F460801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 316 | 535 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_11256791|Ga0207661_112567912 |
| Length | 145 |
| Sequence | LSGTGTASGPRVEDERSLPLRSGEDVVRLRQAVRERAVATGFSLVDQTKIVTAASELGRNTIQYGGGGRVAITTVSDGIRRGVRLEFVDQGPGIADLKLAMQDGYTTGGGLGLGLSGAKRLSDDFEIESSPGKGTRVAIVRWKAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 294 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 299 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 312 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 313 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 314 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.6 |
| Nodule | 0 |
| Rhizoplane | 5.41 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1006366 | 3300001976 | Bacteria | 1543 |
| 2 | JGI24749J21850_1006394 | 3300002076 | Bacteria | 1642 |
| 3 | JGI25159J45721_1001219 | 3300002987 | Bacteria | 10904 |
| 4 | JGI25161J50226_1018535 | 3300003374 | Bacteria | 721 |
| 5 | Ga0055526_1000729 | 3300003771 | Bacteria | 24835 |
| 6 | Ga0055537_1000078 | 3300003773 | Bacteria | 70140 |
| 7 | Ga0055534_1000105 | 3300003784 | Bacteria | 64494 |
| 8 | Ga0055528_1000609 | 3300003790 | Bacteria | 26761 |
| 9 | Ga0055543_1012016 | 3300004625 | Bacteria | 1753 |
| 10 | Ga0065712_10093866 | 3300005290 | Bacteria | 2276 |
| 11 | Ga0065707_10117266 | 3300005295 | Bacteria | 2216 |
| 12 | Ga0070658_10065693 | 3300005327 | Bacteria | 2962 |
| 13 | Ga0070658_10117735 | 3300005327 | Bacteria | 2206 |
| 14 | Ga0070658_11747516 | 3300005327 | Bacteria | 538 |
| 15 | Ga0070676_10020571 | 3300005328 | Bacteria | 3686 |
| 16 | Ga0070683_100112891 | 3300005329 | Bacteria | 2564 |
| 17 | Ga0070683_102124226 | 3300005329 | Unclassified | 539 |
| 18 | Ga0070690_100290781 | 3300005330 | Bacteria | 1168 |
| 19 | Ga0070670_100138332 | 3300005331 | Bacteria | 2105 |
| 20 | Ga0070670_100253714 | 3300005331 | Bacteria | 1533 |
| 21 | Ga0070677_10008120 | 3300005333 | Bacteria | 3523 |
| 22 | Ga0070677_10318231 | 3300005333 | Bacteria | 796 |
| 23 | Ga0070666_10063810 | 3300005335 | Bacteria | 2497 |
| 24 | Ga0070680_100056645 | 3300005336 | Bacteria | 3204 |
| 25 | Ga0068868_100156848 | 3300005338 | Bacteria | 1878 |
| 26 | Ga0070689_100003293 | 3300005340 | Bacteria | 10727 |
| 27 | Ga0070689_100050687 | 3300005340 | Bacteria | 3208 |
| 28 | Ga0070691_10297814 | 3300005341 | Bacteria | 880 |
| 29 | Ga0070661_100025395 | 3300005344 | Bacteria | 4257 |
| 30 | Ga0070661_100590524 | 3300005344 | Bacteria | 897 |
| 31 | Ga0070669_100048428 | 3300005353 | Bacteria | 3102 |
| 32 | Ga0070669_100074302 | 3300005353 | Bacteria | 2520 |
| 33 | Ga0070669_100640308 | 3300005353 | Bacteria | 894 |
| 34 | Ga0070675_100020756 | 3300005354 | Bacteria | 5243 |
| 35 | Ga0070675_100158041 | 3300005354 | Bacteria | 1947 |
| 36 | Ga0070675_100496367 | 3300005354 | Bacteria | 1099 |
| 37 | Ga0070671_100122652 | 3300005355 | Bacteria | 2187 |
| 38 | Ga0070671_100358986 | 3300005355 | Bacteria | 1244 |
| 39 | Ga0070671_100977961 | 3300005355 | Unclassified | 741 |
| 40 | Ga0070674_100196108 | 3300005356 | Bacteria | 1556 |
| 41 | Ga0070673_100633398 | 3300005364 | Bacteria | 977 |
| 42 | Ga0070673_100760455 | 3300005364 | Unclassified | 893 |
| 43 | Ga0070688_100001681 | 3300005365 | Bacteria | 11046 |
| 44 | Ga0070688_100663336 | 3300005365 | Bacteria | 804 |
| 45 | Ga0070659_100015377 | 3300005366 | Bacteria | 5732 |
| 46 | Ga0070659_100033198 | 3300005366 | Bacteria | 4007 |
| 47 | Ga0070667_100586935 | 3300005367 | Bacteria | 1026 |
| 48 | Ga0070709_10070217 | 3300005434 | Bacteria | 2257 |
| 49 | Ga0070714_100011345 | 3300005435 | Bacteria | 7066 |
| 50 | Ga0070714_100500304 | 3300005435 | Bacteria | 1159 |
| 51 | Ga0070713_100022623 | 3300005436 | Bacteria | 4860 |
| 52 | Ga0070713_100098188 | 3300005436 | Unclassified | 2532 |
| 53 | Ga0070713_100197770 | 3300005436 | Bacteria | 1814 |
| 54 | Ga0070710_10015016 | 3300005437 | Bacteria | 3911 |
| 55 | Ga0070701_10004728 | 3300005438 | Bacteria | 5558 |
| 56 | Ga0070711_100013903 | 3300005439 | Bacteria | 5063 |
| 57 | Ga0070700_100161938 | 3300005441 | Bacteria | 1541 |
| 58 | Ga0070663_100148766 | 3300005455 | Bacteria | 1794 |
| 59 | Ga0070663_100732032 | 3300005455 | Bacteria | 843 |
| 60 | Ga0070678_100073627 | 3300005456 | Bacteria | 2564 |
| 61 | Ga0070678_100632922 | 3300005456 | Bacteria | 958 |
| 62 | Ga0070662_100371166 | 3300005457 | Bacteria | 1176 |
| 63 | Ga0070662_100528408 | 3300005457 | Bacteria | 986 |
| 64 | Ga0070662_101147428 | 3300005457 | Bacteria | 667 |
| 65 | Ga0070681_10001174 | 3300005458 | Bacteria | 22638 |
| 66 | Ga0070681_10008404 | 3300005458 | Bacteria | 10108 |
| 67 | Ga0068867_100241438 | 3300005459 | Bacteria | 1465 |
| 68 | Ga0070685_10018655 | 3300005466 | Bacteria | 3734 |
| 69 | Ga0070679_100027775 | 3300005530 | Bacteria | 5573 |
| 70 | Ga0070679_100572548 | 3300005530 | Bacteria | 1073 |
| 71 | Ga0070684_100050090 | 3300005535 | Bacteria | 3627 |
| 72 | Ga0070684_100096891 | 3300005535 | Bacteria | 2630 |
| 73 | Ga0068853_100365534 | 3300005539 | Bacteria | 1345 |
| 74 | Ga0068853_100756985 | 3300005539 | Bacteria | 928 |
| 75 | Ga0070672_100261866 | 3300005543 | Bacteria | 1458 |
| 76 | Ga0070672_100752412 | 3300005543 | Bacteria | 855 |
| 77 | Ga0070672_100810618 | 3300005543 | Bacteria | 824 |
| 78 | Ga0070672_100968238 | 3300005543 | Bacteria | 753 |
| 79 | Ga0070696_100552239 | 3300005546 | Bacteria | 923 |
| 80 | Ga0070693_100314094 | 3300005547 | Bacteria | 1061 |
| 81 | Ga0070665_100007292 | 3300005548 | Bacteria | 11246 |
| 82 | Ga0070665_100054089 | 3300005548 | Bacteria | 4026 |
| 83 | Ga0070665_100368485 | 3300005548 | Bacteria | 1443 |
| 84 | Ga0070704_100164062 | 3300005549 | Bacteria | 1760 |
