F460801

General Info

Members Datasets Scaffolds Average Seq Length
536 316 535 129

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_11256791|Ga0207661_112567912
Length 145
Sequence LSGTGTASGPRVEDERSLPLRSGEDVVRLRQAVRERAVATGFSLVDQTKIVTAASELGRNTIQYGGGGRVAITTVSDGIRRGVRLEFVDQGPGIADLKLAMQDGYTTGGGLGLGLSGAKRLSDDFEIESSPGKGTRVAIVRWKAR

Samples

Sample ID Description Type Environment
1 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
234 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
293 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
294 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 5.41
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1006366 3300001976 Bacteria 1543
2 JGI24749J21850_1006394 3300002076 Bacteria 1642
3 JGI25159J45721_1001219 3300002987 Bacteria 10904
4 JGI25161J50226_1018535 3300003374 Bacteria 721
5 Ga0055526_1000729 3300003771 Bacteria 24835
6 Ga0055537_1000078 3300003773 Bacteria 70140
7 Ga0055534_1000105 3300003784 Bacteria 64494
8 Ga0055528_1000609 3300003790 Bacteria 26761
9 Ga0055543_1012016 3300004625 Bacteria 1753
10 Ga0065712_10093866 3300005290 Bacteria 2276
11 Ga0065707_10117266 3300005295 Bacteria 2216
12 Ga0070658_10065693 3300005327 Bacteria 2962
13 Ga0070658_10117735 3300005327 Bacteria 2206
14 Ga0070658_11747516 3300005327 Bacteria 538
15 Ga0070676_10020571 3300005328 Bacteria 3686
16 Ga0070683_100112891 3300005329 Bacteria 2564
17 Ga0070683_102124226 3300005329 Unclassified 539
18 Ga0070690_100290781 3300005330 Bacteria 1168
19 Ga0070670_100138332 3300005331 Bacteria 2105
20 Ga0070670_100253714 3300005331 Bacteria 1533
21 Ga0070677_10008120 3300005333 Bacteria 3523
22 Ga0070677_10318231 3300005333 Bacteria 796
23 Ga0070666_10063810 3300005335 Bacteria 2497
24 Ga0070680_100056645 3300005336 Bacteria 3204
25 Ga0068868_100156848 3300005338 Bacteria 1878
26 Ga0070689_100003293 3300005340 Bacteria 10727
27 Ga0070689_100050687 3300005340 Bacteria 3208
28 Ga0070691_10297814 3300005341 Bacteria 880
29 Ga0070661_100025395 3300005344 Bacteria 4257
30 Ga0070661_100590524 3300005344 Bacteria 897
31 Ga0070669_100048428 3300005353 Bacteria 3102
32 Ga0070669_100074302 3300005353 Bacteria 2520
33 Ga0070669_100640308 3300005353 Bacteria 894
34 Ga0070675_100020756 3300005354 Bacteria 5243
35 Ga0070675_100158041 3300005354 Bacteria 1947
36 Ga0070675_100496367 3300005354 Bacteria 1099
37 Ga0070671_100122652 3300005355 Bacteria 2187
38 Ga0070671_100358986 3300005355 Bacteria 1244
39 Ga0070671_100977961 3300005355 Unclassified 741
40 Ga0070674_100196108 3300005356 Bacteria 1556
41 Ga0070673_100633398 3300005364 Bacteria 977
42 Ga0070673_100760455 3300005364 Unclassified 893
43 Ga0070688_100001681 3300005365 Bacteria 11046
44 Ga0070688_100663336 3300005365 Bacteria 804
45 Ga0070659_100015377 3300005366 Bacteria 5732
46 Ga0070659_100033198 3300005366 Bacteria 4007
47 Ga0070667_100586935 3300005367 Bacteria 1026
48 Ga0070709_10070217 3300005434 Bacteria 2257
49 Ga0070714_100011345 3300005435 Bacteria 7066
50 Ga0070714_100500304 3300005435 Bacteria 1159
51 Ga0070713_100022623 3300005436 Bacteria 4860
52 Ga0070713_100098188 3300005436 Unclassified 2532
53 Ga0070713_100197770 3300005436 Bacteria 1814
54 Ga0070710_10015016 3300005437 Bacteria 3911
55 Ga0070701_10004728 3300005438 Bacteria 5558
56 Ga0070711_100013903 3300005439 Bacteria 5063
57 Ga0070700_100161938 3300005441 Bacteria 1541
58 Ga0070663_100148766 3300005455 Bacteria 1794
59 Ga0070663_100732032 3300005455 Bacteria 843
60 Ga0070678_100073627 3300005456 Bacteria 2564
61 Ga0070678_100632922 3300005456 Bacteria 958
62 Ga0070662_100371166 3300005457 Bacteria 1176
63 Ga0070662_100528408 3300005457 Bacteria 986
64 Ga0070662_101147428 3300005457 Bacteria 667
65 Ga0070681_10001174 3300005458 Bacteria 22638
66 Ga0070681_10008404 3300005458 Bacteria 10108
67 Ga0068867_100241438 3300005459 Bacteria 1465
68 Ga0070685_10018655 3300005466 Bacteria 3734
69 Ga0070679_100027775 3300005530 Bacteria 5573
70 Ga0070679_100572548 3300005530 Bacteria 1073
71 Ga0070684_100050090 3300005535 Bacteria 3627
72 Ga0070684_100096891 3300005535 Bacteria 2630
73 Ga0068853_100365534 3300005539 Bacteria 1345
74 Ga0068853_100756985 3300005539 Bacteria 928
75 Ga0070672_100261866 3300005543 Bacteria 1458
76 Ga0070672_100752412 3300005543 Bacteria 855
77 Ga0070672_100810618 3300005543 Bacteria 824
78 Ga0070672_100968238 3300005543 Bacteria 753
79 Ga0070696_100552239 3300005546 Bacteria 923
80 Ga0070693_100314094 3300005547 Bacteria 1061
81 Ga0070665_100007292 3300005548 Bacteria 11246
82 Ga0070665_100054089 3300005548 Bacteria 4026
83 Ga0070665_100368485 3300005548 Bacteria 1443
84 Ga0070704_100164062 3300005549 Bacteria 1760
85 Ga0068855_100014368 3300005563 Bacteria 9533
86 Ga0068855_100608553 3300005563 Bacteria 1177
87 Ga0068857_100814402 3300005577 Bacteria 892
88 Ga0068857_101843777 3300005577 Bacteria 592
89 Ga0068854_100078435 3300005578 Bacteria 2433
90 Ga0068856_100537244 3300005614 Bacteria 1190
91 Ga0070702_100041760 3300005615 Bacteria 2574
92 Ga0068852_100000280 3300005616 Bacteria 34116
93 Ga0068852_100006538 3300005616 Bacteria 8431
94 Ga0068852_100048865 3300005616 Bacteria 3617
95 Ga0068852_100535046 3300005616 Bacteria 1170
96 Ga0068859_100090927 3300005617 Bacteria 3103
97 Ga0068859_101291063 3300005617 Bacteria 804
98 Ga0068864_100019560 3300005618 Bacteria 5664
99 Ga0068864_100956728 3300005618 Bacteria 848
100 Ga0068866_10139937 3300005718 Bacteria 1388
101 Ga0068861_101250045 3300005719 Unclassified 720
102 Ga0068861_101777658 3300005719 Bacteria 611
103 Ga0068851_10020304 3300005834 Bacteria 3215
104 Ga0068870_10013372 3300005840 Bacteria 3856
105 Ga0068870_10073610 3300005840 Bacteria 1869
106 Ga0068863_100049099 3300005841 Bacteria 4001
107 Ga0068863_100351831 3300005841 Bacteria 1435
108 Ga0068858_100012863 3300005842 Bacteria 7891
109 Ga0068860_102776100 3300005843 Bacteria 508
110 Ga0068862_100305345 3300005844 Bacteria 1465
111 Ga0068862_100491646 3300005844 Bacteria 1163
112 Ga0068862_100715480 3300005844 Bacteria 971
113 Ga0070717_10010529 3300006028 Bacteria 6987
114 Ga0070717_10097841 3300006028 Bacteria 2487
115 Ga0070717_10174821 3300006028 Bacteria 1869
116 Ga0070717_10202484 3300006028 Bacteria 1739
117 Ga0075365_10387584 3300006038 Bacteria 986
118 Ga0070712_100011965 3300006175 Bacteria 5515
119 Ga0075367_10591791 3300006178 Bacteria 705
120 Ga0075369_10027805 3300006186 Bacteria 2366
121 Ga0075366_10047648 3300006195 Bacteria 2541
122 Ga0075366_10181536 3300006195 Bacteria 1278
123 Ga0075366_10236968 3300006195 Bacteria 1112
124 Ga0097621_100080650 3300006237 Bacteria 2707
125 Ga0097621_100159848 3300006237 Bacteria 1936
126 Ga0068871_100235172 3300006358 Bacteria 1591
127 Ga0068871_100763683 3300006358 Unclassified 889
128 Ga0075428_100000213 3300006844 Bacteria 55855
129 Ga0075428_100282231 3300006844 Bacteria 1787
130 Ga0075428_100768218 3300006844 Bacteria 1025
131 Ga0075428_102318756 3300006844 Unclassified 552
132 Ga0075430_100695688 3300006846 Bacteria 838
133 Ga0075431_100029987 3300006847 Bacteria 5602
134 Ga0075434_100069546 3300006871 Bacteria 3510
135 Ga0075434_100897617 3300006871 Bacteria 901
136 Ga0075429_100317294 3300006880 Bacteria 1364
137 Ga0075429_100922302 3300006880 Bacteria 764
138 Ga0068865_100008093 3300006881 Bacteria 6488
139 Ga0068865_100532790 3300006881 Bacteria 984
140 Ga0068865_100553504 3300006881 Bacteria 966
141 Ga0097620_100090930 3300006931 Bacteria 3103
142 Ga0097620_101291271 3300006931 Bacteria 804
143 Ga0105240_10004564 3300009093 Bacteria 21003
144 Ga0105240_10853739 3300009093 Bacteria 982
145 Ga0105240_10963161 3300009093 Bacteria 915
146 Ga0105240_11684142 3300009093 Bacteria 662
147 Ga0111539_10002652 3300009094 Bacteria 23721
148 Ga0111539_10055127 3300009094 Bacteria 4726
149 Ga0111539_10224069 3300009094 Bacteria 2190
150 Ga0111539_10406722 3300009094 Bacteria 1585
151 Ga0111539_10734228 3300009094 Bacteria 1149
152 Ga0105245_10042425 3300009098 Bacteria 4060
153 Ga0105245_10059001 3300009098 Bacteria 3455
154 Ga0105245_10652719 3300009098 Bacteria 1082
155 Ga0105247_11244134 3300009101 Bacteria 595
156 Ga0114129_11389672 3300009147 Bacteria 867
157 Ga0105243_10133382 3300009148 Bacteria 2110
158 Ga0105243_10385516 3300009148 Bacteria 1297
159 Ga0105243_11220768 3300009148 Bacteria 766
160 Ga0105241_11940560 3300009174 Bacteria 578
161 Ga0105242_10592373 3300009176 Bacteria 1070
162 Ga0105248_10091698 3300009177 Bacteria 3421
163 Ga0105237_10423417 3300009545 Bacteria 1337
164 Ga0105237_11558299 3300009545 Bacteria 668
165 Ga0105238_10022903 3300009551 Bacteria 6367
166 Ga0105238_10417392 3300009551 Bacteria 1336
167 Ga0105238_11077875 3300009551 Bacteria 826
168 Ga0105239_10530738 3300010375 Bacteria 1339
169 Ga0157369_10000349 3300013105 Bacteria 61491
