10189029	3300025961	Bacteria	1624
210	Ga0207668_10016049	3300025972	Bacteria	4666
211	Ga0207668_10690559	3300025972	Bacteria	896
212	Ga0207640_10263303	3300025981	Bacteria	1345
213	Ga0207658_10070906	3300025986	Bacteria	2637
214	Ga0207703_10005193	3300026035	Bacteria	10522
215	Ga0207703_10278091	3300026035	Bacteria	1519
216	Ga0207639_10029877	3300026041	Bacteria	3994
217	Ga0207678_10045622	3300026067	Bacteria	3790
218	Ga0207708_10190467	3300026075	Bacteria	1632
219	Ga0207702_10010653	3300026078	Bacteria	7682
220	Ga0207702_10157729	3300026078	Bacteria	2070
221	Ga0207702_10298434	3300026078	Bacteria	1528
222	Ga0207702_10320224	3300026078	Bacteria	1477
223	Ga0207702_10464717	3300026078	Bacteria	1229
224	Ga0207641_10101463	3300026088	Bacteria	2536
225	Ga0207676_10127530	3300026095	Bacteria	2157
226	Ga0207675_100086587	3300026118	Bacteria	2942
227	Ga0207683_10009372	3300026121	Bacteria	8339
228	Ga0207698_10022520	3300026142	Bacteria	4381
229	Ga0207698_10271535	3300026142	Bacteria	1563
230	Ga0268266_10037556	3300028379	Bacteria	4125
231	Ga0268266_10072392	3300028379	Bacteria	2989
232	Ga0268266_10594126	3300028379	Bacteria	1063
233	Ga0268265_10082181	3300028380	Bacteria	2547
234	Ga0268265_10121867	3300028380	Bacteria	2150
235	Ga0268264_10005784	3300028381	Bacteria	10484
236	Ga0268264_10026017	3300028381	Bacteria	4778
237	Ga0268264_10454716	3300028381	Bacteria	1241
238	Ga0265334_10004351	3300028573	Bacteria	6296
239	Ga0316176_1080438	3300030732	Bacteria	19551
240	Ga0314311_1128988	3300030733	Bacteria	2335
241	Ga0307513_10208616	3300031456	Bacteria	1787
242	Ga0373928_0105725	3300035084	Bacteria	739
243	Ga0373949_0007852	3300035090	Bacteria	2339
244	Ga0373952_0051031	3300035092	Bacteria	986
245	Ga0373923_0005110	3300035111	Bacteria	4429
246	Ga0373932_0106786	3300035112	Bacteria	918
247	Ga0373939_0032606	3300035114	Bacteria	1515
248	Ga0373953_0046346	3300035117	Bacteria	1745
249	Ga0373954_0201161	3300035118	Bacteria	979
250	Ga0373956_0065228	3300035119	Bacteria	1654
251	Ga0373955_0004532	3300035172	Bacteria	6156
252	Ga0373927_0022958	3300035695	Bacteria	4087
253	Ga0373927_0090273	3300035695	Bacteria	1990
254	Ga0373937_0006560	3300036401	Bacteria	10052
255	Ga0373937_1085452	3300036401	Bacteria	749
256	Ga0395899_0192365	3300037312	Bacteria	1427
257	Ga0395899_0305093	3300037312	Bacteria	1076
258	Ga0395900_0000774	3300037418	Bacteria	42584
259	Ga0395898_0000015	3300037466	Bacteria	439819
260	Ga0395905_0108468	3300037471	Bacteria	2606
261	Ga0436364_0011164	3300037853	Bacteria	2753
262	Ga0436364_0025119	3300037853	Bacteria	13977
263	Ga0436364_0928292	3300037853	Bacteria	6743
264	Ga0436364_1040466	3300037853	Bacteria	95595
265	Ga0395901_0272710	3300038443	Bacteria	1759
266	Ga0436365_0121523	3300039437	Bacteria	6360
267	Ga0436365_0527945	3300039437	Bacteria	5350
268	Ga0436365_1119806	3300039437	Bacteria	3352
269	Ga0451837_1052306	3300041494	Bacteria	1928
270	Ga0439449_0027099	3300042007	Bacteria	2139
271	Ga0451577_0051943	3300042876	Bacteria	3660
272	Ga0466969_0023377	3300044656	Bacteria	3186
273	Ga0466969_0071504	3300044656	Bacteria	1668
274	Ga0466972_0005176	3300044658	Bacteria	6528
275	Ga0466972_0025388	3300044658	Bacteria	2938
276	Ga0466972_0077011	3300044658	Bacteria	1589
277	Ga0466965_0002921	3300044683	Bacteria	7386
278	Ga0466965_0005478	3300044683	Bacteria	5724
279	Ga0466965_0057658	3300044683	Bacteria	1936
280	Ga0466965_0139216	3300044683	Bacteria	1263
281	Ga0466966_0016485	3300044684	Bacteria	4880
282	Ga0466966_0102629	3300044684	Bacteria	1768
283	Ga0466961_0006026	3300044693	Bacteria	7688
284	Ga0466961_0014022	3300044693	Bacteria	5138
285	Ga0466961_0015798	3300044693	Bacteria	4844
286	Ga0466961_0079019	3300044693	Bacteria	2083
287	Ga0466961_0319229	3300044693	Bacteria	947
288	Ga0466961_0324944	3300044693	Bacteria	938
289	Ga0466963_0000170	3300044694	Bacteria	26709
290	Ga0466963_0014559	3300044694	Bacteria	4853
291	Ga0466963_0028695	3300044694	Bacteria	3576
292	Ga0466963_0643382	3300044694	Bacteria	748
293	Ga0466971_0057936	3300044719	Bacteria	1748
294	Ga0466971_0067117	3300044719	Bacteria	1626
295	Ga0466968_0075077	3300044735	Bacteria	1477
296	Ga0466970_0027522	3300044765	Bacteria	2983
297	Ga0466970_0046940	3300044765	Bacteria	2301
298	Ga0466970_0143797	3300044765	Bacteria	1315
299	Ga0466970_0182532	3300044765	Bacteria	1164
300	Ga0466957_0088698	3300044842	Bacteria	1935
301	Ga0466957_0227434	3300044842	Bacteria	1234
302	Ga0466960_0030967	3300044901	Bacteria	2465
303	Ga0466960_0259357	3300044901	Bacteria	968
304	Ga0466960_0384223	3300044901	Bacteria	806
305	Ga0466959_0117407	3300045049	Bacteria	1894
306	Ga0466959_0183437	3300045049	Bacteria	1463
307	Ga0466959_0242051	3300045049	Bacteria	1246
308	Ga0466959_0276342	3300045049	Bacteria	1154
309	Ga0466959_0493995	3300045049	Bacteria	827
310	Ga0466958_0002030	3300045836	Bacteria	9989
311	Ga0466958_0032060	3300045836	Bacteria	3124
312	Ga0466958_0104309	3300045836	Bacteria	1766
313	Ga0466958_0114571	3300045836	Bacteria	1684
314	Ga0466958_0122793	3300045836	Bacteria	1627
315	Ga0466958_0133345	3300045836	Bacteria	1561
316	Ga0466958_0246600	3300045836	Bacteria	1142
317	Ga0466958_0310080	3300045836	Bacteria	1014
318	Ga0466958_0544223	3300045836	Bacteria	754
319	Ga0466958_0576858	3300045836	Bacteria	731
320	Ga0466967_0000442	3300045976	Bacteria	19832
321	Ga0466967_0001786	3300045976	Bacteria	12883
322	Ga0466967_0025241	3300045976	Bacteria	4898
323	Ga0466967_0025914	3300045976	Bacteria	4844
324	Ga0466967_0034848	3300045976	Bacteria	4278
325	Ga0466967_0035449	3300045976	Bacteria	4248
326	Ga0466967_0048921	3300045976	Bacteria	3695
327	Ga0466967_0056418	3300045976	Bacteria	3463
328	Ga0466967_0106438	3300045976	Bacteria	2571
329	Ga0466967_0185344	3300045976	Bacteria	1965
330	Ga0466967_0219086	3300045976	Bacteria	1808
331	Ga0466967_0289200	3300045976	Bacteria	1574
332	Ga0466967_0562030	3300045976	Bacteria	1123
333	Ga0466967_0827641	3300045976	Bacteria	920
334	Ga0466967_0983982	3300045976	Bacteria	840
335	Ga0495592_0064189	3300046454	Bacteria	2692
336	Ga0495603_0235607	3300046455	Bacteria	1055
337	Ga0495603_0349828	3300046455	Bacteria	848
338	Ga0495606_0004765	3300046507	Bacteria	13342
339	Ga0495608_0006783	3300046511	Bacteria	8119
340	Ga0495628_0124297	3300046516	Bacteria	1977
341	Ga0495667_0005257	3300046559	Bacteria	8750
342	Ga0495668_0000349	3300046616	Bacteria	61429
343	Ga0495625_0010115	3300046660	Bacteria	7836
344	Ga0495588_0386695	3300046674	Bacteria	735
345	Ga0495623_0077662	3300046679	Bacteria	2058
346	Ga0495669_0074507	3300046684	Bacteria	1552
347	Ga0495683_0085887	3300047323	Bacteria	1529
348	Ga0495602_0062618	3300048088	Bacteria	3227
349	Ga0495626_0000427	3300048091	Bacteria	43189
350	Ga0496100_0023859	3300048903	Bacteria	3723
351	Ga0496100_0064210	3300048903	Bacteria	2429
352	Ga0496100_0164696	3300048903	Bacteria	1592
353	Ga0496100_0183198	3300048903	Bacteria	1515
354	Ga0496101_0069806	3300048904	Bacteria	2571