| 85 | Ga0068855_100014368 | 3300005563 | Bacteria | 9533 |
| 86 | Ga0068855_100608553 | 3300005563 | Bacteria | 1177 |
| 87 | Ga0068857_100814402 | 3300005577 | Bacteria | 892 |
| 88 | Ga0068857_101843777 | 3300005577 | Bacteria | 592 |
| 89 | Ga0068854_100078435 | 3300005578 | Bacteria | 2433 |
| 90 | Ga0068856_100537244 | 3300005614 | Bacteria | 1190 |
| 91 | Ga0070702_100041760 | 3300005615 | Bacteria | 2574 |
| 92 | Ga0068852_100000280 | 3300005616 | Bacteria | 34116 |
| 93 | Ga0068852_100006538 | 3300005616 | Bacteria | 8431 |
| 94 | Ga0068852_100048865 | 3300005616 | Bacteria | 3617 |
| 95 | Ga0068852_100535046 | 3300005616 | Bacteria | 1170 |
| 96 | Ga0068859_100090927 | 3300005617 | Bacteria | 3103 |
| 97 | Ga0068859_101291063 | 3300005617 | Bacteria | 804 |
| 98 | Ga0068864_100019560 | 3300005618 | Bacteria | 5664 |
| 99 | Ga0068864_100956728 | 3300005618 | Bacteria | 848 |
| 100 | Ga0068866_10139937 | 3300005718 | Bacteria | 1388 |
| 101 | Ga0068861_101250045 | 3300005719 | Unclassified | 720 |
| 102 | Ga0068861_101777658 | 3300005719 | Bacteria | 611 |
| 103 | Ga0068851_10020304 | 3300005834 | Bacteria | 3215 |
| 104 | Ga0068870_10013372 | 3300005840 | Bacteria | 3856 |
| 105 | Ga0068870_10073610 | 3300005840 | Bacteria | 1869 |
| 106 | Ga0068863_100049099 | 3300005841 | Bacteria | 4001 |
| 107 | Ga0068863_100351831 | 3300005841 | Bacteria | 1435 |
| 108 | Ga0068858_100012863 | 3300005842 | Bacteria | 7891 |
| 109 | Ga0068860_102776100 | 3300005843 | Bacteria | 508 |
| 110 | Ga0068862_100305345 | 3300005844 | Bacteria | 1465 |
| 111 | Ga0068862_100491646 | 3300005844 | Bacteria | 1163 |
| 112 | Ga0068862_100715480 | 3300005844 | Bacteria | 971 |
| 113 | Ga0070717_10010529 | 3300006028 | Bacteria | 6987 |
| 114 | Ga0070717_10097841 | 3300006028 | Bacteria | 2487 |
| 115 | Ga0070717_10174821 | 3300006028 | Bacteria | 1869 |
| 116 | Ga0070717_10202484 | 3300006028 | Bacteria | 1739 |
| 117 | Ga0075365_10387584 | 3300006038 | Bacteria | 986 |
| 118 | Ga0070712_100011965 | 3300006175 | Bacteria | 5515 |
| 119 | Ga0075367_10591791 | 3300006178 | Bacteria | 705 |
| 120 | Ga0075369_10027805 | 3300006186 | Bacteria | 2366 |
| 121 | Ga0075366_10047648 | 3300006195 | Bacteria | 2541 |
| 122 | Ga0075366_10181536 | 3300006195 | Bacteria | 1278 |
| 123 | Ga0075366_10236968 | 3300006195 | Bacteria | 1112 |
| 124 | Ga0097621_100080650 | 3300006237 | Bacteria | 2707 |
| 125 | Ga0097621_100159848 | 3300006237 | Bacteria | 1936 |
| 126 | Ga0068871_100235172 | 3300006358 | Bacteria | 1591 |
| 127 | Ga0068871_100763683 | 3300006358 | Unclassified | 889 |
| 128 | Ga0075428_100000213 | 3300006844 | Bacteria | 55855 |
| 129 | Ga0075428_100282231 | 3300006844 | Bacteria | 1787 |
| 130 | Ga0075428_100768218 | 3300006844 | Bacteria | 1025 |
| 131 | Ga0075428_102318756 | 3300006844 | Unclassified | 552 |
| 132 | Ga0075430_100695688 | 3300006846 | Bacteria | 838 |
| 133 | Ga0075431_100029987 | 3300006847 | Bacteria | 5602 |
| 134 | Ga0075434_100069546 | 3300006871 | Bacteria | 3510 |
| 135 | Ga0075434_100897617 | 3300006871 | Bacteria | 901 |
| 136 | Ga0075429_100317294 | 3300006880 | Bacteria | 1364 |
| 137 | Ga0075429_100922302 | 3300006880 | Bacteria | 764 |
| 138 | Ga0068865_100008093 | 3300006881 | Bacteria | 6488 |
| 139 | Ga0068865_100532790 | 3300006881 | Bacteria | 984 |
| 140 | Ga0068865_100553504 | 3300006881 | Bacteria | 966 |
| 141 | Ga0097620_100090930 | 3300006931 | Bacteria | 3103 |
| 142 | Ga0097620_101291271 | 3300006931 | Bacteria | 804 |
| 143 | Ga0105240_10004564 | 3300009093 | Bacteria | 21003 |
| 144 | Ga0105240_10853739 | 3300009093 | Bacteria | 982 |
| 145 | Ga0105240_10963161 | 3300009093 | Bacteria | 915 |
| 146 | Ga0105240_11684142 | 3300009093 | Bacteria | 662 |
| 147 | Ga0111539_10002652 | 3300009094 | Bacteria | 23721 |
| 148 | Ga0111539_10055127 | 3300009094 | Bacteria | 4726 |
| 149 | Ga0111539_10224069 | 3300009094 | Bacteria | 2190 |
| 150 | Ga0111539_10406722 | 3300009094 | Bacteria | 1585 |
| 151 | Ga0111539_10734228 | 3300009094 | Bacteria | 1149 |
| 152 | Ga0105245_10042425 | 3300009098 | Bacteria | 4060 |
| 153 | Ga0105245_10059001 | 3300009098 | Bacteria | 3455 |
| 154 | Ga0105245_10652719 | 3300009098 | Bacteria | 1082 |
| 155 | Ga0105247_11244134 | 3300009101 | Bacteria | 595 |
| 156 | Ga0114129_11389672 | 3300009147 | Bacteria | 867 |
| 157 | Ga0105243_10133382 | 3300009148 | Bacteria | 2110 |
| 158 | Ga0105243_10385516 | 3300009148 | Bacteria | 1297 |
| 159 | Ga0105243_11220768 | 3300009148 | Bacteria | 766 |
| 160 | Ga0105241_11940560 | 3300009174 | Bacteria | 578 |
| 161 | Ga0105242_10592373 | 3300009176 | Bacteria | 1070 |
| 162 | Ga0105248_10091698 | 3300009177 | Bacteria | 3421 |
| 163 | Ga0105237_10423417 | 3300009545 | Bacteria | 1337 |
| 164 | Ga0105237_11558299 | 3300009545 | Bacteria | 668 |
| 165 | Ga0105238_10022903 | 3300009551 | Bacteria | 6367 |
| 166 | Ga0105238_10417392 | 3300009551 | Bacteria | 1336 |
| 167 | Ga0105238_11077875 | 3300009551 | Bacteria | 826 |
| 168 | Ga0105239_10530738 | 3300010375 | Bacteria | 1339 |
| 169 | Ga0157369_10000349 | 3300013105 | Bacteria | 61491 |
| 170 | Ga0157369_11040001 | 3300013105 | Bacteria | 838 |
| 171 | Ga0157374_10091399 | 3300013296 | Bacteria | 2902 |
| 172 | Ga0157378_10024945 | 3300013297 | Bacteria | 5266 |
| 173 | Ga0157378_10464938 | 3300013297 | Bacteria | 1258 |
| 174 | Ga0163162_10082280 | 3300013306 | Bacteria | 3291 |
| 175 | Ga0163162_11203905 | 3300013306 | Bacteria | 860 |
| 176 | Ga0163162_11538722 | 3300013306 | Bacteria | 758 |
| 177 | Ga0157372_10006727 | 3300013307 | Bacteria | 12224 |
| 178 | Ga0157375_10265407 | 3300013308 | Bacteria | 1878 |
| 179 | Ga0157375_10829115 | 3300013308 | Bacteria | 1072 |