170 Ga0157369_11040001 3300013105 Bacteria 838
171 Ga0157374_10091399 3300013296 Bacteria 2902
172 Ga0157378_10024945 3300013297 Bacteria 5266
173 Ga0157378_10464938 3300013297 Bacteria 1258
174 Ga0163162_10082280 3300013306 Bacteria 3291
175 Ga0163162_11203905 3300013306 Bacteria 860
176 Ga0163162_11538722 3300013306 Bacteria 758
177 Ga0157372_10006727 3300013307 Bacteria 12224
178 Ga0157375_10265407 3300013308 Bacteria 1878
179 Ga0157375_10829115 3300013308 Bacteria 1072
180 Ga0157375_12025647 3300013308 Bacteria 684
181 Ga0157375_13373738 3300013308 Bacteria 532
182 Ga0157375_13571319 3300013308 Unclassified 517
183 Ga0163163_10225064 3300014325 Unclassified 1925
184 Ga0157380_10543341 3300014326 Bacteria 1138
185 Ga0157380_10635255 3300014326 Bacteria 1062
186 Ga0157380_11046732 3300014326 Bacteria 852
187 Ga0157380_12763270 3300014326 Bacteria 557
188 Ga0157379_10002758 3300014968 Bacteria 14819
189 Ga0157379_10144347 3300014968 Bacteria 2146
190 Ga0157379_10246752 3300014968 Bacteria 1620
191 Ga0157376_10081887 3300014969 Bacteria 2772
192 Ga0157376_11836956 3300014969 Bacteria 642
193 Ga0163161_10139463 3300017792 Bacteria 1835
194 Ga0163161_11195488 3300017792 Bacteria 657
195 Ga0213874_10062254 3300021377 Bacteria 1171
196 Ga0213875_10194698 3300021388 Bacteria 953
197 Ga0209565_1000035 3300025263 Bacteria 298125
198 Ga0209673_1000006 3300025273 Bacteria 650600
199 Ga0209130_1000086 3300025284 Bacteria 157063
200 Ga0207673_1012200 3300025290 Bacteria 1118
201 Ga0209675_1000005 3300025291 Bacteria 849192
202 Ga0209564_1000083 3300025295 Bacteria 259272
203 Ga0209256_1000322 3300025299 Bacteria 82681
204 Ga0207426_1010402 3300025302 Bacteria 3611
205 Ga0207656_10002335 3300025321 Bacteria 6365
206 Ga0207656_10035316 3300025321 Bacteria 2092
207 Ga0207656_10566617 3300025321 Bacteria 579
208 Ga0207653_10255785 3300025885 Bacteria 672
209 Ga0207682_10004221 3300025893 Bacteria 6069
210 Ga0207692_10653771 3300025898 Bacteria 679
211 Ga0207688_10041948 3300025901 Bacteria 2546
212 Ga0207688_10078230 3300025901 Bacteria 1885
213 Ga0207688_10313994 3300025901 Bacteria 960
214 Ga0207680_10065193 3300025903 Bacteria 2235
215 Ga0207699_10085530 3300025906 Bacteria 1967
216 Ga0207645_10142794 3300025907 Bacteria 1560
217 Ga0207643_10000682 3300025908 Bacteria 21212
218 Ga0207705_10019349 3300025909 Bacteria 4869
219 Ga0207705_10061629 3300025909 Bacteria 2709
220 Ga0207684_11334355 3300025910 Bacteria 589
221 Ga0207707_10003106 3300025912 Bacteria 14737
222 Ga0207707_10041225 3300025912 Bacteria 4032
223 Ga0207695_10347870 3300025913 Bacteria 1370
224 Ga0207671_10365337 3300025914 Bacteria 1146
225 Ga0207693_10007023 3300025915 Bacteria 9294
226 Ga0207663_10008656 3300025916 Bacteria 5338
227 Ga0207660_10060992 3300025917 Bacteria 2713
228 Ga0207660_10144000 3300025917 Bacteria 1824
229 Ga0207662_10123418 3300025918 Bacteria 1626
230 Ga0207657_10118861 3300025919 Bacteria 2175
231 Ga0207649_10231208 3300025920 Bacteria 1322
232 Ga0207649_10236024 3300025920 Bacteria 1310
233 Ga0207649_10346601 3300025920 Bacteria 1098
234 Ga0207652_10102555 3300025921 Bacteria 2529
235 Ga0207652_10225334 3300025921 Bacteria 1689
236 Ga0207652_10585365 3300025921 Bacteria 1001
237 Ga0207652_11624798 3300025921 Bacteria 551
238 Ga0207681_10056525 3300025923 Bacteria 2677
239 Ga0207694_10290970 3300025924 Bacteria 1343
240 Ga0207650_10000503 3300025925 Bacteria 32602
241 Ga0207650_10043652 3300025925 Bacteria 3292
242 Ga0207650_10379669 3300025925 Bacteria 1167
243 Ga0207650_11107143 3300025925 Bacteria 674
244 Ga0207659_10003703 3300025926 Bacteria 9218
245 Ga0207659_10010298 3300025926 Bacteria 5870
246 Ga0207659_10127163 3300025926 Bacteria 1962
247 Ga0207659_10354724 3300025926 Bacteria 1218
248 Ga0207687_10238079 3300025927 Bacteria 1441
249 Ga0207687_10498400 3300025927 Bacteria 1016
250 Ga0207700_10031558 3300025928 Bacteria 3766
251 Ga0207700_10064311 3300025928 Bacteria 2794
252 Ga0207700_10271559 3300025928 Bacteria 1456
253 Ga0207700_10437676 3300025928 Bacteria 1151
254 Ga0207700_10483911 3300025928 Bacteria 1094
255 Ga0207664_10026705 3300025929 Bacteria 4366
256 Ga0207664_10296440 3300025929 Bacteria 1422
257 Ga0207644_10014234 3300025931 Bacteria 5319
258 Ga0207644_10476984 3300025931 Bacteria 1027
259 Ga0207690_10029406 3300025932 Bacteria 3493
260 Ga0207690_10107326 3300025932 Bacteria 2005
261 Ga0207706_10003306 3300025933 Bacteria 15441
262 Ga0207706_10289713 3300025933 Bacteria 1427
263 Ga0207706_10346374 3300025933 Bacteria 1292
264 Ga0207686_10321612 3300025934 Bacteria 1156
265 Ga0207709_10121576 3300025935 Bacteria 1764
266 Ga0207709_10326083 3300025935 Bacteria 1151
267 Ga0207670_10180538 3300025936 Bacteria 1589
268 Ga0207670_10344830 3300025936 Bacteria 1178
269 Ga0207704_10352971 3300025938 Bacteria 1146
270 Ga0207704_10503153 3300025938 Bacteria 977
271 Ga0207704_10781929 3300025938 Bacteria 796
272 Ga0207704_11961866 3300025938 Bacteria 504
273 Ga0207691_10063492 3300025940 Bacteria 3349
274 Ga0207691_10177110 3300025940 Bacteria 1865
275 Ga0207691_10352511 3300025940 Bacteria 1259
276 Ga0207689_10056136 3300025942 Bacteria 3240
277 Ga0207661_10044841 3300025944 Bacteria 3497
278 Ga0207661_11256791 3300025944 Bacteria 681
279 Ga0207661_11499663 3300025944 Bacteria 618
280 Ga0207667_10069772 3300025949 Bacteria 3658
281 Ga0207667_10133910 3300025949 Bacteria 2552
282 Ga0207651_10209677 3300025960 Bacteria 1567
283 Ga0207651_10230251 3300025960 Bacteria 1504
284 Ga0207668_10649565 3300025972 Bacteria 923
285 Ga0207668_10786748 3300025972 Bacteria 841
286 Ga0207668_11825129 3300025972 Bacteria 549
287 Ga0207640_10167566 3300025981 Bacteria 1633
288 Ga0207658_10522874 3300025986 Bacteria 1059
289 Ga0207677_10187143 3300026023 Bacteria 1634
290 Ga0207703_10023215 3300026035 Bacteria 4872
291 Ga0207678_10018252 3300026067 Bacteria 6160
292 Ga0207678_10273128 3300026067 Bacteria 1450
293 Ga0207708_10759885 3300026075 Bacteria 832
294 Ga0207702_10455605 3300026078 Bacteria 1242
295 Ga0207641_10031886 3300026088 Bacteria 4372
296 Ga0207641_11291989 3300026088 Bacteria 730
297 Ga0207648_10001351 3300026089 Bacteria 27125
298 Ga0207648_10363789 3300026089 Bacteria 1306
299 Ga0207676_10018991 3300026095 Bacteria 5007
300 Ga0207676_11711935 3300026095 Unclassified 627
301 Ga0207675_100568465 3300026118 Bacteria 1134
302 Ga0207683_10240784 3300026121 Bacteria 1650
303 Ga0207683_11152318 3300026121 Bacteria 719
304 Ga0207698_10003142 3300026142 Bacteria 9903
305 Ga0207698_10003270 3300026142 Bacteria 9739
306 Ga0207698_10051317 3300026142 Bacteria 3153
307 Ga0207698_10104015 3300026142 Bacteria 2361
308 Ga0207698_10804725 3300026142 Bacteria 942
309 Ga0209969_1000396 3300027360 Bacteria 5822
310 Ga0209967_1002571 3300027364 Bacteria 2357
311 Ga0209995_1002457 3300027471 Bacteria 2928
312 Ga0209968_1004367 3300027526 Unclassified 2123
313 Ga0209999_1001603 3300027543 Bacteria 3899
314 Ga0209970_1003931 3300027614 Bacteria 2482
315 Ga0209974_10001697 3300027876 Bacteria 7976
316 Ga0207428_10037058 3300027907 Bacteria 3970
317 Ga0207428_10241774 3300027907 Bacteria 1348
318 Ga0268266_10012719 3300028379 Bacteria 7272
319 Ga0268266_10078103 3300028379 Bacteria 2880
320 Ga0268266_10581415 3300028379 Bacteria 1075
321 Ga0268266_11195274 3300028379 Bacteria 735
322 Ga0268265_10443019 3300028380 Bacteria 1211
323 Ga0268265_10590433 3300028380 Bacteria 1060
324 Ga0268265_12179760 3300028380 Bacteria 561
325 Ga0268264_11129989 3300028381 Bacteria 792
326 Ga0265320_10006897 3300031240 Bacteria 7100
327 Ga0307408_100100499 3300031548 Bacteria 2203
328 Ga0265313_10079766 3300031595 Bacteria 1489
329 Ga0307405_11724818 3300031731 Bacteria 555
330 Ga0307413_10882083 3300031824 Bacteria 758
331 Ga0307410_10346464 3300031852 Bacteria 1186
332 Ga0307410_11498601 3300031852 Bacteria 594
333 Ga0307406_10465755 3300031901 Bacteria 1017
334 Ga0307412_10342486 3300031911 Bacteria 1197
335 Ga0307412_10485339 3300031911 Bacteria 1026
336 Ga0307409_100729750 3300031995 Bacteria 993
337 Ga0307409_101776628 3300031995 Bacteria 646
338 Ga0307416_100351814 3300032002 Bacteria 1491
339 Ga0307416_101247756 3300032002 Bacteria 849
340 Ga0307415_100802856 3300032126 Bacteria 859
341 Ga0373959_0104398 3300034820 Bacteria 678
342 Ga0373926_0045799 3300035083 Bacteria 1569
343 Ga0373934_0000150 3300035086 Bacteria 25208
344 Ga0373934_0012965 3300035086 Bacteria 3150
345 Ga0373940_0079129 3300035088 Bacteria 969
346 Ga0373949_0042919 3300035090 Bacteria 1117
347 Ga0373923_0013544 3300035111 Bacteria 3042
348 Ga0373923_0155415 3300035111 Bacteria 1041
349 Ga0373939_0455078 3300035114 Bacteria 539
350 Ga0373941_0025182 3300035115 Bacteria 1716
351 Ga0373941_0444747 3300035115 Bacteria 543