355	Ga0496101_0183569	3300048904	Bacteria	1612
356	Ga0496101_0297774	3300048904	Bacteria	1263
357	Ga0496101_0355169	3300048904	Bacteria	1152
358	Ga0496102_0001992	3300048905	Bacteria	17640
359	Ga0496102_0035739	3300048905	Bacteria	4474
360	Ga0496102_0111781	3300048905	Bacteria	2547
361	Ga0496102_0956849	3300048905	Bacteria	777
362	Ga0496103_0005713	3300048906	Bacteria	7435
363	Ga0496103_0129371	3300048906	Bacteria	1612
364	Ga0496103_0483748	3300048906	Bacteria	793
365	Ga0496104_0007030	3300048907	Bacteria	9925
366	Ga0496104_0013659	3300048907	Bacteria	7321
367	Ga0496104_0027737	3300048907	Bacteria	5242
368	Ga0496104_0040426	3300048907	Bacteria	4370
369	Ga0496104_0418852	3300048907	Bacteria	1251
370	Ga0496105_0016792	3300048908	Bacteria	5851
371	Ga0496105_0020412	3300048908	Bacteria	5354
372	Ga0496105_0112219	3300048908	Bacteria	2250
373	Ga0496105_0154392	3300048908	Bacteria	1886
374	Ga0496105_0184351	3300048908	Bacteria	1708
375	Ga0496105_0237329	3300048908	Bacteria	1480
376	Ga0496105_0252503	3300048908	Bacteria	1428
377	Ga0496106_0002142	3300048909	Bacteria	14744
378	Ga0496106_0013463	3300048909	Bacteria	6038
379	Ga0496107_0000563	3300048910	Bacteria	20750
380	Ga0496107_0073918	3300048910	Bacteria	2480
381	Ga0496107_0083803	3300048910	Bacteria	2325
382	Ga0496108_0007681	3300048911	Bacteria	8735
383	Ga0496108_0023983	3300048911	Bacteria	5022
384	Ga0496108_0047310	3300048911	Bacteria	3596
385	Ga0496108_0066324	3300048911	Bacteria	3043
386	Ga0496108_0531350	3300048911	Bacteria	1027
387	Ga0496109_0004733	3300048912	Bacteria	11373
388	Ga0496109_0007746	3300048912	Bacteria	9093
389	Ga0496109_0497804	3300048912	Bacteria	1150
390	Ga0496110_0011153	3300048913	Bacteria	7344
391	Ga0496110_0099598	3300048913	Bacteria	2605
392	Ga0496111_0049496	3300048914	Bacteria	3030
393	Ga0496112_0003876	3300048915	Bacteria	12504
394	Ga0496112_0014483	3300048915	Bacteria	7320
395	Ga0496112_0020617	3300048915	Bacteria	6250
396	Ga0496112_0038479	3300048915	Bacteria	4671
397	Ga0496112_0059470	3300048915	Bacteria	3766
398	Ga0496112_0359071	3300048915	Bacteria	1399
399	Ga0496113_0018307	3300048916	Bacteria	4876
400	Ga0496113_0108877	3300048916	Bacteria	2154
401	Ga0496113_0179520	3300048916	Bacteria	1678
402	Ga0496113_0288875	3300048916	Bacteria	1312
403	Ga0496114_0000006	3300048917	Bacteria	472921
404	Ga0496114_0008364	3300048917	Bacteria	8195
405	Ga0496114_0226125	3300048917	Bacteria	1643
406	Ga0496114_0269017	3300048917	Bacteria	1501
407	Ga0496114_0633601	3300048917	Bacteria	941
408	Ga0496115_0002640	3300048918	Bacteria	12878
409	Ga0496115_0015701	3300048918	Bacteria	5750
410	Ga0496115_0020300	3300048918	Bacteria	5125
411	Ga0496115_0063579	3300048918	Bacteria	2977
412	Ga0496115_0242309	3300048918	Bacteria	1486
413	Ga0496115_0321034	3300048918	Bacteria	1267
414	Ga0496115_0349775	3300048918	Bacteria	1205
415	Ga0496115_0395816	3300048918	Bacteria	1121
416	Ga0496116_0151352	3300048919	Bacteria	1288
417	Ga0496117_0006149	3300048920	Bacteria	12269
418	Ga0496117_0030593	3300048920	Bacteria	4127
419	Ga0496118_0002736	3300048921	Bacteria	23202
420	Ga0496119_0043788	3300048922	Bacteria	2825
421	Ga0496122_0001200	3300048925	Bacteria	44223
422	Ga0496123_0001124	3300048926	Bacteria	39914
423	Ga0496125_0127380	3300048928	Bacteria	1801
424	Ga0496126_0004104	3300048929	Bacteria	17619
425	Ga0496126_0034592	3300048929	Bacteria	4745
426	Ga0496126_0075942	3300048929	Bacteria	2981
427	Ga0496126_0090140	3300048929	Bacteria	2698
428	Ga0496126_0095429	3300048929	Bacteria	2609
429	Ga0501031_0155011	3300049568	Bacteria	1497
430	Ga0501031_0194330	3300049568	Bacteria	1324
431	Ga0501033_0515472	3300049570	Bacteria	826
432	Ga0501034_0010956	3300049571	Bacteria	9419
433	Ga0501036_0035628	3300049572	Bacteria	4210
434	Ga0501036_0534169	3300049572	Bacteria	975
435	Ga0501037_0096225	3300049573	Bacteria	2140
436	Ga0501038_0061534	3300049574	Bacteria	3210
437	Ga0501039_0009061	3300049575	Bacteria	7584
438	Ga0501039_0106270	3300049575	Bacteria	2192
439	Ga0501039_0151146	3300049575	Bacteria	1824
440	Ga0501040_0024064	3300049576	Bacteria	4086
441	Ga0501040_0032380	3300049576	Bacteria	3537
442	Ga0501041_0003540	3300049577	Bacteria	8982
443	Ga0501041_0185574	3300049577	Bacteria	1302
444	Ga0501041_0408393	3300049577	Bacteria	860
445	Ga0501042_0000713	3300049578	Bacteria	18051
446	Ga0501042_0034414	3300049578	Bacteria	3592
447	Ga0501042_0086114	3300049578	Bacteria	2253
448	Ga0501042_0101798	3300049578	Bacteria	2066
449	Ga0501043_0005966	3300049579	Bacteria	9789
450	Ga0501043_0116680	3300049579	Bacteria	2095
451	Ga0501043_0172725	3300049579	Bacteria	1686
452	Ga0501046_0054059	3300049580	Bacteria	3160
453	Ga0501048_0009752	3300049582	Bacteria	7201
454	Ga0501048_0016804	3300049582	Bacteria	5394
455	Ga0501048_0066521	3300049582	Bacteria	2548
456	Ga0501048_0117984	3300049582	Bacteria	1874
457	Ga0501067_0009015	3300049583	Bacteria	5530
458	Ga0501067_0020499	3300049583	Bacteria	3659
459	Ga0501068_0021712	3300049584	Bacteria	3752
460	Ga0501069_0051065	3300049585	Bacteria	2301
461	Ga0501069_0169400	3300049585	Bacteria	1259
462	Ga0501070_0000167	3300049586	Bacteria	60680
463	Ga0501070_0001898	3300049586	Bacteria	18497
464	Ga0501071_0016685	3300049587	Bacteria	5052
465	Ga0501071_0019161	3300049587	Bacteria	4747
466	Ga0501071_0034131	3300049587	Bacteria	3619
467	Ga0501071_0169138	3300049587	Bacteria	1636
468	Ga0501072_0004698	3300049588	Bacteria	10407
469	Ga0501072_0012933	3300049588	Bacteria	6385
470	Ga0501072_0016120	3300049588	Bacteria	5731
471	Ga0501072_0025892	3300049588	Bacteria	4570
472	Ga0501074_0035821	3300049590	Bacteria	3595
473	Ga0501074_0105551	3300049590	Bacteria	2017
474	Ga0501074_0275524	3300049590	Bacteria	1196
475	Ga0501075_0059431	3300049591	Bacteria	2880
476	Ga0501075_0059803	3300049591	Bacteria	2871
477	Ga0501075_0117753	3300049591	Bacteria	2019
478	Ga0501075_0281512	3300049591	Bacteria	1267
479	Ga0501076_0029443	3300049592	Bacteria	4271
480	Ga0501076_0062473	3300049592	Bacteria	2966
481	Ga0501076_0511789	3300049592	Bacteria	989
482	Ga0501077_0017298	3300049593	Bacteria	4548
483	Ga0501077_0018834	3300049593	Bacteria	4369
484	Ga0501079_0003546	3300049741	Bacteria	11473
485	Ga0501079_0077546	3300049741	Bacteria	2570
486	Ga0501079_0183185	3300049741	Bacteria	1634
487	Ga0501080_0027502	3300049742	Bacteria	5289
488	Ga0501080_0129245	3300049742	Bacteria	2338
489	Ga0501080_0584782	3300049742	Bacteria	992
490	Ga0501081_0027785	3300049743	Bacteria	3815
491	Ga0501081_0063831	3300049743	Bacteria	2556
492	Ga0501083_0096761	3300049744	Bacteria	1948
493	Ga0501083_0252847	3300049744	Bacteria	1147
494	Ga0501035_0070616	3300049822	Bacteria	3093
495	Ga0501044_0002645	3300049823	Bacteria	20386
496	Ga0501045_0111118	3300049824	Bacteria	2032
497	nmdc:mga00v17_59455_c1	3300050491	Bacteria	2345
498	nmdc:mga05p37_4252_c1	3300050507	Bacteria	16729
499	nmdc:mga06r32_602912_c1	3300050510	Bacteria	1069
500	nmdc:mga0n895_17102_c1	3300050512	Bacteria	6679