| 180 | Ga0157375_12025647 | 3300013308 | Bacteria | 684 |
| 181 | Ga0157375_13373738 | 3300013308 | Bacteria | 532 |
| 182 | Ga0157375_13571319 | 3300013308 | Unclassified | 517 |
| 183 | Ga0163163_10225064 | 3300014325 | Unclassified | 1925 |
| 184 | Ga0157380_10543341 | 3300014326 | Bacteria | 1138 |
| 185 | Ga0157380_10635255 | 3300014326 | Bacteria | 1062 |
| 186 | Ga0157380_11046732 | 3300014326 | Bacteria | 852 |
| 187 | Ga0157380_12763270 | 3300014326 | Bacteria | 557 |
| 188 | Ga0157379_10002758 | 3300014968 | Bacteria | 14819 |
| 189 | Ga0157379_10144347 | 3300014968 | Bacteria | 2146 |
| 190 | Ga0157379_10246752 | 3300014968 | Bacteria | 1620 |
| 191 | Ga0157376_10081887 | 3300014969 | Bacteria | 2772 |
| 192 | Ga0157376_11836956 | 3300014969 | Bacteria | 642 |
| 193 | Ga0163161_10139463 | 3300017792 | Bacteria | 1835 |
| 194 | Ga0163161_11195488 | 3300017792 | Bacteria | 657 |
| 195 | Ga0213874_10062254 | 3300021377 | Bacteria | 1171 |
| 196 | Ga0213875_10194698 | 3300021388 | Bacteria | 953 |
| 197 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 198 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 199 | Ga0209130_1000086 | 3300025284 | Bacteria | 157063 |
| 200 | Ga0207673_1012200 | 3300025290 | Bacteria | 1118 |
| 201 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 202 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 203 | Ga0209256_1000322 | 3300025299 | Bacteria | 82681 |
| 204 | Ga0207426_1010402 | 3300025302 | Bacteria | 3611 |
| 205 | Ga0207656_10002335 | 3300025321 | Bacteria | 6365 |
| 206 | Ga0207656_10035316 | 3300025321 | Bacteria | 2092 |
| 207 | Ga0207656_10566617 | 3300025321 | Bacteria | 579 |
| 208 | Ga0207653_10255785 | 3300025885 | Bacteria | 672 |
| 209 | Ga0207682_10004221 | 3300025893 | Bacteria | 6069 |
| 210 | Ga0207692_10653771 | 3300025898 | Bacteria | 679 |
| 211 | Ga0207688_10041948 | 3300025901 | Bacteria | 2546 |
| 212 | Ga0207688_10078230 | 3300025901 | Bacteria | 1885 |
| 213 | Ga0207688_10313994 | 3300025901 | Bacteria | 960 |
| 214 | Ga0207680_10065193 | 3300025903 | Bacteria | 2235 |
| 215 | Ga0207699_10085530 | 3300025906 | Bacteria | 1967 |
| 216 | Ga0207645_10142794 | 3300025907 | Bacteria | 1560 |
| 217 | Ga0207643_10000682 | 3300025908 | Bacteria | 21212 |
| 218 | Ga0207705_10019349 | 3300025909 | Bacteria | 4869 |
| 219 | Ga0207705_10061629 | 3300025909 | Bacteria | 2709 |
| 220 | Ga0207684_11334355 | 3300025910 | Bacteria | 589 |
| 221 | Ga0207707_10003106 | 3300025912 | Bacteria | 14737 |
| 222 | Ga0207707_10041225 | 3300025912 | Bacteria | 4032 |
| 223 | Ga0207695_10347870 | 3300025913 | Bacteria | 1370 |
| 224 | Ga0207671_10365337 | 3300025914 | Bacteria | 1146 |
| 225 | Ga0207693_10007023 | 3300025915 | Bacteria | 9294 |
| 226 | Ga0207663_10008656 | 3300025916 | Bacteria | 5338 |
| 227 | Ga0207660_10060992 | 3300025917 | Bacteria | 2713 |
| 228 | Ga0207660_10144000 | 3300025917 | Bacteria | 1824 |
| 229 | Ga0207662_10123418 | 3300025918 | Bacteria | 1626 |
| 230 | Ga0207657_10118861 | 3300025919 | Bacteria | 2175 |
| 231 | Ga0207649_10231208 | 3300025920 | Bacteria | 1322 |
| 232 | Ga0207649_10236024 | 3300025920 | Bacteria | 1310 |
| 233 | Ga0207649_10346601 | 3300025920 | Bacteria | 1098 |
| 234 | Ga0207652_10102555 | 3300025921 | Bacteria | 2529 |
| 235 | Ga0207652_10225334 | 3300025921 | Bacteria | 1689 |
| 236 | Ga0207652_10585365 | 3300025921 | Bacteria | 1001 |
| 237 | Ga0207652_11624798 | 3300025921 | Bacteria | 551 |
| 238 | Ga0207681_10056525 | 3300025923 | Bacteria | 2677 |
| 239 | Ga0207694_10290970 | 3300025924 | Bacteria | 1343 |
| 240 | Ga0207650_10000503 | 3300025925 | Bacteria | 32602 |
| 241 | Ga0207650_10043652 | 3300025925 | Bacteria | 3292 |
| 242 | Ga0207650_10379669 | 3300025925 | Bacteria | 1167 |
| 243 | Ga0207650_11107143 | 3300025925 | Bacteria | 674 |
| 244 | Ga0207659_10003703 | 3300025926 | Bacteria | 9218 |
| 245 | Ga0207659_10010298 | 3300025926 | Bacteria | 5870 |
| 246 | Ga0207659_10127163 | 3300025926 | Bacteria | 1962 |
| 247 | Ga0207659_10354724 | 3300025926 | Bacteria | 1218 |
| 248 | Ga0207687_10238079 | 3300025927 | Bacteria | 1441 |
| 249 | Ga0207687_10498400 | 3300025927 | Bacteria | 1016 |
| 250 | Ga0207700_10031558 | 3300025928 | Bacteria | 3766 |
| 251 | Ga0207700_10064311 | 3300025928 | Bacteria | 2794 |
| 252 | Ga0207700_10271559 | 3300025928 | Bacteria | 1456 |
| 253 | Ga0207700_10437676 | 3300025928 | Bacteria | 1151 |
| 254 | Ga0207700_10483911 | 3300025928 | Bacteria | 1094 |
| 255 | Ga0207664_10026705 | 3300025929 | Bacteria | 4366 |
| 256 | Ga0207664_10296440 | 3300025929 | Bacteria | 1422 |
| 257 | Ga0207644_10014234 | 3300025931 | Bacteria | 5319 |
| 258 | Ga0207644_10476984 | 3300025931 | Bacteria | 1027 |
| 259 | Ga0207690_10029406 | 3300025932 | Bacteria | 3493 |
| 260 | Ga0207690_10107326 | 3300025932 | Bacteria | 2005 |
| 261 | Ga0207706_10003306 | 3300025933 | Bacteria | 15441 |
| 262 | Ga0207706_10289713 | 3300025933 | Bacteria | 1427 |
| 263 | Ga0207706_10346374 | 3300025933 | Bacteria | 1292 |
| 264 | Ga0207686_10321612 | 3300025934 | Bacteria | 1156 |
| 265 | Ga0207709_10121576 | 3300025935 | Bacteria | 1764 |
| 266 | Ga0207709_10326083 | 3300025935 | Bacteria | 1151 |
| 267 | Ga0207670_10180538 | 3300025936 | Bacteria | 1589 |
| 268 | Ga0207670_10344830 | 3300025936 | Bacteria | 1178 |
| 269 | Ga0207704_10352971 | 3300025938 | Bacteria | 1146 |
| 270 | Ga0207704_10503153 | 3300025938 | Bacteria | 977 |
| 271 | Ga0207704_10781929 | 3300025938 | Bacteria | 796 |
| 272 | Ga0207704_11961866 | 3300025938 | Bacteria | 504 |
| 273 | Ga0207691_10063492 | 3300025940 | Bacteria | 3349 |
| 274 | Ga0207691_10177110 | 3300025940 | Bacteria | 1865 |
| 275 | Ga0207691_10352511 | 3300025940 | Bacteria | 1259 |