352 Ga0373945_0514972 3300035116 Bacteria 534
353 Ga0373953_0050933 3300035117 Bacteria 1673
354 Ga0373954_0025781 3300035118 Bacteria 2691
355 Ga0373956_0000118 3300035119 Bacteria 27439
356 Ga0373956_0034133 3300035119 Bacteria 2240
357 Ga0373956_0355266 3300035119 Bacteria 699
358 Ga0373957_0035241 3300035120 Bacteria 1858
359 Ga0373957_0057611 3300035120 Bacteria 1499
360 Ga0373960_0023150 3300035121 Bacteria 1671
361 Ga0373960_0086634 3300035121 Bacteria 995
362 Ga0373946_0505059 3300035171 Bacteria 620
363 Ga0373946_0600045 3300035171 Bacteria 571
364 Ga0373955_0000871 3300035172 Bacteria 12934
365 Ga0373955_0060164 3300035172 Bacteria 2094
366 Ga0373961_0362079 3300035241 Bacteria 549
367 Ga0373962_0035723 3300035242 Bacteria 1381
368 Ga0373924_0002351 3300035410 Bacteria 6357
369 Ga0373924_0043242 3300035410 Bacteria 1850
370 Ga0373924_0072149 3300035410 Unclassified 1458
371 Ga0373924_0093648 3300035410 Bacteria 1287
372 Ga0373931_0077484 3300035691 Bacteria 1827
373 Ga0373935_0568399 3300035692 Bacteria 827
374 Ga0373927_0112254 3300035695 Bacteria 1776
375 Ga0373927_0197813 3300035695 Bacteria 1319
376 Ga0373927_0219637 3300035695 Bacteria 1248
377 Ga0373927_0461115 3300035695 Bacteria 839
378 Ga0373933_0000264 3300035724 Bacteria 34415
379 Ga0373933_0022468 3300035724 Bacteria 3593
380 Ga0373933_0289497 3300035724 Bacteria 1059
381 Ga0373947_0025083 3300035725 Bacteria 3476
382 Ga0373947_0091689 3300035725 Bacteria 1896
383 Ga0373947_0124264 3300035725 Bacteria 1642
384 Ga0373947_0623228 3300035725 Bacteria 735
385 Ga0373937_0000187 3300036401 Bacteria 60840
386 Ga0373937_0007297 3300036401 Bacteria 9568
387 Ga0373937_0106260 3300036401 Bacteria 2609
388 Ga0373937_0116544 3300036401 Bacteria 2488
389 Ga0373925_0059884 3300037068 Bacteria 2857
390 Ga0373925_0131753 3300037068 Bacteria 1950
391 Ga0373925_0172968 3300037068 Bacteria 1706
392 Ga0373925_0206353 3300037068 Bacteria 1564
393 Ga0373925_1134383 3300037068 Bacteria 643
394 Ga0395899_0402143 3300037312 Bacteria 906
395 Ga0395905_0859089 3300037471 Bacteria 810
396 Ga0436364_0438451 3300037853 Bacteria 1210
397 Ga0395901_1084037 3300038443 Bacteria 772
398 Ga0436365_1629968 3300039437 Bacteria 982
399 Ga0436363_1218882 3300039450 Bacteria 2144
400 Ga0439439_0007000 3300041406 Bacteria 2626
401 Ga0439435_0031011 3300042436 Bacteria 1451
402 Ga0451577_0006157 3300042876 Bacteria 12055
403 Ga0466972_0003193 3300044658 Bacteria 8142
404 Ga0466963_0415644 3300044694 Bacteria 949
405 Ga0453684_0049328 3300044712 Bacteria 5554
406 Ga0451576_0003736 3300045051 Bacteria 20577
407 Ga0495592_0002947 3300046454 Bacteria 12113
408 Ga0495592_0223721 3300046454 Unclassified 1257
409 Ga0495603_0356354 3300046455 Bacteria 839
410 Ga0495629_0097869 3300046459 Bacteria 2047
411 Ga0495629_0244965 3300046459 Unclassified 1234
412 Ga0495629_0744311 3300046459 Bacteria 649
413 Ga0495651_0000909 3300046462 Bacteria 22947
414 Ga0495651_0008040 3300046462 Bacteria 8086
415 Ga0495651_0459613 3300046462 Bacteria 821
416 Ga0495653_0000455 3300046463 Bacteria 31841
417 Ga0495580_0479839 3300046472 Bacteria 832
418 Ga0495580_0520146 3300046472 Bacteria 793
419 Ga0495662_0188540 3300046476 Bacteria 1017
420 Ga0495594_0408021 3300046499 Bacteria 773
421 Ga0495606_0000011 3300046507 Bacteria 296816
422 Ga0495608_0000235 3300046511 Bacteria 40161
423 Ga0495618_0094389 3300046514 Bacteria 1913
424 Ga0495628_0000373 3300046516 Bacteria 41064
425 Ga0495630_0000265 3300046517 Bacteria 42480
426 Ga0495642_0072187 3300046528 Bacteria 1445
427 Ga0495642_0141607 3300046528 Bacteria 1038
428 Ga0495652_0000781 3300046529 Bacteria 36646
429 Ga0495652_0439526 3300046529 Bacteria 915
430 Ga0495665_0280145 3300046531 Bacteria 855
431 Ga0495586_0084442 3300046535 Bacteria 1748
432 Ga0495587_0000650 3300046536 Bacteria 23317
433 Ga0495587_0047953 3300046536 Unclassified 2532
434 Ga0495598_0050348 3300046537 Bacteria 1252
435 Ga0495621_0338196 3300046539 Bacteria 629
436 Ga0495645_0000654 3300046543 Bacteria 23867
437 Ga0495667_0001539 3300046559 Bacteria 15262
438 Ga0495656_0537272 3300046615 Bacteria 622
439 Ga0495668_0000030 3300046616 Bacteria 262663
440 Ga0495668_0485086 3300046616 Bacteria 681
441 Ga0495634_0073353 3300046642 Unclassified 2250
442 Ga0495635_0000129 3300046663 Bacteria 45476
443 Ga0495635_0330528 3300046663 Bacteria 1019
444 Ga0495635_0584708 3300046663 Unclassified 730
445 Ga0495657_0000184 3300046675 Bacteria 56279
446 Ga0495599_0001198 3300046678 Bacteria 14690
447 Ga0495599_0050607 3300046678 Bacteria 2603
448 Ga0495599_0722030 3300046678 Bacteria 573
449 Ga0495623_0000213 3300046679 Bacteria 37055
450 Ga0495646_0000096 3300046680 Bacteria 42826
451 Ga0495658_0810989 3300046683 Bacteria 599
452 Ga0495613_0032268 3300046689 Bacteria 3890
453 Ga0495613_0260676 3300046689 Bacteria 1208
454 Ga0495624_0959969 3300046690 Bacteria 502
455 Ga0495670_0126458 3300046691 Bacteria 1331
456 Ga0495600_0000374 3300046809 Bacteria 23364
457 Ga0495600_0541914 3300046809 Bacteria 712
458 Ga0495581_0166109 3300047315 Bacteria 1290
459 Ga0495604_0000480 3300047317 Bacteria 35148
460 Ga0495674_0012522 3300047319 Bacteria 7990
461 Ga0495674_0253359 3300047319 Bacteria 1448
462 Ga0495672_0377078 3300047320 Bacteria 653
463 Ga0495680_0006860 3300047322 Bacteria 10523
464 Ga0495675_0010372 3300047444 Bacteria 5824
465 Ga0495684_0000108 3300047471 Bacteria 59609
466 Ga0495684_0042153 3300047471 Bacteria 3497
467 Ga0495684_0654223 3300047471 Bacteria 702
468 Ga0495686_0001097 3300047472 Bacteria 32205
469 Ga0495602_0000954 3300048088 Bacteria 27928
470 Ga0495615_0126474 3300048090 Bacteria 744
471 Ga0496100_0015213 3300048903 Bacteria 4489
472 Ga0496101_0026654 3300048904 Bacteria 4019
473 Ga0496101_0099785 3300048904 Bacteria 2171
474 Ga0496102_0011374 3300048905 Bacteria 7669
475 Ga0496102_0012907 3300048905 Bacteria 7233
476 Ga0496102_0163971 3300048905 Bacteria 2091
477 Ga0496102_1002217 3300048905 Bacteria 756
478 Ga0496104_0004348 3300048907 Bacteria 12323
479 Ga0496104_0078991 3300048907 Bacteria 3136
480 Ga0496105_0010792 3300048908 Bacteria 7195
481 Ga0496105_0055169 3300048908 Bacteria 3281
482 Ga0496105_0726516 3300048908 Bacteria 760
483 Ga0496106_0118617 3300048909 Bacteria 2066
484 Ga0496107_0018151 3300048910 Bacteria 4950
485 Ga0496107_0535370 3300048910 Bacteria 868
486 Ga0496108_0016356 3300048911 Bacteria 6049
487 Ga0496108_0116999 3300048911 Bacteria 2284
488 Ga0496108_0730901 3300048911 Bacteria 857
489 Ga0496108_1175767 3300048911 Bacteria 649
490 Ga0496109_0013720 3300048912 Bacteria 7039
491 Ga0496109_0077392 3300048912 Bacteria 3061
492 Ga0496109_0253331 3300048912 Bacteria 1658
493 Ga0496110_0045502 3300048913 Bacteria 3837
494 Ga0496110_0050375 3300048913 Bacteria 3656
495 Ga0496111_0054522 3300048914 Bacteria 2890
496 Ga0496111_0453205 3300048914 Bacteria 946
497 Ga0496114_0038019 3300048917 Bacteria 3982
498 Ga0496114_0076107 3300048917 Bacteria 2828
499 Ga0496114_0122792 3300048917 Bacteria 2235
500 Ga0496126_0380724 3300048929 Unclassified 1149
501 Ga0501042_1302057 3300049578 Bacteria 530
502 Ga0501217_183097 3300049661 Unclassified 644
503 Ga0501257_180191 3300049686 Bacteria 598
504 Ga0501225_0254390 3300049705 Bacteria 579
505 Ga0501079_0576318 3300049741 Bacteria 885
506 Ga0501045_0880190 3300049824 Bacteria 658
507 nmdc:mga00v17_209779_c1 3300050491 Bacteria 1260
508 nmdc:mga0yw44_1025548_c1 3300050492 Bacteria 558
509 nmdc:mga0yw44_492652_c1 3300050492 Bacteria 831
510 nmdc:mga0k408_135088_c1 3300050493 Bacteria 1465
511 nmdc:mga0k408_94915_c1 3300050493 Bacteria 1754
512 nmdc:mga06z11_546148_c1 3300050494 Bacteria 703
513 nmdc:mga06z11_586411_c1 3300050494 Bacteria 678
514 nmdc:mga0qj67_1103121_c1 3300050509 Bacteria 620
515 nmdc:mga0qj67_166967_c1 3300050509 Bacteria 1787
516 nmdc:mga06r32_27835_c1 3300050510 Bacteria 5284
517 nmdc:mga08y16_397104_c1 3300050511 Bacteria 1412
518 nmdc:mga08y16_54111_c1 3300050511 Bacteria 4194
519 nmdc:mga08y16_54122_c1 3300050511 Bacteria 4193
520 nmdc:mga0n895_168573_c1 3300050512 Bacteria 2222
521 nmdc:mga0a205_225817_c1 3300050515 Bacteria 1757
522 nmdc:mga0sz30_31836_c1 3300050516 Bacteria 2184
523 Ga0495601_0064853 3300053077 Bacteria 2324
524 Ga0495601_0072050 3300053077 Bacteria 2207
525 Ga0495612_0000510 3300053078 Bacteria 15585
526 Ga0495595_0003934 3300053084 Bacteria 5935
527 Ga0495595_0149704 3300053084 Unclassified 1148
528 Ga0495619_0005821 3300053085 Bacteria 7813
529 Ga0495619_0548832 3300053085 Unclassified 793
530 Ga0500641_0008209 3300053096 Bacteria 3723
531 Ga0500637_0139306 3300053178 Bacteria 1405
532 Ga0590071_000915 3300059421 Bacteria 8173
533 Ga0590074_000991 3300059423 Bacteria 4463
534 Ga0590075_006259 3300059424 Bacteria 2823
535 Ga0590077_002195 3300059426 Bacteria 4256