501	nmdc:mga0n895_9583_c1	3300050512	Bacteria	8482
502	nmdc:mga0rr50_19744_c1	3300050513	Bacteria	4557
503	nmdc:mga0rr50_3905_c1	3300050513	Bacteria	8675
504	nmdc:mga08x19_8671_c1	3300050514	Bacteria	6063
505	nmdc:mga0a205_18267_c1	3300050515	Bacteria	6590
506	nmdc:mga0a205_6731_c1	3300050515	Bacteria	10392
507	Ga0500635_0000002	3300053080	Bacteria	265613
508	Ga0495619_0453715	3300053085	Bacteria	884
509	Ga0500650_0005958	3300053098	Bacteria	4604
510	Ga0500650_0068684	3300053098	Bacteria	1656
511	Ga0500559_0000115	3300053136	Bacteria	63289
512	Ga0500573_0091418	3300053140	Bacteria	1719
513	Ga0500577_0002280	3300053142	Bacteria	4890
514	Ga0500577_0014334	3300053142	Bacteria	2448
515	Ga0500616_0041385	3300053153	Bacteria	2473
516	Ga0501084_0021968	3300054114	Bacteria	5323
517	Ga0501084_0094193	3300054114	Bacteria	2514
518	Ga0501084_0128306	3300054114	Bacteria	2134
519	Ga0501084_0314752	3300054114	Bacteria	1322
520	Ga0501082_0003076	3300060353	Bacteria	14555
521	Ga0501082_0020010	3300060353	Bacteria	5767
522	Ga0501082_0028539	3300060353	Bacteria	4806
523	Ga0466962_0039365	3300061719	Bacteria	2264
524	Ga0466962_0061984	3300061719	Bacteria	1785
525	Ga0466962_0091777	3300061719	Bacteria	1455
526	Ga0466962_0220095	3300061719	Bacteria	930
527	Ga0530510_0011703	3300061734	Bacteria	6157
528	Ga0530510_0122883	3300061734	Bacteria	1907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044694	Ga0466963_0643382	Ga0466963_0643382_24_590	187
2	3300045976	Ga0466967_0025914	Ga0466967_0025914_580_1257	194
3	3300035084	Ga0373928_0105725	Ga0373928_0105725_121_714	196
4	3300025904	Ga0207647_10095342	Ga0207647_100953422	200
5	3300041494	Ga0451837_1052306	Ga0451837_1052306_21_701	203
6	3300005339	Ga0070660_100497579	Ga0070660_1004975792	206
7	3300005340	Ga0070689_100223703	Ga0070689_1002237032	206
8	3300005543	Ga0070672_100549383	Ga0070672_1005493831	206
9	3300005578	Ga0068854_100109602	Ga0068854_1001096022	206
10	3300006852	Ga0075433_10518363	Ga0075433_105183631	206
11	3300013306	Ga0163162_10009368	Ga0163162_100093682	206
12	3300025904	Ga0207647_10080738	Ga0207647_100807382	206
13	3300025911	Ga0207654_10570077	Ga0207654_105700771	206
14	3300025913	Ga0207695_10702034	Ga0207695_107020341	206
15	3300025916	Ga0207663_10608643	Ga0207663_106086432	206
16	3300025919	Ga0207657_10277957	Ga0207657_102779571	206
17	3300026035	Ga0207703_10278091	Ga0207703_102780912	206
18	3300026075	Ga0207708_10190467	Ga0207708_101904672	206
19	3300026095	Ga0207676_10127530	Ga0207676_101275303	206
20	3300026142	Ga0207698_10271535	Ga0207698_102715351	206
21	3300028381	Ga0268264_10454716	Ga0268264_104547162	206
22	3300005341	Ga0070691_10049909	Ga0070691_100499092	212
23	3300005345	Ga0070692_10145367	Ga0070692_101453671	212
24	3300005366	Ga0070659_100079547	Ga0070659_1000795472	212
25	3300005436	Ga0070713_100185636	Ga0070713_1001856361	212
26	3300005439	Ga0070711_100120666	Ga0070711_1001206662	212
27	3300005440	Ga0070705_100100203	Ga0070705_1001002032	212
28	3300005456	Ga0070678_100052591	Ga0070678_1000525912	212
29	3300005539	Ga0068853_100067440	Ga0068853_1000674402	212
30	3300005545	Ga0070695_100101475	Ga0070695_1001014752	212
31	3300005546	Ga0070696_100151427	Ga0070696_1001514272	212
32	3300005547	Ga0070693_100064399	Ga0070693_1000643992	212
33	3300005548	Ga0070665_100099153	Ga0070665_1000991535	212
34	3300005563	Ga0068855_100051303	Ga0068855_1000513032	212
35	3300005564	Ga0070664_100229133	Ga0070664_1002291332	212
36	3300005577	Ga0068857_100241500	Ga0068857_1002415002	212
37	3300005614	Ga0068856_100236938	Ga0068856_1002369382	212
38	3300005615	Ga0070702_100007235	Ga0070702_1000072356	212
39	3300005618	Ga0068864_100205471	Ga0068864_1002054712	212
40	3300005841	Ga0068863_100027312	Ga0068863_1000273127	212
41	3300005842	Ga0068858_100176441	Ga0068858_1001764413	212
42	3300006028	Ga0070717_10024953	Ga0070717_100249537	212
43	3300006358	Ga0068871_100026636	Ga0068871_1000266362	212
44	3300006881	Ga0068865_100019428	Ga0068865_1000194282	212
45	3300025901	Ga0207688_10003537	Ga0207688_100035378	212
46	3300025914	Ga0207671_10008311	Ga0207671_100083112	212
47	3300025924	Ga0207694_10103581	Ga0207694_101035812	212
48	3300025934	Ga0207686_10037717	Ga0207686_100377171	212
49	3300025935	Ga0207709_10029597	Ga0207709_100295972	212
50	3300025939	Ga0207665_10000830	Ga0207665_1000083019	212
51	3300025940	Ga0207691_10156828	Ga0207691_101568282	212
52	3300025942	Ga0207689_10036774	Ga0207689_100367744	212
53	3300025949	Ga0207667_10037395	Ga0207667_100373957	212
54	3300025961	Ga0207712_10081330	Ga0207712_100813303	212
55	3300025972	Ga0207668_10016049	Ga0207668_100160492	212
56	3300026067	Ga0207678_10045622	Ga0207678_100456226	212
57	3300026118	Ga0207675_100086587	Ga0207675_1000865873	212
58	3300026121	Ga0207683_10009372	Ga0207683_100093728	212
59	3300028380	Ga0268265_10082181	Ga0268265_100821812	212
60	3300050491	nmdc:mga00v17_59455_c1	nmdc:mga00v17_59455_c1_968_1651	212
61	3300049568	Ga0501031_0194330	Ga0501031_0194330_532_1230	214
62	3300049570	Ga0501033_0515472	Ga0501033_0515472_44_742	214
63	3300049572	Ga0501036_0035628	Ga0501036_0035628_848_1546	214
64	3300049573	Ga0501037_0096225	Ga0501037_0096225_187_885	214
65	3300049574	Ga0501038_0061534	Ga0501038_0061534_261_959	214
66	3300049575	Ga0501039_0106270	Ga0501039_0106270_74_772	214
67	3300049576	Ga0501040_0032380	Ga0501040_0032380_2123_2821	214
68	3300049577	Ga0501041_0408393	Ga0501041_0408393_81_779	214
69	3300049578	Ga0501042_0000713	Ga0501042_0000713_12002_12700	214
70	3300049584	Ga0501068_0021712	Ga0501068_0021712_1481_2179	214
71	3300049585	Ga0501069_0051065	Ga0501069_0051065_901_1599	214
72	3300049587	Ga0501071_0019161	Ga0501071_0019161_1302_2000	214
73	3300049588	Ga0501072_0025892	Ga0501072_0025892_379_1077	214
74	3300049590	Ga0501074_0035821	Ga0501074_0035821_1206_1904	214
75	3300049591	Ga0501075_0117753	Ga0501075_0117753_1136_1834	214
76	3300049741	Ga0501079_0003546	Ga0501079_0003546_10473_11171	214
77	3300049742	Ga0501080_0027502	Ga0501080_0027502_4096_4794	214
78	3300049743	Ga0501081_0063831	Ga0501081_0063831_1224_1922	214
79	3300049744	Ga0501083_0096761	Ga0501083_0096761_762_1460	214
80	3300049822	Ga0501035_0070616	Ga0501035_0070616_370_1068	214
81	3300054114	Ga0501084_0094193	Ga0501084_0094193_376_1074	214
82	3300060353	Ga0501082_0028539	Ga0501082_0028539_128_826	214
83	3300046674	Ga0495588_0386695	Ga0495588_0386695_33_722	215
84	3300049593	Ga0501077_0018834	Ga0501077_0018834_2546_3262	215
85	3300048905	Ga0496102_0035739	Ga0496102_0035739_1593_2300	217
86	3300048908	Ga0496105_0154392	Ga0496105_0154392_221_928	217
87	3300048916	Ga0496113_0179520	Ga0496113_0179520_341_1048	217
88	3300005327	Ga0070658_10224598	Ga0070658_102245981	218
89	3300005339	Ga0070660_100003028	Ga0070660_1000030282	218
90	3300005366	Ga0070659_100017697	Ga0070659_1000176975	218
91	3300005468	Ga0070707_100217641	Ga0070707_1002176412	218
92	3300005471	Ga0070698_100018435	Ga0070698_1000184354	218