| 276 | Ga0207689_10056136 | 3300025942 | Bacteria | 3240 |
| 277 | Ga0207661_10044841 | 3300025944 | Bacteria | 3497 |
| 278 | Ga0207661_11256791 | 3300025944 | Bacteria | 681 |
| 279 | Ga0207661_11499663 | 3300025944 | Bacteria | 618 |
| 280 | Ga0207667_10069772 | 3300025949 | Bacteria | 3658 |
| 281 | Ga0207667_10133910 | 3300025949 | Bacteria | 2552 |
| 282 | Ga0207651_10209677 | 3300025960 | Bacteria | 1567 |
| 283 | Ga0207651_10230251 | 3300025960 | Bacteria | 1504 |
| 284 | Ga0207668_10649565 | 3300025972 | Bacteria | 923 |
| 285 | Ga0207668_10786748 | 3300025972 | Bacteria | 841 |
| 286 | Ga0207668_11825129 | 3300025972 | Bacteria | 549 |
| 287 | Ga0207640_10167566 | 3300025981 | Bacteria | 1633 |
| 288 | Ga0207658_10522874 | 3300025986 | Bacteria | 1059 |
| 289 | Ga0207677_10187143 | 3300026023 | Bacteria | 1634 |
| 290 | Ga0207703_10023215 | 3300026035 | Bacteria | 4872 |
| 291 | Ga0207678_10018252 | 3300026067 | Bacteria | 6160 |
| 292 | Ga0207678_10273128 | 3300026067 | Bacteria | 1450 |
| 293 | Ga0207708_10759885 | 3300026075 | Bacteria | 832 |
| 294 | Ga0207702_10455605 | 3300026078 | Bacteria | 1242 |
| 295 | Ga0207641_10031886 | 3300026088 | Bacteria | 4372 |
| 296 | Ga0207641_11291989 | 3300026088 | Bacteria | 730 |
| 297 | Ga0207648_10001351 | 3300026089 | Bacteria | 27125 |
| 298 | Ga0207648_10363789 | 3300026089 | Bacteria | 1306 |
| 299 | Ga0207676_10018991 | 3300026095 | Bacteria | 5007 |
| 300 | Ga0207676_11711935 | 3300026095 | Unclassified | 627 |
| 301 | Ga0207675_100568465 | 3300026118 | Bacteria | 1134 |
| 302 | Ga0207683_10240784 | 3300026121 | Bacteria | 1650 |
| 303 | Ga0207683_11152318 | 3300026121 | Bacteria | 719 |
| 304 | Ga0207698_10003142 | 3300026142 | Bacteria | 9903 |
| 305 | Ga0207698_10003270 | 3300026142 | Bacteria | 9739 |
| 306 | Ga0207698_10051317 | 3300026142 | Bacteria | 3153 |
| 307 | Ga0207698_10104015 | 3300026142 | Bacteria | 2361 |
| 308 | Ga0207698_10804725 | 3300026142 | Bacteria | 942 |
| 309 | Ga0209969_1000396 | 3300027360 | Bacteria | 5822 |
| 310 | Ga0209967_1002571 | 3300027364 | Bacteria | 2357 |
| 311 | Ga0209995_1002457 | 3300027471 | Bacteria | 2928 |
| 312 | Ga0209968_1004367 | 3300027526 | Unclassified | 2123 |
| 313 | Ga0209999_1001603 | 3300027543 | Bacteria | 3899 |
| 314 | Ga0209970_1003931 | 3300027614 | Bacteria | 2482 |
| 315 | Ga0209974_10001697 | 3300027876 | Bacteria | 7976 |
| 316 | Ga0207428_10037058 | 3300027907 | Bacteria | 3970 |
| 317 | Ga0207428_10241774 | 3300027907 | Bacteria | 1348 |
| 318 | Ga0268266_10012719 | 3300028379 | Bacteria | 7272 |
| 319 | Ga0268266_10078103 | 3300028379 | Bacteria | 2880 |
| 320 | Ga0268266_10581415 | 3300028379 | Bacteria | 1075 |
| 321 | Ga0268266_11195274 | 3300028379 | Bacteria | 735 |
| 322 | Ga0268265_10443019 | 3300028380 | Bacteria | 1211 |
| 323 | Ga0268265_10590433 | 3300028380 | Bacteria | 1060 |
| 324 | Ga0268265_12179760 | 3300028380 | Bacteria | 561 |
| 325 | Ga0268264_11129989 | 3300028381 | Bacteria | 792 |
| 326 | Ga0265320_10006897 | 3300031240 | Bacteria | 7100 |
| 327 | Ga0307408_100100499 | 3300031548 | Bacteria | 2203 |
| 328 | Ga0265313_10079766 | 3300031595 | Bacteria | 1489 |
| 329 | Ga0307405_11724818 | 3300031731 | Bacteria | 555 |
| 330 | Ga0307413_10882083 | 3300031824 | Bacteria | 758 |
| 331 | Ga0307410_10346464 | 3300031852 | Bacteria | 1186 |
| 332 | Ga0307410_11498601 | 3300031852 | Bacteria | 594 |
| 333 | Ga0307406_10465755 | 3300031901 | Bacteria | 1017 |
| 334 | Ga0307412_10342486 | 3300031911 | Bacteria | 1197 |
| 335 | Ga0307412_10485339 | 3300031911 | Bacteria | 1026 |
| 336 | Ga0307409_100729750 | 3300031995 | Bacteria | 993 |
| 337 | Ga0307409_101776628 | 3300031995 | Bacteria | 646 |
| 338 | Ga0307416_100351814 | 3300032002 | Bacteria | 1491 |
| 339 | Ga0307416_101247756 | 3300032002 | Bacteria | 849 |
| 340 | Ga0307415_100802856 | 3300032126 | Bacteria | 859 |
| 341 | Ga0373959_0104398 | 3300034820 | Bacteria | 678 |
| 342 | Ga0373926_0045799 | 3300035083 | Bacteria | 1569 |
| 343 | Ga0373934_0000150 | 3300035086 | Bacteria | 25208 |
| 344 | Ga0373934_0012965 | 3300035086 | Bacteria | 3150 |
| 345 | Ga0373940_0079129 | 3300035088 | Bacteria | 969 |
| 346 | Ga0373949_0042919 | 3300035090 | Bacteria | 1117 |
| 347 | Ga0373923_0013544 | 3300035111 | Bacteria | 3042 |
| 348 | Ga0373923_0155415 | 3300035111 | Bacteria | 1041 |
| 349 | Ga0373939_0455078 | 3300035114 | Bacteria | 539 |
| 350 | Ga0373941_0025182 | 3300035115 | Bacteria | 1716 |
| 351 | Ga0373941_0444747 | 3300035115 | Bacteria | 543 |
| 352 | Ga0373945_0514972 | 3300035116 | Bacteria | 534 |
| 353 | Ga0373953_0050933 | 3300035117 | Bacteria | 1673 |
| 354 | Ga0373954_0025781 | 3300035118 | Bacteria | 2691 |
| 355 | Ga0373956_0000118 | 3300035119 | Bacteria | 27439 |
| 356 | Ga0373956_0034133 | 3300035119 | Bacteria | 2240 |
| 357 | Ga0373956_0355266 | 3300035119 | Bacteria | 699 |
| 358 | Ga0373957_0035241 | 3300035120 | Bacteria | 1858 |
| 359 | Ga0373957_0057611 | 3300035120 | Bacteria | 1499 |
| 360 | Ga0373960_0023150 | 3300035121 | Bacteria | 1671 |
| 361 | Ga0373960_0086634 | 3300035121 | Bacteria | 995 |
| 362 | Ga0373946_0505059 | 3300035171 | Bacteria | 620 |
| 363 | Ga0373946_0600045 | 3300035171 | Bacteria | 571 |
| 364 | Ga0373955_0000871 | 3300035172 | Bacteria | 12934 |
| 365 | Ga0373955_0060164 | 3300035172 | Bacteria | 2094 |
| 366 | Ga0373961_0362079 | 3300035241 | Bacteria | 549 |
| 367 | Ga0373962_0035723 | 3300035242 | Bacteria | 1381 |
| 368 | Ga0373924_0002351 | 3300035410 | Bacteria | 6357 |
| 369 | Ga0373924_0043242 | 3300035410 | Bacteria | 1850 |
| 370 | Ga0373924_0072149 | 3300035410 | Unclassified | 1458 |
| 371 | Ga0373924_0093648 | 3300035410 | Bacteria | 1287 |
| 372 | Ga0373931_0077484 | 3300035691 | Bacteria | 1827 |