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_11538722 Ga0163162_115387222 107
2 3300014968 Ga0157379_10246752 Ga0157379_102467522 107
3 3300005333 Ga0070677_10318231 Ga0070677_103182312 109
4 3300006186 Ga0075369_10027805 Ga0075369_100278052 116
5 3300006195 Ga0075366_10236968 Ga0075366_102369682 116
6 3300050493 nmdc:mga0k408_135088_c1 nmdc:mga0k408_135088_c1_398_817 116
7 3300050516 nmdc:mga0sz30_31836_c1 nmdc:mga0sz30_31836_c1_1128_1547 116
8 3300002987 JGI25159J45721_1001219 JGI25159J45721_10012195 117
9 3300003374 JGI25161J50226_1018535 JGI25161J50226_10185352 117
10 3300003771 Ga0055526_1000729 Ga0055526_10007294 117
11 3300003773 Ga0055537_1000078 Ga0055537_100007823 117
12 3300003784 Ga0055534_1000105 Ga0055534_100010534 117
13 3300003790 Ga0055528_1000609 Ga0055528_100060912 117
14 3300004625 Ga0055543_1012016 Ga0055543_10120162 117
15 3300005844 Ga0068862_100491646 Ga0068862_1004916462 117
16 3300006038 Ga0075365_10387584 Ga0075365_103875842 117
17 3300006195 Ga0075366_10047648 Ga0075366_100476482 117
18 3300009094 Ga0111539_10055127 Ga0111539_100551273 117
19 3300025263 Ga0209565_1000035 Ga0209565_1000035249 117
20 3300025273 Ga0209673_1000006 Ga0209673_1000006339 117
21 3300025284 Ga0209130_1000086 Ga0209130_1000086101 117
22 3300025291 Ga0209675_1000005 Ga0209675_1000005433 117
23 3300025295 Ga0209564_1000083 Ga0209564_1000083203 117
24 3300025299 Ga0209256_1000322 Ga0209256_100032238 117
25 3300025302 Ga0207426_1010402 Ga0207426_10104024 117
26 3300027360 Ga0209969_1000396 Ga0209969_10003967 117
27 3300027364 Ga0209967_1002571 Ga0209967_10025714 117
28 3300027471 Ga0209995_1002457 Ga0209995_10024572 117
29 3300027526 Ga0209968_1004367 Ga0209968_10043672 117
30 3300027543 Ga0209999_1001603 Ga0209999_10016033 117
31 3300027614 Ga0209970_1003931 Ga0209970_10039313 117
32 3300027876 Ga0209974_10001697 Ga0209974_100016978 117
33 3300027907 Ga0207428_10241774 Ga0207428_102417742 117
34 3300028380 Ga0268265_10443019 Ga0268265_104430192 117
35 3300037068 Ga0373925_0206353 Ga0373925_0206353_112_504 117
36 3300046616 Ga0495668_0000030 Ga0495668_0000030_92159_92572 117
37 3300047472 Ga0495686_0001097 Ga0495686_0001097_4314_4727 117
38 3300049705 Ga0501225_0254390 Ga0501225_0254390_54_437 117
39 3300050492 nmdc:mga0yw44_1025548_c1 nmdc:mga0yw44_1025548_c1_97_513 117
40 3300050492 nmdc:mga0yw44_492652_c1 nmdc:mga0yw44_492652_c1_355_774 117
41 3300050494 nmdc:mga06z11_586411_c1 nmdc:mga06z11_586411_c1_177_596 117
42 3300050511 nmdc:mga08y16_54122_c1 nmdc:mga08y16_54122_c1_3231_3632 117
43 3300053178 Ga0500637_0139306 Ga0500637_0139306_15_467 117
44 3300001976 JGI24752J21851_1006366 JGI24752J21851_10063663 118
45 3300002076 JGI24749J21850_1006394 JGI24749J21850_10063943 118
46 3300005290 Ga0065712_10093866 Ga0065712_100938661 118
47 3300005295 Ga0065707_10117266 Ga0065707_101172661 118
48 3300005327 Ga0070658_10065693 Ga0070658_100656932 118
49 3300005327 Ga0070658_10117735 Ga0070658_101177353 118
50 3300005327 Ga0070658_11747516 Ga0070658_117475161 118
51 3300005328 Ga0070676_10020571 Ga0070676_100205714 118
52 3300005329 Ga0070683_100112891 Ga0070683_1001128913 118
53 3300005329 Ga0070683_102124226 Ga0070683_1021242261 118
54 3300005330 Ga0070690_100290781 Ga0070690_1002907812 118
55 3300005331 Ga0070670_100138332 Ga0070670_1001383322 118
56 3300005331 Ga0070670_100253714 Ga0070670_1002537143 118
57 3300005333 Ga0070677_10008120 Ga0070677_100081204 118
58 3300005335 Ga0070666_10063810 Ga0070666_100638102 118
59 3300005336 Ga0070680_100056645 Ga0070680_1000566454 118
60 3300005338 Ga0068868_100156848 Ga0068868_1001568481 118
61 3300005340 Ga0070689_100003293 Ga0070689_1000032937 118
62 3300005340 Ga0070689_100050687 Ga0070689_1000506873 118
63 3300005341 Ga0070691_10297814 Ga0070691_102978142 118
64 3300005344 Ga0070661_100025395 Ga0070661_1000253953 118
65 3300005344 Ga0070661_100590524 Ga0070661_1005905242 118
66 3300005353 Ga0070669_100048428 Ga0070669_1000484283 118
67 3300005353 Ga0070669_100074302 Ga0070669_1000743024 118
68 3300005353 Ga0070669_100640308 Ga0070669_1006403082 118
69 3300005354 Ga0070675_100020756 Ga0070675_1000207562 118
70 3300005354 Ga0070675_100158041 Ga0070675_1001580413 118
71 3300005354 Ga0070675_100496367 Ga0070675_1004963672 118
72 3300005355 Ga0070671_100122652 Ga0070671_1001226523 118
73 3300005355 Ga0070671_100358986 Ga0070671_1003589863 118
74 3300005355 Ga0070671_100977961 Ga0070671_1009779611 118
75 3300005356 Ga0070674_100196108 Ga0070674_1001961082 118
76 3300005364 Ga0070673_100633398 Ga0070673_1006333981 118
77 3300005364 Ga0070673_100760455 Ga0070673_1007604552 118
78 3300005365 Ga0070688_100001681 Ga0070688_1000016813 118
79 3300005365 Ga0070688_100663336 Ga0070688_1006633362 118
80 3300005366 Ga0070659_100015377 Ga0070659_1000153774 118
81 3300005366 Ga0070659_100033198 Ga0070659_1000331983 118
82 3300005367 Ga0070667_100586935 Ga0070667_1005869353 118
83 3300005434 Ga0070709_10070217 Ga0070709_100702172 118
84 3300005435 Ga0070714_100011345 Ga0070714_1000113453 118
85 3300005435 Ga0070714_100500304 Ga0070714_1005003042 118
86 3300005436 Ga0070713_100022623 Ga0070713_1000226235 118
87 3300005436 Ga0070713_100098188 Ga0070713_1000981884 118
88 3300005436 Ga0070713_100197770 Ga0070713_1001977703 118
89 3300005437 Ga0070710_10015016 Ga0070710_100150163 118
90 3300005438 Ga0070701_10004728 Ga0070701_100047282 118
91 3300005439 Ga0070711_100013903 Ga0070711_1000139032 118
92 3300005441 Ga0070700_100161938 Ga0070700_1001619382 118
93 3300005455 Ga0070663_100148766 Ga0070663_1001487663 118
94 3300005455 Ga0070663_100732032 Ga0070663_1007320322 118
95 3300005456 Ga0070678_100073627 Ga0070678_1000736273 118
96 3300005456 Ga0070678_100632922 Ga0070678_1006329221 118
97 3300005457 Ga0070662_100371166 Ga0070662_1003711662 118
98 3300005457 Ga0070662_100528408 Ga0070662_1005284082 118
99 3300005457 Ga0070662_101147428 Ga0070662_1011474281 118
100 3300005458 Ga0070681_10001174 Ga0070681_100011748 118
101 3300005458 Ga0070681_10008404 Ga0070681_100084045 118
102 3300005459 Ga0068867_100241438 Ga0068867_1002414382 118
103 3300005466 Ga0070685_10018655 Ga0070685_100186553 118
104 3300005530 Ga0070679_100027775 Ga0070679_1000277752 118
105 3300005530 Ga0070679_100572548 Ga0070679_1005725482 118
106 3300005535 Ga0070684_100050090 Ga0070684_1000500904 118
107 3300005535 Ga0070684_100096891 Ga0070684_1000968912 118
108 3300005539 Ga0068853_100365534 Ga0068853_1003655343 118
109 3300005539 Ga0068853_100756985 Ga0068853_1007569852 118
110 3300005543 Ga0070672_100261866 Ga0070672_1002618662 118
111 3300005543 Ga0070672_100752412 Ga0070672_1007524122 118
112 3300005543 Ga0070672_100810618 Ga0070672_1008106182 118
113 3300005543 Ga0070672_100968238 Ga0070672_1009682382 118
114 3300005546 Ga0070696_100552239 Ga0070696_1005522391 118
115 3300005547 Ga0070693_100314094 Ga0070693_1003140941 118
116 3300005548 Ga0070665_100007292 Ga0070665_1000072927 118
117 3300005548 Ga0070665_100054089 Ga0070665_1000540893 118
118 3300005548 Ga0070665_100368485 Ga0070665_1003684853 118
119 3300005549 Ga0070704_100164062 Ga0070704_1001640622 118
120 3300005563 Ga0068855_100014368 Ga0068855_10001436812 118
121 3300005563 Ga0068855_100608553 Ga0068855_1006085532 118
122 3300005577 Ga0068857_100814402 Ga0068857_1008144022 118
123 3300005577 Ga0068857_101843777 Ga0068857_1018437771 118
124 3300005578 Ga0068854_100078435 Ga0068854_1000784353 118
125 3300005614 Ga0068856_100537244 Ga0068856_1005372442 118
126 3300005615 Ga0070702_100041760 Ga0070702_1000417604 118
127 3300005616 Ga0068852_100000280 Ga0068852_10000028015 118
128 3300005616 Ga0068852_100006538 Ga0068852_1000065388 118
129 3300005616 Ga0068852_100048865 Ga0068852_1000488654 118
130 3300005616 Ga0068852_100535046 Ga0068852_1005350462 118
131 3300005617 Ga0068859_100090927 Ga0068859_1000909272 118
132 3300005617 Ga0068859_101291063 Ga0068859_1012910632 118
133 3300005618 Ga0068864_100019560 Ga0068864_1000195604 118
134 3300005618 Ga0068864_100956728 Ga0068864_1009567282 118
135 3300005718 Ga0068866_10139937 Ga0068866_101399373 118
136 3300005719 Ga0068861_101250045 Ga0068861_1012500452 118
137 3300005719 Ga0068861_101777658 Ga0068861_1017776582 118