93	3300005563	Ga0068855_100386399	Ga0068855_1003863991	218
94	3300025919	Ga0207657_10008380	Ga0207657_1000838012	218
95	3300025922	Ga0207646_10053895	Ga0207646_100538953	218
96	3300025932	Ga0207690_10073914	Ga0207690_100739142	218
97	3300046507	Ga0495606_0004765	Ga0495606_0004765_5521_6228	218
98	3300046616	Ga0495668_0000349	Ga0495668_0000349_7101_7808	218
99	3300046660	Ga0495625_0010115	Ga0495625_0010115_79_786	218
100	3300047323	Ga0495683_0085887	Ga0495683_0085887_757_1464	218
101	3300048091	Ga0495626_0000427	Ga0495626_0000427_35356_36063	218
102	3300005344	Ga0070661_100540989	Ga0070661_1005409891	219
103	3300005937	Ga0081455_10049986	Ga0081455_100499863	219
104	3300009545	Ga0105237_10219341	Ga0105237_102193412	219
105	3300010375	Ga0105239_10010166	Ga0105239_100101663	219
106	3300025933	Ga0207706_10089275	Ga0207706_100892752	219
107	3300061719	Ga0466962_0039365	Ga0466962_0039365_1410_2072	219
108	iso_pu_bacteria	2643221617	2644101322	219
109	iso_pu_bacteria	2643221620	2644119272	219
110	3300044658	Ga0466972_0077011	Ga0466972_0077011_703_1368	220
111	3300045836	Ga0466958_0104309	Ga0466958_0104309_495_1160	220
112	3300045976	Ga0466967_0219086	Ga0466967_0219086_717_1382	220
113	iso_pu_bacteria	2791354901	2791912295	220
114	3300005563	Ga0068855_100231654	Ga0068855_1002316543	221
115	3300005983	Ga0081540_1000095	Ga0081540_100009564	221
116	3300006871	Ga0075434_100082700	Ga0075434_1000827001	221
117	3300007076	Ga0075435_100066519	Ga0075435_1000665192	221
118	3300009147	Ga0114129_10010532	Ga0114129_100105323	221
119	3300009147	Ga0114129_10235351	Ga0114129_102353513	221
120	3300025949	Ga0207667_10729305	Ga0207667_107293052	221
121	3300042876	Ga0451577_0051943	Ga0451577_0051943_1044_1772	221
122	3300049591	Ga0501075_0281512	Ga0501075_0281512_49_720	221
123	3300050507	nmdc:mga05p37_4252_c1	nmdc:mga05p37_4252_c1_8565_9293	221
124	3300050512	nmdc:mga0n895_17102_c1	nmdc:mga0n895_17102_c1_959_1687	221
125	3300050513	nmdc:mga0rr50_3905_c1	nmdc:mga0rr50_3905_c1_7184_7912	221
126	3300050514	nmdc:mga08x19_8671_c1	nmdc:mga08x19_8671_c1_598_1326	221
127	3300050515	nmdc:mga0a205_18267_c1	nmdc:mga0a205_18267_c1_3123_3851	221
128	3300005434	Ga0070709_10289113	Ga0070709_102891131	222
129	3300005435	Ga0070714_100107150	Ga0070714_1001071502	222
130	3300005437	Ga0070710_10000789	Ga0070710_1000078911	222
131	3300005468	Ga0070707_100014368	Ga0070707_1000143685	222
132	3300005471	Ga0070698_100034690	Ga0070698_1000346903	222
133	3300006175	Ga0070712_100000007	Ga0070712_100000007105	222
134	3300009098	Ga0105245_10008786	Ga0105245_100087862	222
135	3300021388	Ga0213875_10004089	Ga0213875_100040892	222
136	3300021388	Ga0213875_10035148	Ga0213875_100351482	222
137	3300025898	Ga0207692_10001955	Ga0207692_100019558	222
138	3300025922	Ga0207646_10048731	Ga0207646_100487313	222
139	3300025929	Ga0207664_10148414	Ga0207664_101484142	222
140	3300025932	Ga0207690_10601193	Ga0207690_106011932	222
141	3300025981	Ga0207640_10263303	Ga0207640_102633034	222
142	3300026078	Ga0207702_10464717	Ga0207702_104647172	222
143	3300030732	Ga0316176_1080438	Ga0316176_10804387	222
144	3300030733	Ga0314311_1128988	Ga0314311_11289882	222
145	3300036401	Ga0373937_1085452	Ga0373937_1085452_48_722	222
146	3300037853	Ga0436364_0025119	Ga0436364_0025119_8411_9112	222
147	3300037853	Ga0436364_0928292	Ga0436364_0928292_4614_5288	222
148	3300044658	Ga0466972_0025388	Ga0466972_0025388_69_749	222
149	3300044683	Ga0466965_0002921	Ga0466965_0002921_2300_2980	222
150	3300044683	Ga0466965_0005478	Ga0466965_0005478_565_1245	222
151	3300044735	Ga0466968_0075077	Ga0466968_0075077_732_1412	222
152	3300045976	Ga0466967_0034848	Ga0466967_0034848_449_1132	222
153	3300045976	Ga0466967_0035449	Ga0466967_0035449_2063_2737	222
154	3300045976	Ga0466967_0289200	Ga0466967_0289200_496_1170	222
155	3300045976	Ga0466967_0827641	Ga0466967_0827641_55_729	222
156	3300048911	Ga0496108_0007681	Ga0496108_0007681_1203_1883	222
157	3300048915	Ga0496112_0003876	Ga0496112_0003876_2058_2744	222
158	3300048915	Ga0496112_0059470	Ga0496112_0059470_48_728	222
159	3300048918	Ga0496115_0020300	Ga0496115_0020300_2671_3345	222
160	3300048929	Ga0496126_0090140	Ga0496126_0090140_1929_2603	222
161	3300049572	Ga0501036_0534169	Ga0501036_0534169_236_925	222
162	3300050510	nmdc:mga06r32_602912_c1	nmdc:mga06r32_602912_c1_10_684	222
163	iso_pu_bacteria	2857727296	2857728213	222
164	3300005330	Ga0070690_100080176	Ga0070690_1000801762	223
165	3300005335	Ga0070666_10037222	Ga0070666_100372223	223
166	3300005336	Ga0070680_100277323	Ga0070680_1002773232	223
167	3300005347	Ga0070668_100580509	Ga0070668_1005805092	223
168	3300005353	Ga0070669_100000127	Ga0070669_10000012715	223
169	3300005355	Ga0070671_100003133	Ga0070671_1000031338	223
170	3300005355	Ga0070671_100004712	Ga0070671_1000047123	223
171	3300005355	Ga0070671_100026974	Ga0070671_1000269742	223
172	3300005355	Ga0070671_100085349	Ga0070671_1000853492	223
173	3300005367	Ga0070667_100078154	Ga0070667_1000781545	223
174	3300005367	Ga0070667_100382490	Ga0070667_1003824902	223
175	3300005367	Ga0070667_100395219	Ga0070667_1003952192	223
176	3300005435	Ga0070714_100231716	Ga0070714_1002317162	223
177	3300005436	Ga0070713_100042744	Ga0070713_1000427444	223
178	3300005436	Ga0070713_100404127	Ga0070713_1004041271	223
179	3300005458	Ga0070681_10391224	Ga0070681_103912241	223
180	3300005539	Ga0068853_100037225	Ga0068853_1000372252	223
181	3300005543	Ga0070672_100533943	Ga0070672_1005339432	223
182	3300005544	Ga0070686_100247486	Ga0070686_1002474861	223
183	3300005548	Ga0070665_100111491	Ga0070665_1001114912	223
184	3300005563	Ga0068855_100013417	Ga0068855_1000134179	223
185	3300005563	Ga0068855_100324151	Ga0068855_1003241512	223
186	3300005614	Ga0068856_100055600	Ga0068856_1000556002	223
187	3300005614	Ga0068856_100085353	Ga0068856_1000853532	223
188	3300005614	Ga0068856_100142479	Ga0068856_1001424792	223
189	3300005617	Ga0068859_100104143	Ga0068859_1001041434	223
190	3300005617	Ga0068859_100152594	Ga0068859_1001525942	223
191	3300005618	Ga0068864_100397766	Ga0068864_1003977662	223
192	3300005841	Ga0068863_100617681	Ga0068863_1006176812	223
193	3300005842	Ga0068858_100001051	Ga0068858_1000010516	223
194	3300005843	Ga0068860_100039777	Ga0068860_1000397772	223
195	3300005843	Ga0068860_100330405	Ga0068860_1003304052	223
196	3300005843	Ga0068860_100331051	Ga0068860_1003310512	223
197	3300005844	Ga0068862_100085123	Ga0068862_1000851232	223
198	3300005844	Ga0068862_100203562	Ga0068862_1002035622	223
199	3300005937	Ga0081455_10000107	Ga0081455_1000010718	223
200	3300005937	Ga0081455_10003258	Ga0081455_1000325817	223
201	3300005937	Ga0081455_10047949	Ga0081455_100479492	223
202	3300005983	Ga0081540_1002819	Ga0081540_10028196	223
203	3300005983	Ga0081540_1095287	Ga0081540_10952872	223
204	3300006028	Ga0070717_10031447	Ga0070717_100314472	223
205	3300006051	Ga0075364_10018206	Ga0075364_100182063	223