| 373 | Ga0373935_0568399 | 3300035692 | Bacteria | 827 |
| 374 | Ga0373927_0112254 | 3300035695 | Bacteria | 1776 |
| 375 | Ga0373927_0197813 | 3300035695 | Bacteria | 1319 |
| 376 | Ga0373927_0219637 | 3300035695 | Bacteria | 1248 |
| 377 | Ga0373927_0461115 | 3300035695 | Bacteria | 839 |
| 378 | Ga0373933_0000264 | 3300035724 | Bacteria | 34415 |
| 379 | Ga0373933_0022468 | 3300035724 | Bacteria | 3593 |
| 380 | Ga0373933_0289497 | 3300035724 | Bacteria | 1059 |
| 381 | Ga0373947_0025083 | 3300035725 | Bacteria | 3476 |
| 382 | Ga0373947_0091689 | 3300035725 | Bacteria | 1896 |
| 383 | Ga0373947_0124264 | 3300035725 | Bacteria | 1642 |
| 384 | Ga0373947_0623228 | 3300035725 | Bacteria | 735 |
| 385 | Ga0373937_0000187 | 3300036401 | Bacteria | 60840 |
| 386 | Ga0373937_0007297 | 3300036401 | Bacteria | 9568 |
| 387 | Ga0373937_0106260 | 3300036401 | Bacteria | 2609 |
| 388 | Ga0373937_0116544 | 3300036401 | Bacteria | 2488 |
| 389 | Ga0373925_0059884 | 3300037068 | Bacteria | 2857 |
| 390 | Ga0373925_0131753 | 3300037068 | Bacteria | 1950 |
| 391 | Ga0373925_0172968 | 3300037068 | Bacteria | 1706 |
| 392 | Ga0373925_0206353 | 3300037068 | Bacteria | 1564 |
| 393 | Ga0373925_1134383 | 3300037068 | Bacteria | 643 |
| 394 | Ga0395899_0402143 | 3300037312 | Bacteria | 906 |
| 395 | Ga0395905_0859089 | 3300037471 | Bacteria | 810 |
| 396 | Ga0436364_0438451 | 3300037853 | Bacteria | 1210 |
| 397 | Ga0395901_1084037 | 3300038443 | Bacteria | 772 |
| 398 | Ga0436365_1629968 | 3300039437 | Bacteria | 982 |
| 399 | Ga0436363_1218882 | 3300039450 | Bacteria | 2144 |
| 400 | Ga0439439_0007000 | 3300041406 | Bacteria | 2626 |
| 401 | Ga0439435_0031011 | 3300042436 | Bacteria | 1451 |
| 402 | Ga0451577_0006157 | 3300042876 | Bacteria | 12055 |
| 403 | Ga0466972_0003193 | 3300044658 | Bacteria | 8142 |
| 404 | Ga0466963_0415644 | 3300044694 | Bacteria | 949 |
| 405 | Ga0453684_0049328 | 3300044712 | Bacteria | 5554 |
| 406 | Ga0451576_0003736 | 3300045051 | Bacteria | 20577 |
| 407 | Ga0495592_0002947 | 3300046454 | Bacteria | 12113 |
| 408 | Ga0495592_0223721 | 3300046454 | Unclassified | 1257 |
| 409 | Ga0495603_0356354 | 3300046455 | Bacteria | 839 |
| 410 | Ga0495629_0097869 | 3300046459 | Bacteria | 2047 |
| 411 | Ga0495629_0244965 | 3300046459 | Unclassified | 1234 |
| 412 | Ga0495629_0744311 | 3300046459 | Bacteria | 649 |
| 413 | Ga0495651_0000909 | 3300046462 | Bacteria | 22947 |
| 414 | Ga0495651_0008040 | 3300046462 | Bacteria | 8086 |
| 415 | Ga0495651_0459613 | 3300046462 | Bacteria | 821 |
| 416 | Ga0495653_0000455 | 3300046463 | Bacteria | 31841 |
| 417 | Ga0495580_0479839 | 3300046472 | Bacteria | 832 |
| 418 | Ga0495580_0520146 | 3300046472 | Bacteria | 793 |
| 419 | Ga0495662_0188540 | 3300046476 | Bacteria | 1017 |
| 420 | Ga0495594_0408021 | 3300046499 | Bacteria | 773 |
| 421 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 422 | Ga0495608_0000235 | 3300046511 | Bacteria | 40161 |
| 423 | Ga0495618_0094389 | 3300046514 | Bacteria | 1913 |
| 424 | Ga0495628_0000373 | 3300046516 | Bacteria | 41064 |
| 425 | Ga0495630_0000265 | 3300046517 | Bacteria | 42480 |
| 426 | Ga0495642_0072187 | 3300046528 | Bacteria | 1445 |
| 427 | Ga0495642_0141607 | 3300046528 | Bacteria | 1038 |
| 428 | Ga0495652_0000781 | 3300046529 | Bacteria | 36646 |
| 429 | Ga0495652_0439526 | 3300046529 | Bacteria | 915 |
| 430 | Ga0495665_0280145 | 3300046531 | Bacteria | 855 |
| 431 | Ga0495586_0084442 | 3300046535 | Bacteria | 1748 |
| 432 | Ga0495587_0000650 | 3300046536 | Bacteria | 23317 |
| 433 | Ga0495587_0047953 | 3300046536 | Unclassified | 2532 |
| 434 | Ga0495598_0050348 | 3300046537 | Bacteria | 1252 |
| 435 | Ga0495621_0338196 | 3300046539 | Bacteria | 629 |
| 436 | Ga0495645_0000654 | 3300046543 | Bacteria | 23867 |
| 437 | Ga0495667_0001539 | 3300046559 | Bacteria | 15262 |
| 438 | Ga0495656_0537272 | 3300046615 | Bacteria | 622 |
| 439 | Ga0495668_0000030 | 3300046616 | Bacteria | 262663 |
| 440 | Ga0495668_0485086 | 3300046616 | Bacteria | 681 |
| 441 | Ga0495634_0073353 | 3300046642 | Unclassified | 2250 |
| 442 | Ga0495635_0000129 | 3300046663 | Bacteria | 45476 |
| 443 | Ga0495635_0330528 | 3300046663 | Bacteria | 1019 |
| 444 | Ga0495635_0584708 | 3300046663 | Unclassified | 730 |
| 445 | Ga0495657_0000184 | 3300046675 | Bacteria | 56279 |
| 446 | Ga0495599_0001198 | 3300046678 | Bacteria | 14690 |
| 447 | Ga0495599_0050607 | 3300046678 | Bacteria | 2603 |
| 448 | Ga0495599_0722030 | 3300046678 | Bacteria | 573 |
| 449 | Ga0495623_0000213 | 3300046679 | Bacteria | 37055 |
| 450 | Ga0495646_0000096 | 3300046680 | Bacteria | 42826 |
| 451 | Ga0495658_0810989 | 3300046683 | Bacteria | 599 |
| 452 | Ga0495613_0032268 | 3300046689 | Bacteria | 3890 |
| 453 | Ga0495613_0260676 | 3300046689 | Bacteria | 1208 |
| 454 | Ga0495624_0959969 | 3300046690 | Bacteria | 502 |
| 455 | Ga0495670_0126458 | 3300046691 | Bacteria | 1331 |
| 456 | Ga0495600_0000374 | 3300046809 | Bacteria | 23364 |
| 457 | Ga0495600_0541914 | 3300046809 | Bacteria | 712 |
| 458 | Ga0495581_0166109 | 3300047315 | Bacteria | 1290 |
| 459 | Ga0495604_0000480 | 3300047317 | Bacteria | 35148 |
| 460 | Ga0495674_0012522 | 3300047319 | Bacteria | 7990 |
| 461 | Ga0495674_0253359 | 3300047319 | Bacteria | 1448 |
| 462 | Ga0495672_0377078 | 3300047320 | Bacteria | 653 |
| 463 | Ga0495680_0006860 | 3300047322 | Bacteria | 10523 |
| 464 | Ga0495675_0010372 | 3300047444 | Bacteria | 5824 |
| 465 | Ga0495684_0000108 | 3300047471 | Bacteria | 59609 |
| 466 | Ga0495684_0042153 | 3300047471 | Bacteria | 3497 |
| 467 | Ga0495684_0654223 | 3300047471 | Bacteria | 702 |
| 468 | Ga0495686_0001097 | 3300047472 | Bacteria | 32205 |
| 469 | Ga0495602_0000954 | 3300048088 | Bacteria | 27928 |