138 3300005834 Ga0068851_10020304 Ga0068851_100203043 118
139 3300005840 Ga0068870_10013372 Ga0068870_100133723 118
140 3300005840 Ga0068870_10073610 Ga0068870_100736102 118
141 3300005841 Ga0068863_100049099 Ga0068863_1000490993 118
142 3300005841 Ga0068863_100351831 Ga0068863_1003518312 118
143 3300005842 Ga0068858_100012863 Ga0068858_1000128633 118
144 3300005843 Ga0068860_102776100 Ga0068860_1027761001 118
145 3300005844 Ga0068862_100305345 Ga0068862_1003053452 118
146 3300005844 Ga0068862_100715480 Ga0068862_1007154802 118
147 3300006028 Ga0070717_10010529 Ga0070717_100105296 118
148 3300006028 Ga0070717_10097841 Ga0070717_100978412 118
149 3300006028 Ga0070717_10174821 Ga0070717_101748212 118
150 3300006028 Ga0070717_10202484 Ga0070717_102024843 118
151 3300006175 Ga0070712_100011965 Ga0070712_1000119653 118
152 3300006178 Ga0075367_10591791 Ga0075367_105917912 118
153 3300006195 Ga0075366_10181536 Ga0075366_101815363 118
154 3300006237 Ga0097621_100080650 Ga0097621_1000806503 118
155 3300006237 Ga0097621_100159848 Ga0097621_1001598482 118
156 3300006358 Ga0068871_100235172 Ga0068871_1002351722 118
157 3300006358 Ga0068871_100763683 Ga0068871_1007636832 118
158 3300006844 Ga0075428_100000213 Ga0075428_10000021349 118
159 3300006844 Ga0075428_100282231 Ga0075428_1002822313 118
160 3300006844 Ga0075428_100768218 Ga0075428_1007682182 118
161 3300006844 Ga0075428_102318756 Ga0075428_1023187561 118
162 3300006846 Ga0075430_100695688 Ga0075430_1006956882 118
163 3300006847 Ga0075431_100029987 Ga0075431_1000299873 118
164 3300006871 Ga0075434_100069546 Ga0075434_1000695463 118
165 3300006871 Ga0075434_100897617 Ga0075434_1008976172 118
166 3300006880 Ga0075429_100317294 Ga0075429_1003172943 118
167 3300006880 Ga0075429_100922302 Ga0075429_1009223022 118
168 3300006881 Ga0068865_100008093 Ga0068865_1000080933 118
169 3300006881 Ga0068865_100532790 Ga0068865_1005327902 118
170 3300006881 Ga0068865_100553504 Ga0068865_1005535042 118
171 3300006931 Ga0097620_100090930 Ga0097620_1000909302 118
172 3300006931 Ga0097620_101291271 Ga0097620_1012912712 118
173 3300009093 Ga0105240_10004564 Ga0105240_100045644 118
174 3300009093 Ga0105240_10853739 Ga0105240_108537391 118
175 3300009093 Ga0105240_10963161 Ga0105240_109631612 118
176 3300009093 Ga0105240_11684142 Ga0105240_116841421 118
177 3300009094 Ga0111539_10002652 Ga0111539_100026523 118
178 3300009094 Ga0111539_10224069 Ga0111539_102240692 118
179 3300009094 Ga0111539_10406722 Ga0111539_104067222 118
180 3300009094 Ga0111539_10734228 Ga0111539_107342282 118
181 3300009098 Ga0105245_10042425 Ga0105245_100424252 118
182 3300009098 Ga0105245_10059001 Ga0105245_100590014 118
183 3300009098 Ga0105245_10652719 Ga0105245_106527192 118
184 3300009101 Ga0105247_11244134 Ga0105247_112441341 118
185 3300009147 Ga0114129_11389672 Ga0114129_113896722 118
186 3300009148 Ga0105243_10133382 Ga0105243_101333823 118
187 3300009148 Ga0105243_10385516 Ga0105243_103855162 118
188 3300009148 Ga0105243_11220768 Ga0105243_112207682 118
189 3300009174 Ga0105241_11940560 Ga0105241_119405601 118
190 3300009176 Ga0105242_10592373 Ga0105242_105923732 118
191 3300009177 Ga0105248_10091698 Ga0105248_100916982 118
192 3300009545 Ga0105237_10423417 Ga0105237_104234173 118
193 3300009545 Ga0105237_11558299 Ga0105237_115582991 118
194 3300009551 Ga0105238_10022903 Ga0105238_100229036 118
195 3300009551 Ga0105238_10417392 Ga0105238_104173922 118
196 3300009551 Ga0105238_11077875 Ga0105238_110778752 118
197 3300010375 Ga0105239_10530738 Ga0105239_105307382 118
198 3300013105 Ga0157369_10000349 Ga0157369_1000034916 118
199 3300013105 Ga0157369_11040001 Ga0157369_110400012 118
200 3300013296 Ga0157374_10091399 Ga0157374_100913993 118
201 3300013297 Ga0157378_10024945 Ga0157378_100249453 118
202 3300013297 Ga0157378_10464938 Ga0157378_104649382 118
203 3300013306 Ga0163162_10082280 Ga0163162_100822804 118
204 3300013306 Ga0163162_11203905 Ga0163162_112039052 118
205 3300013307 Ga0157372_10006727 Ga0157372_100067277 118
206 3300013308 Ga0157375_10265407 Ga0157375_102654072 118
207 3300013308 Ga0157375_10829115 Ga0157375_108291152 118
208 3300013308 Ga0157375_12025647 Ga0157375_120256472 118
209 3300013308 Ga0157375_13373738 Ga0157375_133737381 118
210 3300013308 Ga0157375_13571319 Ga0157375_135713191 118
211 3300014325 Ga0163163_10225064 Ga0163163_102250643 118
212 3300014326 Ga0157380_10543341 Ga0157380_105433412 118
213 3300014326 Ga0157380_10635255 Ga0157380_106352552 118
214 3300014326 Ga0157380_11046732 Ga0157380_110467322 118
215 3300014326 Ga0157380_12763270 Ga0157380_127632702 118
216 3300014968 Ga0157379_10002758 Ga0157379_1000275812 118
217 3300014968 Ga0157379_10144347 Ga0157379_101443472 118
218 3300014969 Ga0157376_10081887 Ga0157376_100818875 118
219 3300014969 Ga0157376_11836956 Ga0157376_118369562 118
220 3300017792 Ga0163161_10139463 Ga0163161_101394632 118
221 3300017792 Ga0163161_11195488 Ga0163161_111954882 118
222 3300021377 Ga0213874_10062254 Ga0213874_100622542 118
223 3300021388 Ga0213875_10194698 Ga0213875_101946982 118
224 3300025290 Ga0207673_1012200 Ga0207673_10122003 118
225 3300025321 Ga0207656_10002335 Ga0207656_100023353 118
226 3300025321 Ga0207656_10035316 Ga0207656_100353163 118
227 3300025321 Ga0207656_10566617 Ga0207656_105666171 118
228 3300025885 Ga0207653_10255785 Ga0207653_102557852 118
229 3300025893 Ga0207682_10004221 Ga0207682_100042216 118
230 3300025898 Ga0207692_10653771 Ga0207692_106537712 118
231 3300025901 Ga0207688_10041948 Ga0207688_100419482 118
232 3300025901 Ga0207688_10078230 Ga0207688_100782302 118
233 3300025901 Ga0207688_10313994 Ga0207688_103139942 118
234 3300025903 Ga0207680_10065193 Ga0207680_100651932 118
235 3300025906 Ga0207699_10085530 Ga0207699_100855303 118
236 3300025907 Ga0207645_10142794 Ga0207645_101427942 118
237 3300025908 Ga0207643_10000682 Ga0207643_100006825 118
238 3300025909 Ga0207705_10019349 Ga0207705_100193494 118
239 3300025909 Ga0207705_10061629 Ga0207705_100616293 118
240 3300025910 Ga0207684_11334355 Ga0207684_113343552 118
241 3300025912 Ga0207707_10003106 Ga0207707_100031062 118
242 3300025912 Ga0207707_10041225 Ga0207707_100412252 118
243 3300025913 Ga0207695_10347870 Ga0207695_103478702 118
244 3300025914 Ga0207671_10365337 Ga0207671_103653373 118
245 3300025915 Ga0207693_10007023 Ga0207693_100070234 118
246 3300025916 Ga0207663_10008656 Ga0207663_100086564 118
247 3300025917 Ga0207660_10060992 Ga0207660_100609923 118
248 3300025917 Ga0207660_10144000 Ga0207660_101440003 118
249 3300025918 Ga0207662_10123418 Ga0207662_101234182 118
250 3300025919 Ga0207657_10118861 Ga0207657_101188613 118
251 3300025920 Ga0207649_10231208 Ga0207649_102312083 118
252 3300025920 Ga0207649_10236024 Ga0207649_102360242 118
253 3300025920 Ga0207649_10346601 Ga0207649_103466012 118
254 3300025921 Ga0207652_10102555 Ga0207652_101025553 118
255 3300025921 Ga0207652_10225334 Ga0207652_102253342 118
256 3300025921 Ga0207652_10585365 Ga0207652_105853652 118
257 3300025921 Ga0207652_11624798 Ga0207652_116247981 118
258 3300025923 Ga0207681_10056525 Ga0207681_100565253 118
259 3300025924 Ga0207694_10290970 Ga0207694_102909702 118
260 3300025925 Ga0207650_10000503 Ga0207650_1000050331 118
261 3300025925 Ga0207650_10043652 Ga0207650_100436524 118
262 3300025925 Ga0207650_10379669 Ga0207650_103796692 118
263 3300025925 Ga0207650_11107143 Ga0207650_111071432 118
264 3300025926 Ga0207659_10003703 Ga0207659_100037033 118
265 3300025926 Ga0207659_10010298 Ga0207659_100102982 118
266 3300025926 Ga0207659_10127163 Ga0207659_101271632 118
267 3300025926 Ga0207659_10354724 Ga0207659_103547241 118
268 3300025927 Ga0207687_10238079 Ga0207687_102380792 118
269 3300025927 Ga0207687_10498400 Ga0207687_104984002 118
270 3300025928 Ga0207700_10031558 Ga0207700_100315585 118
271 3300025928 Ga0207700_10064311 Ga0207700_100643112 118
272 3300025928 Ga0207700_10271559 Ga0207700_102715593 118
273 3300025928 Ga0207700_10437676 Ga0207700_104376762 118
274 3300025928 Ga0207700_10483911 Ga0207700_104839112 118
275 3300025929 Ga0207664_10026705 Ga0207664_100267052 118
276 3300025929 Ga0207664_10296440 Ga0207664_102964402 118