206	3300006173	Ga0070716_100248844	Ga0070716_1002488443	223
207	3300006175	Ga0070712_100016403	Ga0070712_1000164032	223
208	3300006175	Ga0070712_100077780	Ga0070712_1000777802	223
209	3300006931	Ga0097620_100104146	Ga0097620_1001041462	223
210	3300006931	Ga0097620_100152607	Ga0097620_1001526072	223
211	3300009093	Ga0105240_10037190	Ga0105240_100371906	223
212	3300009093	Ga0105240_10472112	Ga0105240_104721122	223
213	3300009098	Ga0105245_10006684	Ga0105245_100066841	223
214	3300009101	Ga0105247_10086115	Ga0105247_100861152	223
215	3300009174	Ga0105241_10277010	Ga0105241_102770102	223
216	3300009176	Ga0105242_10036318	Ga0105242_100363184	223
217	3300009177	Ga0105248_10112654	Ga0105248_101126547	223
218	3300009177	Ga0105248_10186705	Ga0105248_101867052	223
219	3300009177	Ga0105248_10239054	Ga0105248_102390542	223
220	3300009177	Ga0105248_10586996	Ga0105248_105869962	223
221	3300009545	Ga0105237_10379996	Ga0105237_103799962	223
222	3300009545	Ga0105237_10552659	Ga0105237_105526592	223
223	3300009551	Ga0105238_10083383	Ga0105238_100833833	223
224	3300009551	Ga0105238_10641236	Ga0105238_106412362	223
225	3300010375	Ga0105239_10015644	Ga0105239_100156442	223
226	3300013104	Ga0157370_10013795	Ga0157370_100137952	223
227	3300013105	Ga0157369_10106522	Ga0157369_101065222	223
228	3300013105	Ga0157369_10314634	Ga0157369_103146343	223
229	3300013307	Ga0157372_10493401	Ga0157372_104934012	223
230	3300014325	Ga0163163_10097698	Ga0163163_100976982	223
231	3300014325	Ga0163163_10808785	Ga0163163_108087851	223
232	3300014968	Ga0157379_10197633	Ga0157379_101976332	223
233	3300014969	Ga0157376_10549898	Ga0157376_105498982	223
234	3300020077	Ga0206351_10696167	Ga0206351_106961672	223
235	3300021384	Ga0213876_10143837	Ga0213876_101438372	223
236	3300021388	Ga0213875_10000186	Ga0213875_100001865	223
237	3300021388	Ga0213875_10140524	Ga0213875_101405242	223
238	3300025913	Ga0207695_10053059	Ga0207695_100530594	223
239	3300025915	Ga0207693_10023674	Ga0207693_100236743	223
240	3300025915	Ga0207693_10029381	Ga0207693_100293812	223
241	3300025917	Ga0207660_10174507	Ga0207660_101745072	223
242	3300025923	Ga0207681_10000187	Ga0207681_1000018745	223
243	3300025924	Ga0207694_10349947	Ga0207694_103499472	223
244	3300025928	Ga0207700_10096017	Ga0207700_100960172	223
245	3300025928	Ga0207700_10669012	Ga0207700_106690122	223
246	3300025931	Ga0207644_10000353	Ga0207644_1000035319	223
247	3300025931	Ga0207644_10084907	Ga0207644_100849071	223
248	3300025939	Ga0207665_10039320	Ga0207665_100393202	223
249	3300025940	Ga0207691_10491398	Ga0207691_104913982	223
250	3300025941	Ga0207711_10043263	Ga0207711_100432632	223
251	3300025941	Ga0207711_10272144	Ga0207711_102721442	223
252	3300025941	Ga0207711_10483598	Ga0207711_104835982	223
253	3300025949	Ga0207667_10008467	Ga0207667_100084674	223
254	3300025949	Ga0207667_10149706	Ga0207667_101497062	223
255	3300025949	Ga0207667_10243870	Ga0207667_102438703	223
256	3300025960	Ga0207651_10038655	Ga0207651_100386555	223
257	3300025961	Ga0207712_10189029	Ga0207712_101890291	223
258	3300025972	Ga0207668_10690559	Ga0207668_106905591	223
259	3300025986	Ga0207658_10070906	Ga0207658_100709062	223
260	3300026035	Ga0207703_10005193	Ga0207703_100051936	223
261	3300026041	Ga0207639_10029877	Ga0207639_100298772	223
262	3300026078	Ga0207702_10010653	Ga0207702_100106535	223
263	3300026078	Ga0207702_10157729	Ga0207702_101577292	223
264	3300026078	Ga0207702_10320224	Ga0207702_103202242	223
265	3300028379	Ga0268266_10072392	Ga0268266_100723922	223
266	3300028379	Ga0268266_10594126	Ga0268266_105941262	223
267	3300028380	Ga0268265_10121867	Ga0268265_101218672	223
268	3300028381	Ga0268264_10005784	Ga0268264_100057843	223
269	3300028381	Ga0268264_10026017	Ga0268264_100260172	223
270	3300031456	Ga0307513_10208616	Ga0307513_102086162	223
271	3300035090	Ga0373949_0007852	Ga0373949_0007852_332_1009	223
272	3300035092	Ga0373952_0051031	Ga0373952_0051031_192_869	223
273	3300035111	Ga0373923_0005110	Ga0373923_0005110_3680_4366	223
274	3300035112	Ga0373932_0106786	Ga0373932_0106786_94_771	223
275	3300035114	Ga0373939_0032606	Ga0373939_0032606_112_789	223
276	3300035117	Ga0373953_0046346	Ga0373953_0046346_760_1446	223
277	3300035118	Ga0373954_0201161	Ga0373954_0201161_99_785	223
278	3300035119	Ga0373956_0065228	Ga0373956_0065228_172_858	223
279	3300035172	Ga0373955_0004532	Ga0373955_0004532_701_1387	223
280	3300035695	Ga0373927_0022958	Ga0373927_0022958_836_1513	223
281	3300035695	Ga0373927_0090273	Ga0373927_0090273_737_1414	223
282	3300036401	Ga0373937_0006560	Ga0373937_0006560_2914_3600	223
283	3300037471	Ga0395905_0108468	Ga0395905_0108468_493_1179	223
284	3300037853	Ga0436364_0011164	Ga0436364_0011164_1284_1976	223
285	3300037853	Ga0436364_1040466	Ga0436364_1040466_35281_35967	223
286	3300038443	Ga0395901_0272710	Ga0395901_0272710_1050_1736	223
287	3300039437	Ga0436365_0527945	Ga0436365_0527945_2716_3393	223
288	3300039437	Ga0436365_1119806	Ga0436365_1119806_227_928	223
289	3300042007	Ga0439449_0027099	Ga0439449_0027099_669_1358	223
290	3300044656	Ga0466969_0023377	Ga0466969_0023377_426_1103	223
291	3300044656	Ga0466969_0071504	Ga0466969_0071504_808_1500	223
292	3300044658	Ga0466972_0005176	Ga0466972_0005176_967_1644	223
293	3300044683	Ga0466965_0139216	Ga0466965_0139216_187_864	223
294	3300044684	Ga0466966_0016485	Ga0466966_0016485_1395_2072	223
295	3300044693	Ga0466961_0006026	Ga0466961_0006026_1059_1736	223
296	3300044693	Ga0466961_0014022	Ga0466961_0014022_4335_5012	223
297	3300044693	Ga0466961_0015798	Ga0466961_0015798_638_1315	223
298	3300044693	Ga0466961_0079019	Ga0466961_0079019_1363_2055	223
299	3300044694	Ga0466963_0000170	Ga0466963_0000170_404_1081	223
300	3300044694	Ga0466963_0014559	Ga0466963_0014559_4064_4741	223
301	3300044694	Ga0466963_0028695	Ga0466963_0028695_1417_2094	223
302	3300044719	Ga0466971_0057936	Ga0466971_0057936_635_1312	223
303	3300044719	Ga0466971_0067117	Ga0466971_0067117_111_788	223
304	3300044765	Ga0466970_0046940	Ga0466970_0046940_1548_2225	223
305	3300044765	Ga0466970_0143797	Ga0466970_0143797_39_716	223
306	3300044765	Ga0466970_0182532	Ga0466970_0182532_232_915	223
307	3300044842	Ga0466957_0088698	Ga0466957_0088698_65_742	223
308	3300044842	Ga0466957_0227434	Ga0466957_0227434_440_1117	223
309	3300045049	Ga0466959_0117407	Ga0466959_0117407_1068_1745	223
310	3300045049	Ga0466959_0183437	Ga0466959_0183437_102_779	223
311	3300045049	Ga0466959_0242051	Ga0466959_0242051_498_1181	223
312	3300045049	Ga0466959_0276342	Ga0466959_0276342_391_1083	223
313	3300045049	Ga0466959_0493995	Ga0466959_0493995_39_716	223
314	3300045836	Ga0466958_0002030	Ga0466958_0002030_8516_9193	223
315	3300045836	Ga0466958_0032060	Ga0466958_0032060_98_775	223
316	3300045836	Ga0466958_0114571	Ga0466958_0114571_551_1252	223
317	3300045836	Ga0466958_0122793	Ga0466958_0122793_74_751	223
318	3300045836	Ga0466958_0133345	Ga0466958_0133345_543_1220	223