| 470 | Ga0495615_0126474 | 3300048090 | Bacteria | 744 |
| 471 | Ga0496100_0015213 | 3300048903 | Bacteria | 4489 |
| 472 | Ga0496101_0026654 | 3300048904 | Bacteria | 4019 |
| 473 | Ga0496101_0099785 | 3300048904 | Bacteria | 2171 |
| 474 | Ga0496102_0011374 | 3300048905 | Bacteria | 7669 |
| 475 | Ga0496102_0012907 | 3300048905 | Bacteria | 7233 |
| 476 | Ga0496102_0163971 | 3300048905 | Bacteria | 2091 |
| 477 | Ga0496102_1002217 | 3300048905 | Bacteria | 756 |
| 478 | Ga0496104_0004348 | 3300048907 | Bacteria | 12323 |
| 479 | Ga0496104_0078991 | 3300048907 | Bacteria | 3136 |
| 480 | Ga0496105_0010792 | 3300048908 | Bacteria | 7195 |
| 481 | Ga0496105_0055169 | 3300048908 | Bacteria | 3281 |
| 482 | Ga0496105_0726516 | 3300048908 | Bacteria | 760 |
| 483 | Ga0496106_0118617 | 3300048909 | Bacteria | 2066 |
| 484 | Ga0496107_0018151 | 3300048910 | Bacteria | 4950 |
| 485 | Ga0496107_0535370 | 3300048910 | Bacteria | 868 |
| 486 | Ga0496108_0016356 | 3300048911 | Bacteria | 6049 |
| 487 | Ga0496108_0116999 | 3300048911 | Bacteria | 2284 |
| 488 | Ga0496108_0730901 | 3300048911 | Bacteria | 857 |
| 489 | Ga0496108_1175767 | 3300048911 | Bacteria | 649 |
| 490 | Ga0496109_0013720 | 3300048912 | Bacteria | 7039 |
| 491 | Ga0496109_0077392 | 3300048912 | Bacteria | 3061 |
| 492 | Ga0496109_0253331 | 3300048912 | Bacteria | 1658 |
| 493 | Ga0496110_0045502 | 3300048913 | Bacteria | 3837 |
| 494 | Ga0496110_0050375 | 3300048913 | Bacteria | 3656 |
| 495 | Ga0496111_0054522 | 3300048914 | Bacteria | 2890 |
| 496 | Ga0496111_0453205 | 3300048914 | Bacteria | 946 |
| 497 | Ga0496114_0038019 | 3300048917 | Bacteria | 3982 |
| 498 | Ga0496114_0076107 | 3300048917 | Bacteria | 2828 |
| 499 | Ga0496114_0122792 | 3300048917 | Bacteria | 2235 |
| 500 | Ga0496126_0380724 | 3300048929 | Unclassified | 1149 |
| 501 | Ga0501042_1302057 | 3300049578 | Bacteria | 530 |
| 502 | Ga0501217_183097 | 3300049661 | Unclassified | 644 |
| 503 | Ga0501257_180191 | 3300049686 | Bacteria | 598 |
| 504 | Ga0501225_0254390 | 3300049705 | Bacteria | 579 |
| 505 | Ga0501079_0576318 | 3300049741 | Bacteria | 885 |
| 506 | Ga0501045_0880190 | 3300049824 | Bacteria | 658 |
| 507 | nmdc:mga00v17_209779_c1 | 3300050491 | Bacteria | 1260 |
| 508 | nmdc:mga0yw44_1025548_c1 | 3300050492 | Bacteria | 558 |
| 509 | nmdc:mga0yw44_492652_c1 | 3300050492 | Bacteria | 831 |
| 510 | nmdc:mga0k408_135088_c1 | 3300050493 | Bacteria | 1465 |
| 511 | nmdc:mga0k408_94915_c1 | 3300050493 | Bacteria | 1754 |
| 512 | nmdc:mga06z11_546148_c1 | 3300050494 | Bacteria | 703 |
| 513 | nmdc:mga06z11_586411_c1 | 3300050494 | Bacteria | 678 |
| 514 | nmdc:mga0qj67_1103121_c1 | 3300050509 | Bacteria | 620 |
| 515 | nmdc:mga0qj67_166967_c1 | 3300050509 | Bacteria | 1787 |
| 516 | nmdc:mga06r32_27835_c1 | 3300050510 | Bacteria | 5284 |
| 517 | nmdc:mga08y16_397104_c1 | 3300050511 | Bacteria | 1412 |
| 518 | nmdc:mga08y16_54111_c1 | 3300050511 | Bacteria | 4194 |
| 519 | nmdc:mga08y16_54122_c1 | 3300050511 | Bacteria | 4193 |
| 520 | nmdc:mga0n895_168573_c1 | 3300050512 | Bacteria | 2222 |
| 521 | nmdc:mga0a205_225817_c1 | 3300050515 | Bacteria | 1757 |
| 522 | nmdc:mga0sz30_31836_c1 | 3300050516 | Bacteria | 2184 |
| 523 | Ga0495601_0064853 | 3300053077 | Bacteria | 2324 |
| 524 | Ga0495601_0072050 | 3300053077 | Bacteria | 2207 |
| 525 | Ga0495612_0000510 | 3300053078 | Bacteria | 15585 |
| 526 | Ga0495595_0003934 | 3300053084 | Bacteria | 5935 |
| 527 | Ga0495595_0149704 | 3300053084 | Unclassified | 1148 |
| 528 | Ga0495619_0005821 | 3300053085 | Bacteria | 7813 |
| 529 | Ga0495619_0548832 | 3300053085 | Unclassified | 793 |
| 530 | Ga0500641_0008209 | 3300053096 | Bacteria | 3723 |
| 531 | Ga0500637_0139306 | 3300053178 | Bacteria | 1405 |
| 532 | Ga0590071_000915 | 3300059421 | Bacteria | 8173 |
| 533 | Ga0590074_000991 | 3300059423 | Bacteria | 4463 |
| 534 | Ga0590075_006259 | 3300059424 | Bacteria | 2823 |
| 535 | Ga0590077_002195 | 3300059426 | Bacteria | 4256 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_11538722 | Ga0163162_115387222 | 107 |
| 2 | 3300014968 | Ga0157379_10246752 | Ga0157379_102467522 | 107 |
| 3 | 3300005333 | Ga0070677_10318231 | Ga0070677_103182312 | 109 |
| 4 | 3300006186 | Ga0075369_10027805 | Ga0075369_100278052 | 116 |
| 5 | 3300006195 | Ga0075366_10236968 | Ga0075366_102369682 | 116 |
| 6 | 3300050493 | nmdc:mga0k408_135088_c1 | nmdc:mga0k408_135088_c1_398_817 | 116 |
| 7 | 3300050516 | nmdc:mga0sz30_31836_c1 | nmdc:mga0sz30_31836_c1_1128_1547 | 116 |
| 8 | 3300002987 | JGI25159J45721_1001219 | JGI25159J45721_10012195 | 117 |
| 9 | 3300003374 | JGI25161J50226_1018535 | JGI25161J50226_10185352 | 117 |
| 10 | 3300003771 | Ga0055526_1000729 | Ga0055526_10007294 | 117 |
| 11 | 3300003773 | Ga0055537_1000078 | Ga0055537_100007823 | 117 |
| 12 | 3300003784 | Ga0055534_1000105 | Ga0055534_100010534 | 117 |
| 13 | 3300003790 | Ga0055528_1000609 | Ga0055528_100060912 | 117 |
| 14 | 3300004625 | Ga0055543_1012016 | Ga0055543_10120162 | 117 |
| 15 | 3300005844 | Ga0068862_100491646 | Ga0068862_1004916462 | 117 |
| 16 | 3300006038 | Ga0075365_10387584 | Ga0075365_103875842 | 117 |
| 17 | 3300006195 | Ga0075366_10047648 | Ga0075366_100476482 | 117 |
| 18 | 3300009094 | Ga0111539_10055127 | Ga0111539_100551273 | 117 |
| 19 | 3300025263 | Ga0209565_1000035 | Ga0209565_1000035249 | 117 |
| 20 | 3300025273 | Ga0209673_1000006 | Ga0209673_1000006339 | 117 |
| 21 | 3300025284 | Ga0209130_1000086 | Ga0209130_1000086101 | 117 |
| 22 | 3300025291 | Ga0209675_1000005 | Ga0209675_1000005433 | 117 |
| 23 | 3300025295 | Ga0209564_1000083 | Ga0209564_1000083203 | 117 |
| 24 | 3300025299 | Ga0209256_1000322 | Ga0209256_100032238 | 117 |
| 25 | 3300025302 | Ga0207426_1010402 | Ga0207426_10104024 | 117 |