277 3300025931 Ga0207644_10014234 Ga0207644_100142343 118
278 3300025931 Ga0207644_10476984 Ga0207644_104769843 118
279 3300025932 Ga0207690_10029406 Ga0207690_100294063 118
280 3300025932 Ga0207690_10107326 Ga0207690_101073262 118
281 3300025933 Ga0207706_10003306 Ga0207706_100033063 118
282 3300025933 Ga0207706_10289713 Ga0207706_102897132 118
283 3300025933 Ga0207706_10346374 Ga0207706_103463743 118
284 3300025934 Ga0207686_10321612 Ga0207686_103216122 118
285 3300025935 Ga0207709_10121576 Ga0207709_101215763 118
286 3300025935 Ga0207709_10326083 Ga0207709_103260832 118
287 3300025936 Ga0207670_10180538 Ga0207670_101805383 118
288 3300025936 Ga0207670_10344830 Ga0207670_103448302 118
289 3300025938 Ga0207704_10352971 Ga0207704_103529712 118
290 3300025938 Ga0207704_10503153 Ga0207704_105031532 118
291 3300025938 Ga0207704_10781929 Ga0207704_107819292 118
292 3300025938 Ga0207704_11961866 Ga0207704_119618661 118
293 3300025940 Ga0207691_10063492 Ga0207691_100634922 118
294 3300025940 Ga0207691_10177110 Ga0207691_101771103 118
295 3300025940 Ga0207691_10352511 Ga0207691_103525112 118
296 3300025942 Ga0207689_10056136 Ga0207689_100561363 118
297 3300025944 Ga0207661_10044841 Ga0207661_100448414 118
298 3300025944 Ga0207661_11256791 Ga0207661_112567912 118
299 3300025944 Ga0207661_11499663 Ga0207661_114996632 118
300 3300025949 Ga0207667_10069772 Ga0207667_100697723 118
301 3300025949 Ga0207667_10133910 Ga0207667_101339102 118
302 3300025960 Ga0207651_10209677 Ga0207651_102096772 118
303 3300025960 Ga0207651_10230251 Ga0207651_102302513 118
304 3300025972 Ga0207668_10649565 Ga0207668_106495651 118
305 3300025972 Ga0207668_10786748 Ga0207668_107867481 118
306 3300025972 Ga0207668_11825129 Ga0207668_118251291 118
307 3300025981 Ga0207640_10167566 Ga0207640_101675662 118
308 3300025986 Ga0207658_10522874 Ga0207658_105228741 118
309 3300026023 Ga0207677_10187143 Ga0207677_101871432 118
310 3300026035 Ga0207703_10023215 Ga0207703_100232155 118
311 3300026067 Ga0207678_10018252 Ga0207678_100182521 118
312 3300026067 Ga0207678_10273128 Ga0207678_102731283 118
313 3300026075 Ga0207708_10759885 Ga0207708_107598852 118
314 3300026078 Ga0207702_10455605 Ga0207702_104556052 118
315 3300026088 Ga0207641_10031886 Ga0207641_100318863 118
316 3300026088 Ga0207641_11291989 Ga0207641_112919892 118
317 3300026089 Ga0207648_10001351 Ga0207648_1000135120 118
318 3300026089 Ga0207648_10363789 Ga0207648_103637892 118
319 3300026095 Ga0207676_10018991 Ga0207676_100189916 118
320 3300026095 Ga0207676_11711935 Ga0207676_117119352 118
321 3300026118 Ga0207675_100568465 Ga0207675_1005684652 118
322 3300026121 Ga0207683_10240784 Ga0207683_102407843 118
323 3300026121 Ga0207683_11152318 Ga0207683_111523182 118
324 3300026142 Ga0207698_10003142 Ga0207698_100031427 118
325 3300026142 Ga0207698_10003270 Ga0207698_100032703 118
326 3300026142 Ga0207698_10051317 Ga0207698_100513174 118
327 3300026142 Ga0207698_10104015 Ga0207698_101040152 118
328 3300026142 Ga0207698_10804725 Ga0207698_108047252 118
329 3300027907 Ga0207428_10037058 Ga0207428_100370584 118
330 3300028379 Ga0268266_10012719 Ga0268266_100127193 118
331 3300028379 Ga0268266_10078103 Ga0268266_100781036 118
332 3300028379 Ga0268266_10581415 Ga0268266_105814152 118
333 3300028379 Ga0268266_11195274 Ga0268266_111952742 118
334 3300028380 Ga0268265_10590433 Ga0268265_105904332 118
335 3300028380 Ga0268265_12179760 Ga0268265_121797601 118
336 3300028381 Ga0268264_11129989 Ga0268264_111299892 118
337 3300031240 Ga0265320_10006897 Ga0265320_100068977 118
338 3300031548 Ga0307408_100100499 Ga0307408_1001004992 118
339 3300031595 Ga0265313_10079766 Ga0265313_100797663 118
340 3300031731 Ga0307405_11724818 Ga0307405_117248181 118
341 3300031824 Ga0307413_10882083 Ga0307413_108820832 118
342 3300031852 Ga0307410_10346464 Ga0307410_103464642 118
343 3300031852 Ga0307410_11498601 Ga0307410_114986012 118
344 3300031901 Ga0307406_10465755 Ga0307406_104657552 118
345 3300031911 Ga0307412_10342486 Ga0307412_103424862 118
346 3300031911 Ga0307412_10485339 Ga0307412_104853392 118
347 3300031995 Ga0307409_100729750 Ga0307409_1007297502 118
348 3300031995 Ga0307409_101776628 Ga0307409_1017766282 118
349 3300032002 Ga0307416_100351814 Ga0307416_1003518142 118
350 3300032002 Ga0307416_101247756 Ga0307416_1012477562 118
351 3300032126 Ga0307415_100802856 Ga0307415_1008028562 118
352 3300034820 Ga0373959_0104398 Ga0373959_0104398_57_461 118
353 3300035083 Ga0373926_0045799 Ga0373926_0045799_378_758 118
354 3300035086 Ga0373934_0000150 Ga0373934_0000150_1712_2116 118
355 3300035086 Ga0373934_0012965 Ga0373934_0012965_2511_2915 118
356 3300035088 Ga0373940_0079129 Ga0373940_0079129_547_951 118
357 3300035090 Ga0373949_0042919 Ga0373949_0042919_586_990 118
358 3300035111 Ga0373923_0013544 Ga0373923_0013544_1824_2228 118
359 3300035111 Ga0373923_0155415 Ga0373923_0155415_414_818 118
360 3300035114 Ga0373939_0455078 Ga0373939_0455078_48_452 118
361 3300035115 Ga0373941_0025182 Ga0373941_0025182_306_710 118
362 3300035115 Ga0373941_0444747 Ga0373941_0444747_89_493 118
363 3300035116 Ga0373945_0514972 Ga0373945_0514972_25_420 118
364 3300035117 Ga0373953_0050933 Ga0373953_0050933_504_908 118
365 3300035118 Ga0373954_0025781 Ga0373954_0025781_954_1358 118
366 3300035119 Ga0373956_0000118 Ga0373956_0000118_23189_23593 118
367 3300035119 Ga0373956_0034133 Ga0373956_0034133_1247_1651 118
368 3300035119 Ga0373956_0355266 Ga0373956_0355266_169_573 118
369 3300035120 Ga0373957_0035241 Ga0373957_0035241_746_1150 118
370 3300035120 Ga0373957_0057611 Ga0373957_0057611_567_971 118
371 3300035121 Ga0373960_0023150 Ga0373960_0023150_1006_1410 118
372 3300035121 Ga0373960_0086634 Ga0373960_0086634_122_550 118
373 3300035171 Ga0373946_0505059 Ga0373946_0505059_34_429 118
374 3300035171 Ga0373946_0600045 Ga0373946_0600045_172_552 118
375 3300035172 Ga0373955_0000871 Ga0373955_0000871_2232_2636 118
376 3300035172 Ga0373955_0060164 Ga0373955_0060164_678_1082 118
377 3300035241 Ga0373961_0362079 Ga0373961_0362079_118_522 118
378 3300035242 Ga0373962_0035723 Ga0373962_0035723_637_1041 118
379 3300035410 Ga0373924_0002351 Ga0373924_0002351_2981_3385 118
380 3300035410 Ga0373924_0043242 Ga0373924_0043242_1068_1472 118
381 3300035410 Ga0373924_0072149 Ga0373924_0072149_120_524 118
382 3300035410 Ga0373924_0093648 Ga0373924_0093648_496_876 118
383 3300035691 Ga0373931_0077484 Ga0373931_0077484_1287_1691 118
384 3300035692 Ga0373935_0568399 Ga0373935_0568399_260_664 118
385 3300035695 Ga0373927_0112254 Ga0373927_0112254_1171_1551 118
386 3300035695 Ga0373927_0197813 Ga0373927_0197813_48_452 118
387 3300035695 Ga0373927_0219637 Ga0373927_0219637_559_963 118
388 3300035695 Ga0373927_0461115 Ga0373927_0461115_416_820 118
389 3300035724 Ga0373933_0000264 Ga0373933_0000264_13969_14373 118
390 3300035724 Ga0373933_0022468 Ga0373933_0022468_490_894 118
391 3300035724 Ga0373933_0289497 Ga0373933_0289497_475_879 118
392 3300035725 Ga0373947_0025083 Ga0373947_0025083_2193_2573 118
393 3300035725 Ga0373947_0091689 Ga0373947_0091689_856_1260 118
394 3300035725 Ga0373947_0124264 Ga0373947_0124264_145_549 118
395 3300035725 Ga0373947_0623228 Ga0373947_0623228_66_461 118
396 3300036401 Ga0373937_0000187 Ga0373937_0000187_57222_57626 118
397 3300036401 Ga0373937_0007297 Ga0373937_0007297_5463_5867 118
398 3300036401 Ga0373937_0106260 Ga0373937_0106260_2120_2524 118
399 3300036401 Ga0373937_0116544 Ga0373937_0116544_2085_2465 118
400 3300037068 Ga0373925_0059884 Ga0373925_0059884_1645_2025 118
401 3300037068 Ga0373925_0131753 Ga0373925_0131753_70_474 118
402 3300037068 Ga0373925_0172968 Ga0373925_0172968_597_1007 118
403 3300037068 Ga0373925_1134383 Ga0373925_1134383_82_486 118
404 3300037312 Ga0395899_0402143 Ga0395899_0402143_168_554 118
405 3300037471 Ga0395905_0859089 Ga0395905_0859089_294_680 118
406 3300037853 Ga0436364_0438451 Ga0436364_0438451_240_644 118
407 3300038443 Ga0395901_1084037 Ga0395901_1084037_365_751 118
408 3300039437 Ga0436365_1629968 Ga0436365_1629968_53_457 118
409 3300039450 Ga0436363_1218882 Ga0436363_1218882_1550_1957 118
410 3300041406 Ga0439439_0007000 Ga0439439_0007000_1769_2173 118
411 3300042436 Ga0439435_0031011 Ga0439435_0031011_714_1118 118