319	3300045836	Ga0466958_0310080	Ga0466958_0310080_255_932	223
320	3300045836	Ga0466958_0544223	Ga0466958_0544223_66_743	223
321	3300045836	Ga0466958_0576858	Ga0466958_0576858_19_696	223
322	3300045976	Ga0466967_0000442	Ga0466967_0000442_10824_11501	223
323	3300045976	Ga0466967_0001786	Ga0466967_0001786_40_717	223
324	3300045976	Ga0466967_0025241	Ga0466967_0025241_3701_4378	223
325	3300045976	Ga0466967_0048921	Ga0466967_0048921_640_1317	223
326	3300045976	Ga0466967_0056418	Ga0466967_0056418_452_1129	223
327	3300045976	Ga0466967_0106438	Ga0466967_0106438_1198_1875	223
328	3300045976	Ga0466967_0185344	Ga0466967_0185344_94_771	223
329	3300045976	Ga0466967_0562030	Ga0466967_0562030_420_1097	223
330	3300045976	Ga0466967_0983982	Ga0466967_0983982_72_749	223
331	3300046455	Ga0495603_0235607	Ga0495603_0235607_98_775	223
332	3300046679	Ga0495623_0077662	Ga0495623_0077662_210_896	223
333	3300046684	Ga0495669_0074507	Ga0495669_0074507_122_808	223
334	3300048088	Ga0495602_0062618	Ga0495602_0062618_47_733	223
335	3300048903	Ga0496100_0023859	Ga0496100_0023859_87_764	223
336	3300048903	Ga0496100_0064210	Ga0496100_0064210_24_713	223
337	3300048904	Ga0496101_0297774	Ga0496101_0297774_151_837	223
338	3300048904	Ga0496101_0355169	Ga0496101_0355169_33_710	223
339	3300048905	Ga0496102_0001992	Ga0496102_0001992_2221_2898	223
340	3300048905	Ga0496102_0956849	Ga0496102_0956849_58_747	223
341	3300048906	Ga0496103_0005713	Ga0496103_0005713_3402_4079	223
342	3300048906	Ga0496103_0129371	Ga0496103_0129371_14_691	223
343	3300048906	Ga0496103_0483748	Ga0496103_0483748_77_763	223
344	3300048907	Ga0496104_0013659	Ga0496104_0013659_6348_7025	223
345	3300048907	Ga0496104_0027737	Ga0496104_0027737_2872_3549	223
346	3300048907	Ga0496104_0040426	Ga0496104_0040426_1891_2580	223
347	3300048908	Ga0496105_0237329	Ga0496105_0237329_73_750	223
348	3300048909	Ga0496106_0002142	Ga0496106_0002142_1595_2284	223
349	3300048909	Ga0496106_0013463	Ga0496106_0013463_5265_5942	223
350	3300048910	Ga0496107_0000563	Ga0496107_0000563_2193_2882	223
351	3300048910	Ga0496107_0083803	Ga0496107_0083803_1015_1692	223
352	3300048911	Ga0496108_0023983	Ga0496108_0023983_1660_2337	223
353	3300048911	Ga0496108_0066324	Ga0496108_0066324_1695_2384	223
354	3300048911	Ga0496108_0531350	Ga0496108_0531350_119_808	223
355	3300048912	Ga0496109_0004733	Ga0496109_0004733_5100_5777	223
356	3300048912	Ga0496109_0007746	Ga0496109_0007746_589_1278	223
357	3300048913	Ga0496110_0011153	Ga0496110_0011153_3846_4523	223
358	3300048913	Ga0496110_0099598	Ga0496110_0099598_386_1075	223
359	3300048914	Ga0496111_0049496	Ga0496111_0049496_136_825	223
360	3300048915	Ga0496112_0014483	Ga0496112_0014483_6232_6921	223
361	3300048915	Ga0496112_0020617	Ga0496112_0020617_1670_2347	223
362	3300048915	Ga0496112_0038479	Ga0496112_0038479_3640_4326	223
363	3300048915	Ga0496112_0359071	Ga0496112_0359071_344_1030	223
364	3300048916	Ga0496113_0018307	Ga0496113_0018307_296_973	223
365	3300048916	Ga0496113_0108877	Ga0496113_0108877_69_746	223
366	3300048917	Ga0496114_0000006	Ga0496114_0000006_81876_82562	223
367	3300048917	Ga0496114_0269017	Ga0496114_0269017_756_1433	223
368	3300048918	Ga0496115_0002640	Ga0496115_0002640_5433_6119	223
369	3300048918	Ga0496115_0063579	Ga0496115_0063579_1442_2119	223
370	3300048928	Ga0496125_0127380	Ga0496125_0127380_60_749	223
371	3300048929	Ga0496126_0034592	Ga0496126_0034592_649_1323	223
372	3300048929	Ga0496126_0095429	Ga0496126_0095429_1470_2147	223
373	3300049571	Ga0501034_0010956	Ga0501034_0010956_3145_3840	223
374	3300049575	Ga0501039_0009061	Ga0501039_0009061_1129_1824	223
375	3300049577	Ga0501041_0003540	Ga0501041_0003540_3659_4354	223
376	3300049578	Ga0501042_0034414	Ga0501042_0034414_1339_2034	223
377	3300049579	Ga0501043_0005966	Ga0501043_0005966_5761_6456	223
378	3300049580	Ga0501046_0054059	Ga0501046_0054059_1337_2032	223
379	3300049582	Ga0501048_0009752	Ga0501048_0009752_5580_6275	223
380	3300049583	Ga0501067_0020499	Ga0501067_0020499_237_929	223
381	3300049586	Ga0501070_0001898	Ga0501070_0001898_15834_16529	223
382	3300049587	Ga0501071_0016685	Ga0501071_0016685_3843_4538	223
383	3300049588	Ga0501072_0004698	Ga0501072_0004698_6826_7521	223
384	3300049592	Ga0501076_0062473	Ga0501076_0062473_1439_2134	223
385	3300049593	Ga0501077_0017298	Ga0501077_0017298_2795_3490	223
386	3300049741	Ga0501079_0183185	Ga0501079_0183185_13_708	223
387	3300049742	Ga0501080_0129245	Ga0501080_0129245_1129_1824	223
388	3300049823	Ga0501044_0002645	Ga0501044_0002645_6856_7551	223
389	3300050512	nmdc:mga0n895_9583_c1	nmdc:mga0n895_9583_c1_6692_7369	223
390	3300050513	nmdc:mga0rr50_19744_c1	nmdc:mga0rr50_19744_c1_57_734	223
391	3300050515	nmdc:mga0a205_6731_c1	nmdc:mga0a205_6731_c1_8879_9556	223
392	3300053085	Ga0495619_0453715	Ga0495619_0453715_64_741	223
393	3300053136	Ga0500559_0000115	Ga0500559_0000115_58055_58726	223
394	3300053153	Ga0500616_0041385	Ga0500616_0041385_1375_2052	223
395	3300054114	Ga0501084_0128306	Ga0501084_0128306_515_1210	223
396	3300060353	Ga0501082_0003076	Ga0501082_0003076_1224_1919	223
397	3300061719	Ga0466962_0061984	Ga0466962_0061984_1023_1700	223
398	3300061719	Ga0466962_0091777	Ga0466962_0091777_526_1203	223
399	3300061719	Ga0466962_0220095	Ga0466962_0220095_34_735	223
400	3300061734	Ga0530510_0122883	Ga0530510_0122883_677_1372	223
401	3300005445	Ga0070708_100044913	Ga0070708_1000449132	224
402	3300005471	Ga0070698_100170304	Ga0070698_1001703042	224
403	3300005616	Ga0068852_100002583	Ga0068852_1000025838	224
404	3300006028	Ga0070717_10045411	Ga0070717_100454113	224
405	3300009174	Ga0105241_10129011	Ga0105241_101290112	224
406	3300013296	Ga0157374_10130858	Ga0157374_101308582	224
407	3300025914	Ga0207671_10030861	Ga0207671_100308612	224
408	3300025927	Ga0207687_10050908	Ga0207687_100509082	224
409	3300026088	Ga0207641_10101463	Ga0207641_101014632	224
410	3300026142	Ga0207698_10022520	Ga0207698_100225202	224
411	3300028379	Ga0268266_10037556	Ga0268266_100375562	224
412	3300028573	Ga0265334_10004351	Ga0265334_100043512	224
413	3300044683	Ga0466965_0057658	Ga0466965_0057658_458_1138	224
414	3300044684	Ga0466966_0102629	Ga0466966_0102629_911_1591	224
415	3300044693	Ga0466961_0324944	Ga0466961_0324944_94_774	224
416	3300044765	Ga0466970_0027522	Ga0466970_0027522_170_850	224
417	3300044901	Ga0466960_0030967	Ga0466960_0030967_278_958	224
418	3300044901	Ga0466960_0259357	Ga0466960_0259357_268_948	224
419	3300046454	Ga0495592_0064189	Ga0495592_0064189_1360_2076	224
420	3300046455	Ga0495603_0349828	Ga0495603_0349828_73_768	224
421	3300046511	Ga0495608_0006783	Ga0495608_0006783_4952_5668	224
422	3300046516	Ga0495628_0124297	Ga0495628_0124297_338_1054	224
423	3300046559	Ga0495667_0005257	Ga0495667_0005257_7363_8079	224
424	3300048907	Ga0496104_0418852	Ga0496104_0418852_114_797	224
425	3300048908	Ga0496105_0112219	Ga0496105_0112219_595_1278	224
426	3300048911	Ga0496108_0047310	Ga0496108_0047310_2211_2894	224
427	3300048912	Ga0496109_0497804	Ga0496109_0497804_75_758	224