| 26 | 3300027360 | Ga0209969_1000396 | Ga0209969_10003967 | 117 |
| 27 | 3300027364 | Ga0209967_1002571 | Ga0209967_10025714 | 117 |
| 28 | 3300027471 | Ga0209995_1002457 | Ga0209995_10024572 | 117 |
| 29 | 3300027526 | Ga0209968_1004367 | Ga0209968_10043672 | 117 |
| 30 | 3300027543 | Ga0209999_1001603 | Ga0209999_10016033 | 117 |
| 31 | 3300027614 | Ga0209970_1003931 | Ga0209970_10039313 | 117 |
| 32 | 3300027876 | Ga0209974_10001697 | Ga0209974_100016978 | 117 |
| 33 | 3300027907 | Ga0207428_10241774 | Ga0207428_102417742 | 117 |
| 34 | 3300028380 | Ga0268265_10443019 | Ga0268265_104430192 | 117 |
| 35 | 3300037068 | Ga0373925_0206353 | Ga0373925_0206353_112_504 | 117 |
| 36 | 3300046616 | Ga0495668_0000030 | Ga0495668_0000030_92159_92572 | 117 |
| 37 | 3300047472 | Ga0495686_0001097 | Ga0495686_0001097_4314_4727 | 117 |
| 38 | 3300049705 | Ga0501225_0254390 | Ga0501225_0254390_54_437 | 117 |
| 39 | 3300050492 | nmdc:mga0yw44_1025548_c1 | nmdc:mga0yw44_1025548_c1_97_513 | 117 |
| 40 | 3300050492 | nmdc:mga0yw44_492652_c1 | nmdc:mga0yw44_492652_c1_355_774 | 117 |
| 41 | 3300050494 | nmdc:mga06z11_586411_c1 | nmdc:mga06z11_586411_c1_177_596 | 117 |
| 42 | 3300050511 | nmdc:mga08y16_54122_c1 | nmdc:mga08y16_54122_c1_3231_3632 | 117 |
| 43 | 3300053178 | Ga0500637_0139306 | Ga0500637_0139306_15_467 | 117 |
| 44 | 3300001976 | JGI24752J21851_1006366 | JGI24752J21851_10063663 | 118 |
| 45 | 3300002076 | JGI24749J21850_1006394 | JGI24749J21850_10063943 | 118 |
| 46 | 3300005290 | Ga0065712_10093866 | Ga0065712_100938661 | 118 |
| 47 | 3300005295 | Ga0065707_10117266 | Ga0065707_101172661 | 118 |
| 48 | 3300005327 | Ga0070658_10065693 | Ga0070658_100656932 | 118 |
| 49 | 3300005327 | Ga0070658_10117735 | Ga0070658_101177353 | 118 |
| 50 | 3300005327 | Ga0070658_11747516 | Ga0070658_117475161 | 118 |
| 51 | 3300005328 | Ga0070676_10020571 | Ga0070676_100205714 | 118 |
| 52 | 3300005329 | Ga0070683_100112891 | Ga0070683_1001128913 | 118 |
| 53 | 3300005329 | Ga0070683_102124226 | Ga0070683_1021242261 | 118 |
| 54 | 3300005330 | Ga0070690_100290781 | Ga0070690_1002907812 | 118 |
| 55 | 3300005331 | Ga0070670_100138332 | Ga0070670_1001383322 | 118 |
| 56 | 3300005331 | Ga0070670_100253714 | Ga0070670_1002537143 | 118 |
| 57 | 3300005333 | Ga0070677_10008120 | Ga0070677_100081204 | 118 |
| 58 | 3300005335 | Ga0070666_10063810 | Ga0070666_100638102 | 118 |
| 59 | 3300005336 | Ga0070680_100056645 | Ga0070680_1000566454 | 118 |
| 60 | 3300005338 | Ga0068868_100156848 | Ga0068868_1001568481 | 118 |
| 61 | 3300005340 | Ga0070689_100003293 | Ga0070689_1000032937 | 118 |
| 62 | 3300005340 | Ga0070689_100050687 | Ga0070689_1000506873 | 118 |
| 63 | 3300005341 | Ga0070691_10297814 | Ga0070691_102978142 | 118 |
| 64 | 3300005344 | Ga0070661_100025395 | Ga0070661_1000253953 | 118 |
| 65 | 3300005344 | Ga0070661_100590524 | Ga0070661_1005905242 | 118 |
| 66 | 3300005353 | Ga0070669_100048428 | Ga0070669_1000484283 | 118 |
| 67 | 3300005353 | Ga0070669_100074302 | Ga0070669_1000743024 | 118 |
| 68 | 3300005353 | Ga0070669_100640308 | Ga0070669_1006403082 | 118 |
| 69 | 3300005354 | Ga0070675_100020756 | Ga0070675_1000207562 | 118 |
| 70 | 3300005354 | Ga0070675_100158041 | Ga0070675_1001580413 | 118 |
| 71 | 3300005354 | Ga0070675_100496367 | Ga0070675_1004963672 | 118 |
| 72 | 3300005355 | Ga0070671_100122652 | Ga0070671_1001226523 | 118 |
| 73 | 3300005355 | Ga0070671_100358986 | Ga0070671_1003589863 | 118 |
| 74 | 3300005355 | Ga0070671_100977961 | Ga0070671_1009779611 | 118 |
| 75 | 3300005356 | Ga0070674_100196108 | Ga0070674_1001961082 | 118 |
| 76 | 3300005364 | Ga0070673_100633398 | Ga0070673_1006333981 | 118 |
| 77 | 3300005364 | Ga0070673_100760455 | Ga0070673_1007604552 | 118 |
| 78 | 3300005365 | Ga0070688_100001681 | Ga0070688_1000016813 | 118 |
| 79 | 3300005365 | Ga0070688_100663336 | Ga0070688_1006633362 | 118 |
| 80 | 3300005366 | Ga0070659_100015377 | Ga0070659_1000153774 | 118 |
| 81 | 3300005366 | Ga0070659_100033198 | Ga0070659_1000331983 | 118 |
| 82 | 3300005367 | Ga0070667_100586935 | Ga0070667_1005869353 | 118 |
| 83 | 3300005434 | Ga0070709_10070217 | Ga0070709_100702172 | 118 |
| 84 | 3300005435 | Ga0070714_100011345 | Ga0070714_1000113453 | 118 |
| 85 | 3300005435 | Ga0070714_100500304 | Ga0070714_1005003042 | 118 |
| 86 | 3300005436 | Ga0070713_100022623 | Ga0070713_1000226235 | 118 |
| 87 | 3300005436 | Ga0070713_100098188 | Ga0070713_1000981884 | 118 |
| 88 | 3300005436 | Ga0070713_100197770 | Ga0070713_1001977703 | 118 |
| 89 | 3300005437 | Ga0070710_10015016 | Ga0070710_100150163 | 118 |
| 90 | 3300005438 | Ga0070701_10004728 | Ga0070701_100047282 | 118 |
| 91 | 3300005439 | Ga0070711_100013903 | Ga0070711_1000139032 | 118 |
| 92 | 3300005441 | Ga0070700_100161938 | Ga0070700_1001619382 | 118 |
| 93 | 3300005455 | Ga0070663_100148766 | Ga0070663_1001487663 | 118 |
| 94 | 3300005455 | Ga0070663_100732032 | Ga0070663_1007320322 | 118 |
| 95 | 3300005456 | Ga0070678_100073627 | Ga0070678_1000736273 | 118 |
| 96 | 3300005456 | Ga0070678_100632922 | Ga0070678_1006329221 | 118 |
| 97 | 3300005457 | Ga0070662_100371166 | Ga0070662_1003711662 | 118 |
| 98 | 3300005457 | Ga0070662_100528408 | Ga0070662_1005284082 | 118 |
| 99 | 3300005457 | Ga0070662_101147428 | Ga0070662_1011474281 | 118 |
| 100 | 3300005458 | Ga0070681_10001174 | Ga0070681_100011748 | 118 |
| 101 | 3300005458 | Ga0070681_10008404 | Ga0070681_100084045 | 118 |
| 102 | 3300005459 | Ga0068867_100241438 | Ga0068867_1002414382 | 118 |
| 103 | 3300005466 | Ga0070685_10018655 | Ga0070685_100186553 | 118 |
| 104 | 3300005530 | Ga0070679_100027775 | Ga0070679_1000277752 | 118 |
| 105 | 3300005530 | Ga0070679_100572548 | Ga0070679_1005725482 | 118 |
| 106 | 3300005535 | Ga0070684_100050090 | Ga0070684_1000500904 | 118 |