412 3300042876 Ga0451577_0006157 Ga0451577_0006157_6223_6627 118
413 3300044658 Ga0466972_0003193 Ga0466972_0003193_7307_7723 118
414 3300044694 Ga0466963_0415644 Ga0466963_0415644_182_613 118
415 3300044712 Ga0453684_0049328 Ga0453684_0049328_292_696 118
416 3300045051 Ga0451576_0003736 Ga0451576_0003736_17405_17809 118
417 3300046454 Ga0495592_0002947 Ga0495592_0002947_1485_1889 118
418 3300046454 Ga0495592_0223721 Ga0495592_0223721_834_1238 118
419 3300046455 Ga0495603_0356354 Ga0495603_0356354_27_431 118
420 3300046459 Ga0495629_0097869 Ga0495629_0097869_226_630 118
421 3300046459 Ga0495629_0244965 Ga0495629_0244965_208_618 118
422 3300046459 Ga0495629_0744311 Ga0495629_0744311_10_390 118
423 3300046462 Ga0495651_0000909 Ga0495651_0000909_2346_2750 118
424 3300046462 Ga0495651_0008040 Ga0495651_0008040_4475_4879 118
425 3300046462 Ga0495651_0459613 Ga0495651_0459613_18_422 118
426 3300046463 Ga0495653_0000455 Ga0495653_0000455_22118_22522 118
427 3300046472 Ga0495580_0479839 Ga0495580_0479839_310_714 118
428 3300046472 Ga0495580_0520146 Ga0495580_0520146_12_392 118
429 3300046476 Ga0495662_0188540 Ga0495662_0188540_91_495 118
430 3300046499 Ga0495594_0408021 Ga0495594_0408021_207_611 118
431 3300046507 Ga0495606_0000011 Ga0495606_0000011_50362_50796 118
432 3300046511 Ga0495608_0000235 Ga0495608_0000235_2897_3301 118
433 3300046514 Ga0495618_0094389 Ga0495618_0094389_1363_1767 118
434 3300046516 Ga0495628_0000373 Ga0495628_0000373_38821_39225 118
435 3300046517 Ga0495630_0000265 Ga0495630_0000265_12068_12472 118
436 3300046528 Ga0495642_0072187 Ga0495642_0072187_405_809 118
437 3300046528 Ga0495642_0141607 Ga0495642_0141607_447_842 118
438 3300046529 Ga0495652_0000781 Ga0495652_0000781_2979_3383 118
439 3300046529 Ga0495652_0439526 Ga0495652_0439526_311_715 118
440 3300046531 Ga0495665_0280145 Ga0495665_0280145_71_475 118
441 3300046535 Ga0495586_0084442 Ga0495586_0084442_210_614 118
442 3300046536 Ga0495587_0000650 Ga0495587_0000650_21556_21960 118
443 3300046536 Ga0495587_0047953 Ga0495587_0047953_618_1022 118
444 3300046537 Ga0495598_0050348 Ga0495598_0050348_736_1152 118
445 3300046539 Ga0495621_0338196 Ga0495621_0338196_228_617 118
446 3300046543 Ga0495645_0000654 Ga0495645_0000654_21624_22028 118
447 3300046559 Ga0495667_0001539 Ga0495667_0001539_13019_13423 118
448 3300046615 Ga0495656_0537272 Ga0495656_0537272_198_602 118
449 3300046616 Ga0495668_0485086 Ga0495668_0485086_92_508 118
450 3300046642 Ga0495634_0073353 Ga0495634_0073353_1590_1994 118
451 3300046663 Ga0495635_0000129 Ga0495635_0000129_9430_9834 118
452 3300046663 Ga0495635_0330528 Ga0495635_0330528_102_506 118
453 3300046663 Ga0495635_0584708 Ga0495635_0584708_273_677 118
454 3300046675 Ga0495657_0000184 Ga0495657_0000184_20199_20603 118
455 3300046678 Ga0495599_0001198 Ga0495599_0001198_11362_11766 118
456 3300046678 Ga0495599_0050607 Ga0495599_0050607_2098_2502 118
457 3300046678 Ga0495599_0722030 Ga0495599_0722030_107_529 118
458 3300046679 Ga0495623_0000213 Ga0495623_0000213_16582_16986 118
459 3300046680 Ga0495646_0000096 Ga0495646_0000096_22968_23372 118
460 3300046683 Ga0495658_0810989 Ga0495658_0810989_166_561 118
461 3300046689 Ga0495613_0032268 Ga0495613_0032268_547_951 118
462 3300046689 Ga0495613_0260676 Ga0495613_0260676_442_846 118
463 3300046690 Ga0495624_0959969 Ga0495624_0959969_17_421 118
464 3300046691 Ga0495670_0126458 Ga0495670_0126458_303_707 118
465 3300046809 Ga0495600_0000374 Ga0495600_0000374_884_1288 118
466 3300046809 Ga0495600_0541914 Ga0495600_0541914_178_582 118
467 3300047315 Ga0495581_0166109 Ga0495581_0166109_419_823 118
468 3300047317 Ga0495604_0000480 Ga0495604_0000480_3644_4048 118
469 3300047319 Ga0495674_0012522 Ga0495674_0012522_2479_2883 118
470 3300047319 Ga0495674_0253359 Ga0495674_0253359_241_645 118
471 3300047320 Ga0495672_0377078 Ga0495672_0377078_11_415 118
472 3300047322 Ga0495680_0006860 Ga0495680_0006860_7097_7501 118
473 3300047444 Ga0495675_0010372 Ga0495675_0010372_2566_2970 118
474 3300047471 Ga0495684_0000108 Ga0495684_0000108_21966_22370 118
475 3300047471 Ga0495684_0042153 Ga0495684_0042153_1488_1868 118
476 3300047471 Ga0495684_0654223 Ga0495684_0654223_39_443 118
477 3300048088 Ga0495602_0000954 Ga0495602_0000954_2895_3299 118
478 3300048090 Ga0495615_0126474 Ga0495615_0126474_101_517 118
479 3300048903 Ga0496100_0015213 Ga0496100_0015213_2552_2947 118
480 3300048904 Ga0496101_0026654 Ga0496101_0026654_3559_3954 118
481 3300048904 Ga0496101_0099785 Ga0496101_0099785_393_809 118
482 3300048905 Ga0496102_0011374 Ga0496102_0011374_2504_2908 118
483 3300048905 Ga0496102_0012907 Ga0496102_0012907_5580_5996 118
484 3300048905 Ga0496102_0163971 Ga0496102_0163971_168_563 118
485 3300048905 Ga0496102_1002217 Ga0496102_1002217_88_504 118
486 3300048907 Ga0496104_0004348 Ga0496104_0004348_8633_9028 118
487 3300048907 Ga0496104_0078991 Ga0496104_0078991_997_1413 118
488 3300048908 Ga0496105_0010792 Ga0496105_0010792_1361_1786 118
489 3300048908 Ga0496105_0055169 Ga0496105_0055169_535_930 118
490 3300048908 Ga0496105_0726516 Ga0496105_0726516_104_487 118
491 3300048909 Ga0496106_0118617 Ga0496106_0118617_1039_1434 118
492 3300048910 Ga0496107_0018151 Ga0496107_0018151_1863_2258 118
493 3300048910 Ga0496107_0535370 Ga0496107_0535370_92_502 118
494 3300048911 Ga0496108_0016356 Ga0496108_0016356_5601_5996 118
495 3300048911 Ga0496108_0116999 Ga0496108_0116999_305_721 118
496 3300048911 Ga0496108_0730901 Ga0496108_0730901_118_543 118
497 3300048911 Ga0496108_1175767 Ga0496108_1175767_166_582 118
498 3300048912 Ga0496109_0013720 Ga0496109_0013720_4891_5286 118
499 3300048912 Ga0496109_0077392 Ga0496109_0077392_2164_2580 118
500 3300048912 Ga0496109_0253331 Ga0496109_0253331_55_456 118
501 3300048913 Ga0496110_0045502 Ga0496110_0045502_1114_1539 118
502 3300048913 Ga0496110_0050375 Ga0496110_0050375_1973_2368 118
503 3300048914 Ga0496111_0054522 Ga0496111_0054522_1103_1519 118
504 3300048914 Ga0496111_0453205 Ga0496111_0453205_223_648 118
505 3300048917 Ga0496114_0038019 Ga0496114_0038019_2597_2998 118
506 3300048917 Ga0496114_0076107 Ga0496114_0076107_1523_1939 118
507 3300048917 Ga0496114_0122792 Ga0496114_0122792_1589_1984 118
508 3300048929 Ga0496126_0380724 Ga0496126_0380724_366_773 118
509 3300049578 Ga0501042_1302057 Ga0501042_1302057_18_410 118
510 3300049661 Ga0501217_183097 Ga0501217_183097_162_590 118
511 3300049686 Ga0501257_180191 Ga0501257_180191_142_558 118
512 3300049741 Ga0501079_0576318 Ga0501079_0576318_83_499 118
513 3300049824 Ga0501045_0880190 Ga0501045_0880190_97_513 118
514 3300050491 nmdc:mga00v17_209779_c1 nmdc:mga00v17_209779_c1_145_567 118
515 3300050493 nmdc:mga0k408_94915_c1 nmdc:mga0k408_94915_c1_580_1002 118
516 3300050494 nmdc:mga06z11_546148_c1 nmdc:mga06z11_546148_c1_154_576 118
517 3300050509 nmdc:mga0qj67_1103121_c1 nmdc:mga0qj67_1103121_c1_203_607 118
518 3300050509 nmdc:mga0qj67_166967_c1 nmdc:mga0qj67_166967_c1_1366_1770 118
519 3300050510 nmdc:mga06r32_27835_c1 nmdc:mga06r32_27835_c1_1919_2323 118
520 3300050511 nmdc:mga08y16_397104_c1 nmdc:mga08y16_397104_c1_420_815 118
521 3300050511 nmdc:mga08y16_54111_c1 nmdc:mga08y16_54111_c1_2189_2593 118
522 3300050512 nmdc:mga0n895_168573_c1 nmdc:mga0n895_168573_c1_237_641 118
523 3300050515 nmdc:mga0a205_225817_c1 nmdc:mga0a205_225817_c1_1209_1613 118
524 3300053077 Ga0495601_0064853 Ga0495601_0064853_661_1065 118
525 3300053077 Ga0495601_0072050 Ga0495601_0072050_1000_1404 118
526 3300053078 Ga0495612_0000510 Ga0495612_0000510_2919_3323 118
527 3300053084 Ga0495595_0003934 Ga0495595_0003934_1811_2215 118
528 3300053084 Ga0495595_0149704 Ga0495595_0149704_561_965 118
529 3300053085 Ga0495619_0005821 Ga0495619_0005821_2921_3325 118
530 3300053085 Ga0495619_0548832 Ga0495619_0548832_347_778 118
531 3300053096 Ga0500641_0008209 Ga0500641_0008209_1820_2239 118
532 3300059421 Ga0590071_000915 Ga0590071_000915_4951_5376 118
533 3300059423 Ga0590074_000991 Ga0590074_000991_424_849 118
534 3300059424 Ga0590075_006259 Ga0590075_006259_426_851 118
535 3300059426 Ga0590077_002195 Ga0590077_002195_3080_3505 118
536 iso_pu_bacteria 2643221603 2644031629 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