428	3300048916	Ga0496113_0288875	Ga0496113_0288875_472_1155	224
429	3300048917	Ga0496114_0226125	Ga0496114_0226125_662_1345	224
430	3300048918	Ga0496115_0242309	Ga0496115_0242309_257_940	224
431	3300048918	Ga0496115_0321034	Ga0496115_0321034_169_852	224
432	3300049583	Ga0501067_0009015	Ga0501067_0009015_1535_2245	224
433	3300049585	Ga0501069_0169400	Ga0501069_0169400_45_755	224
434	3300053098	Ga0500650_0068684	Ga0500650_0068684_294_974	224
435	3300053142	Ga0500577_0002280	Ga0500577_0002280_242_922	224
436	iso_pu_bacteria	2884763398	2884765681	224
437	3300021384	Ga0213876_10006822	Ga0213876_100068222	225
438	3300037312	Ga0395899_0192365	Ga0395899_0192365_314_1027	225
439	3300037418	Ga0395900_0000774	Ga0395900_0000774_15946_16659	225
440	3300037466	Ga0395898_0000015	Ga0395898_0000015_87096_87809	225
441	3300039437	Ga0436365_0121523	Ga0436365_0121523_974_1738	225
442	3300049575	Ga0501039_0151146	Ga0501039_0151146_507_1235	225
443	3300049578	Ga0501042_0101798	Ga0501042_0101798_1298_2026	225
444	3300049579	Ga0501043_0172725	Ga0501043_0172725_136_864	225
445	3300049582	Ga0501048_0117984	Ga0501048_0117984_292_1020	225
446	3300049586	Ga0501070_0000167	Ga0501070_0000167_19191_19949	225
447	3300049587	Ga0501071_0169138	Ga0501071_0169138_717_1445	225
448	3300049588	Ga0501072_0012933	Ga0501072_0012933_968_1708	225
449	3300049590	Ga0501074_0105551	Ga0501074_0105551_892_1620	225
450	3300049590	Ga0501074_0275524	Ga0501074_0275524_436_1185	225
451	3300049591	Ga0501075_0059803	Ga0501075_0059803_1493_2221	225
452	3300049592	Ga0501076_0029443	Ga0501076_0029443_2756_3484	225
453	3300049824	Ga0501045_0111118	Ga0501045_0111118_958_1686	225
454	3300054114	Ga0501084_0314752	Ga0501084_0314752_579_1307	225
455	3300048925	Ga0496122_0001200	Ga0496122_0001200_40910_41599	226
456	3300048926	Ga0496123_0001124	Ga0496123_0001124_955_1644	226
457	3300049582	Ga0501048_0016804	Ga0501048_0016804_42_848	226
458	3300053098	Ga0500650_0005958	Ga0500650_0005958_3276_3986	226
459	3300053140	Ga0500573_0091418	Ga0500573_0091418_786_1475	226
460	3300053142	Ga0500577_0014334	Ga0500577_0014334_840_1550	226
461	iso_pu_bacteria	2643221616	2644097125	226
462	iso_pu_bacteria	2844841374	2844842707	226
463	iso_pu_bacteria	2928153084	2928156293	226
464	iso_pu_bacteria	2964326757	2964328075	226
465	3300049568	Ga0501031_0155011	Ga0501031_0155011_680_1414	227
466	3300049576	Ga0501040_0024064	Ga0501040_0024064_1340_2074	227
467	3300049577	Ga0501041_0185574	Ga0501041_0185574_136_870	227
468	3300049578	Ga0501042_0086114	Ga0501042_0086114_941_1675	227
469	3300049579	Ga0501043_0116680	Ga0501043_0116680_968_1702	227
470	3300049582	Ga0501048_0066521	Ga0501048_0066521_778_1512	227
471	3300049587	Ga0501071_0034131	Ga0501071_0034131_415_1149	227
472	3300049588	Ga0501072_0016120	Ga0501072_0016120_4816_5550	227
473	3300049591	Ga0501075_0059431	Ga0501075_0059431_1983_2717	227
474	3300049592	Ga0501076_0511789	Ga0501076_0511789_29_763	227
475	3300049741	Ga0501079_0077546	Ga0501079_0077546_1605_2339	227
476	3300049742	Ga0501080_0584782	Ga0501080_0584782_82_816	227
477	3300049743	Ga0501081_0027785	Ga0501081_0027785_722_1456	227
478	3300049744	Ga0501083_0252847	Ga0501083_0252847_284_1018	227
479	3300054114	Ga0501084_0021968	Ga0501084_0021968_3310_4044	227
480	3300060353	Ga0501082_0020010	Ga0501082_0020010_3285_4019	227
481	3300061734	Ga0530510_0011703	Ga0530510_0011703_2016_2750	227
482	3300002772	JGI25164J39214_1000419	JGI25164J39214_100041913	228
483	3300003214	JGI25165J46597_1000004	JGI25165J46597_1000004465	228
484	3300003760	Ga0055527_1000001	Ga0055527_1000001521	228
485	3300003763	Ga0055529_1000019	Ga0055529_100001927	228
486	3300005435	Ga0070714_100096765	Ga0070714_1000967652	228
487	3300013308	Ga0157375_11648918	Ga0157375_116489181	228
488	3300025228	Ga0209672_100006	Ga0209672_100006454	228
489	3300025229	Ga0209147_100699	Ga0209147_10069911	228
490	3300025231	Ga0207427_100010	Ga0207427_100010117	228
491	3300025233	Ga0209437_100216	Ga0209437_10021688	228
492	3300025242	Ga0209258_101354	Ga0209258_1013542	228
493	3300025254	Ga0209148_1000015	Ga0209148_1000015298	228
494	3300025261	Ga0209233_1000001	Ga0209233_10000011832	228
495	3300025272	Ga0209455_1000013	Ga0209455_1000013298	228
496	3300025929	Ga0207664_10095898	Ga0207664_100958981	228
497	3300044901	Ga0466960_0384223	Ga0466960_0384223_15_701	228
498	3300045836	Ga0466958_0246600	Ga0466958_0246600_208_894	228
499	3300048903	Ga0496100_0164696	Ga0496100_0164696_284_973	228
500	3300048904	Ga0496101_0183569	Ga0496101_0183569_561_1250	228
501	3300048905	Ga0496102_0111781	Ga0496102_0111781_313_1005	228
502	3300048908	Ga0496105_0020412	Ga0496105_0020412_77_769	228
503	3300048908	Ga0496105_0184351	Ga0496105_0184351_366_1055	228
504	3300048917	Ga0496114_0633601	Ga0496114_0633601_92_781	228
505	3300048918	Ga0496115_0349775	Ga0496115_0349775_34_723	228
506	3300048918	Ga0496115_0395816	Ga0496115_0395816_67_759	228
507	3300048919	Ga0496116_0151352	Ga0496116_0151352_524_1216	228
508	3300048920	Ga0496117_0030593	Ga0496117_0030593_496_1188	228
509	3300048921	Ga0496118_0002736	Ga0496118_0002736_19062_19754	228
510	3300048929	Ga0496126_0004104	Ga0496126_0004104_11458_12153	228
511	3300053080	Ga0500635_0000002	Ga0500635_0000002_99_788	228
512	3300005327	Ga0070658_10164911	Ga0070658_101649112	229
513	3300005614	Ga0068856_100044459	Ga0068856_1000444593	229
514	3300013105	Ga0157369_10015786	Ga0157369_100157868	229
515	3300020080	Ga0206350_10161877	Ga0206350_101618772	229
516	3300020082	Ga0206353_10380448	Ga0206353_103804485	229
517	3300025253	Ga0209677_100608	Ga0209677_1006081	229
518	3300025272	Ga0209455_1002099	Ga0209455_10020991	229
519	3300026078	Ga0207702_10298434	Ga0207702_102984342	229
520	3300037312	Ga0395899_0305093	Ga0395899_0305093_91_792	229
521	3300006186	Ga0075369_10062958	Ga0075369_100629582	230
522	3300009551	Ga0105238_11085462	Ga0105238_110854621	230
523	3300013105	Ga0157369_11039452	Ga0157369_110394521	230
524	3300025904	Ga0207647_10104677	Ga0207647_101046772	230
525	3300044693	Ga0466961_0319229	Ga0466961_0319229_151_879	230
526	3300048903	Ga0496100_0183198	Ga0496100_0183198_593_1315	230
527	3300048904	Ga0496101_0069806	Ga0496101_0069806_1802_2524	230
528	3300048907	Ga0496104_0007030	Ga0496104_0007030_349_1071	230
529	3300048908	Ga0496105_0016792	Ga0496105_0016792_3600_4322	230
530	3300048908	Ga0496105_0252503	Ga0496105_0252503_568_1287	230
531	3300048910	Ga0496107_0073918	Ga0496107_0073918_1521_2243	230
532	3300048917	Ga0496114_0008364	Ga0496114_0008364_5733_6455	230
533	3300048918	Ga0496115_0015701	Ga0496115_0015701_1919_2641	230
534	3300048920	Ga0496117_0006149	Ga0496117_0006149_1535_2242	230
535	3300048922	Ga0496119_0043788	Ga0496119_0043788_1288_2010	230
536	3300048929	Ga0496126_0075942	Ga0496126_0075942_2080_2802	230
537	3300002067	JGI24735J21928_10003055	JGI24735J21928_100030555	232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

14

123

0.99 PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

156

232

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1nxx-assembly1.cif.gz_A-2	micarec ph 5.5	0.9925	1	117
1nxt-assembly1.cif.gz_A-2	micarec ph 4.0	0.9921	1	117
2a9r-assembly1.cif.gz_A-2	rr02-rec phosphate in the active site	0.9914	1	117
8fk2-assembly1.cif.gz_B	the n-terminal vicr from streptococcus mutans	0.9892	2	117
1zh4-assembly1.cif.gz_A	crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe	0.9856	2	120

ID	Description	Score	Start	End	Superfamily
af_P9WGN1_2_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9968	1	76	3.40.50.2300
af_P21866_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9966	1	78	3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.986	2	78	3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9856	2	121	3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9837	2	76	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A354CML5-F1-model_v4	DNA-binding response regulator	0.9939	2	110	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A1V5JWS4-F1-model_v4	histidine kinase (EC 2.7.13.3)	0.9906	2	117	GO:0000155 GO:0005524 GO:0006355
AF-A0A353ZQK5-F1-model_v4	DNA-binding response regulator	0.9894	2	110	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993
AF-A0A3D0J4M6-F1-model_v4	Two-component system response regulator	0.9867	2	115	GO:0000160 GO:0003677
AF-A0A2A4RET6-F1-model_v4	DNA-binding response regulator	0.9865	2	117	GO:0000156 GO:0000976 GO:0005829 GO:0006355 GO:0032993

Feature Viewer

pLDDT	pTM	Quality
89.01	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460913

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

14

123

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

156

232

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map