45

145

0.88

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

20

141

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8498 1 116
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8301 1 116
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.7996 1 116
6m36-assembly2.cif.gz_I the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.7939 1 118
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.7923 1 118
ID Description Score Start End Superfamily
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.825 1 116 3.30.565.10
af_Q4DBJ0_39_145_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8124 52 74 2.30.29.30
1tidC00 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.806 1 116 3.30.565.10
af_Q2FWJ3_5_155_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7794 1 117 3.30.565.10
af_Q5U2U3_71_143_2.20.140.10 Mainly Beta;Single Sheet;q64v53_bacfr protein fold;WGR domain 0.7787 51 68 2.20.140.10
ID Description Score Start End GO Terms
AF-A0A538PNY1-F1-model_v4 Anti-sigma regulatory factor 0.9857 2 118
AF-A0A6H2D199-F1-model_v4 Anti-sigma regulatory factor 0.9832 1 118
AF-A0A4V3T269-F1-model_v4 ATP-binding protein 0.9829 1 118 GO:0004674
GO:0005524
AF-B9X9T7-F1-model_v4 Putative anti-sigma regulatory factor, serine/threonine protein kinase 0.9821 2 117 GO:0004674
AF-A0A0U3L5K6-F1-model_v4 Anti-sigma regulatory factor 0.9815 1 118

Feature Viewer

pLDDT pTM Quality
94.17 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map