| 107 | 3300005535 | Ga0070684_100096891 | Ga0070684_1000968912 | 118 |
| 108 | 3300005539 | Ga0068853_100365534 | Ga0068853_1003655343 | 118 |
| 109 | 3300005539 | Ga0068853_100756985 | Ga0068853_1007569852 | 118 |
| 110 | 3300005543 | Ga0070672_100261866 | Ga0070672_1002618662 | 118 |
| 111 | 3300005543 | Ga0070672_100752412 | Ga0070672_1007524122 | 118 |
| 112 | 3300005543 | Ga0070672_100810618 | Ga0070672_1008106182 | 118 |
| 113 | 3300005543 | Ga0070672_100968238 | Ga0070672_1009682382 | 118 |
| 114 | 3300005546 | Ga0070696_100552239 | Ga0070696_1005522391 | 118 |
| 115 | 3300005547 | Ga0070693_100314094 | Ga0070693_1003140941 | 118 |
| 116 | 3300005548 | Ga0070665_100007292 | Ga0070665_1000072927 | 118 |
| 117 | 3300005548 | Ga0070665_100054089 | Ga0070665_1000540893 | 118 |
| 118 | 3300005548 | Ga0070665_100368485 | Ga0070665_1003684853 | 118 |
| 119 | 3300005549 | Ga0070704_100164062 | Ga0070704_1001640622 | 118 |
| 120 | 3300005563 | Ga0068855_100014368 | Ga0068855_10001436812 | 118 |
| 121 | 3300005563 | Ga0068855_100608553 | Ga0068855_1006085532 | 118 |
| 122 | 3300005577 | Ga0068857_100814402 | Ga0068857_1008144022 | 118 |
| 123 | 3300005577 | Ga0068857_101843777 | Ga0068857_1018437771 | 118 |
| 124 | 3300005578 | Ga0068854_100078435 | Ga0068854_1000784353 | 118 |
| 125 | 3300005614 | Ga0068856_100537244 | Ga0068856_1005372442 | 118 |
| 126 | 3300005615 | Ga0070702_100041760 | Ga0070702_1000417604 | 118 |
| 127 | 3300005616 | Ga0068852_100000280 | Ga0068852_10000028015 | 118 |
| 128 | 3300005616 | Ga0068852_100006538 | Ga0068852_1000065388 | 118 |
| 129 | 3300005616 | Ga0068852_100048865 | Ga0068852_1000488654 | 118 |
| 130 | 3300005616 | Ga0068852_100535046 | Ga0068852_1005350462 | 118 |
| 131 | 3300005617 | Ga0068859_100090927 | Ga0068859_1000909272 | 118 |
| 132 | 3300005617 | Ga0068859_101291063 | Ga0068859_1012910632 | 118 |
| 133 | 3300005618 | Ga0068864_100019560 | Ga0068864_1000195604 | 118 |
| 134 | 3300005618 | Ga0068864_100956728 | Ga0068864_1009567282 | 118 |
| 135 | 3300005718 | Ga0068866_10139937 | Ga0068866_101399373 | 118 |
| 136 | 3300005719 | Ga0068861_101250045 | Ga0068861_1012500452 | 118 |
| 137 | 3300005719 | Ga0068861_101777658 | Ga0068861_1017776582 | 118 |
| 138 | 3300005834 | Ga0068851_10020304 | Ga0068851_100203043 | 118 |
| 139 | 3300005840 | Ga0068870_10013372 | Ga0068870_100133723 | 118 |
| 140 | 3300005840 | Ga0068870_10073610 | Ga0068870_100736102 | 118 |
| 141 | 3300005841 | Ga0068863_100049099 | Ga0068863_1000490993 | 118 |
| 142 | 3300005841 | Ga0068863_100351831 | Ga0068863_1003518312 | 118 |
| 143 | 3300005842 | Ga0068858_100012863 | Ga0068858_1000128633 | 118 |
| 144 | 3300005843 | Ga0068860_102776100 | Ga0068860_1027761001 | 118 |
| 145 | 3300005844 | Ga0068862_100305345 | Ga0068862_1003053452 | 118 |
| 146 | 3300005844 | Ga0068862_100715480 | Ga0068862_1007154802 | 118 |
| 147 | 3300006028 | Ga0070717_10010529 | Ga0070717_100105296 | 118 |
| 148 | 3300006028 | Ga0070717_10097841 | Ga0070717_100978412 | 118 |
| 149 | 3300006028 | Ga0070717_10174821 | Ga0070717_101748212 | 118 |
| 150 | 3300006028 | Ga0070717_10202484 | Ga0070717_102024843 | 118 |
| 151 | 3300006175 | Ga0070712_100011965 | Ga0070712_1000119653 | 118 |
| 152 | 3300006178 | Ga0075367_10591791 | Ga0075367_105917912 | 118 |
| 153 | 3300006195 | Ga0075366_10181536 | Ga0075366_101815363 | 118 |
| 154 | 3300006237 | Ga0097621_100080650 | Ga0097621_1000806503 | 118 |
| 155 | 3300006237 | Ga0097621_100159848 | Ga0097621_1001598482 | 118 |
| 156 | 3300006358 | Ga0068871_100235172 | Ga0068871_1002351722 | 118 |
| 157 | 3300006358 | Ga0068871_100763683 | Ga0068871_1007636832 | 118 |
| 158 | 3300006844 | Ga0075428_100000213 | Ga0075428_10000021349 | 118 |
| 159 | 3300006844 | Ga0075428_100282231 | Ga0075428_1002822313 | 118 |
| 160 | 3300006844 | Ga0075428_100768218 | Ga0075428_1007682182 | 118 |
| 161 | 3300006844 | Ga0075428_102318756 | Ga0075428_1023187561 | 118 |
| 162 | 3300006846 | Ga0075430_100695688 | Ga0075430_1006956882 | 118 |
| 163 | 3300006847 | Ga0075431_100029987 | Ga0075431_1000299873 | 118 |
| 164 | 3300006871 | Ga0075434_100069546 | Ga0075434_1000695463 | 118 |
| 165 | 3300006871 | Ga0075434_100897617 | Ga0075434_1008976172 | 118 |
| 166 | 3300006880 | Ga0075429_100317294 | Ga0075429_1003172943 | 118 |
| 167 | 3300006880 | Ga0075429_100922302 | Ga0075429_1009223022 | 118 |
| 168 | 3300006881 | Ga0068865_100008093 | Ga0068865_1000080933 | 118 |
| 169 | 3300006881 | Ga0068865_100532790 | Ga0068865_1005327902 | 118 |
| 170 | 3300006881 | Ga0068865_100553504 | Ga0068865_1005535042 | 118 |
| 171 | 3300006931 | Ga0097620_100090930 | Ga0097620_1000909302 | 118 |
| 172 | 3300006931 | Ga0097620_101291271 | Ga0097620_1012912712 | 118 |
| 173 | 3300009093 | Ga0105240_10004564 | Ga0105240_100045644 | 118 |
| 174 | 3300009093 | Ga0105240_10853739 | Ga0105240_108537391 | 118 |
| 175 | 3300009093 | Ga0105240_10963161 | Ga0105240_109631612 | 118 |
| 176 | 3300009093 | Ga0105240_11684142 | Ga0105240_116841421 | 118 |
| 177 | 3300009094 | Ga0111539_10002652 | Ga0111539_100026523 | 118 |
| 178 | 3300009094 | Ga0111539_10224069 | Ga0111539_102240692 | 118 |
| 179 | 3300009094 | Ga0111539_10406722 | Ga0111539_104067222 | 118 |
| 180 | 3300009094 | Ga0111539_10734228 | Ga0111539_107342282 | 118 |
| 181 | 3300009098 | Ga0105245_10042425 | Ga0105245_100424252 | 118 |
| 182 | 3300009098 | Ga0105245_10059001 | Ga0105245_100590014 | 118 |
| 183 | 3300009098 | Ga0105245_10652719 | Ga0105245_106527192 | 118 |
| 184 | 3300009101 | Ga0105247_11244134 | Ga0105247_112441341 | 118 |
| 185 | 3300009147 | Ga0114129_11389672 | Ga0114129_113896722 | 118 |
| 186 | 3300009148 | Ga0105243_10133382 | Ga0105243_101333823 | 118 |
| 187 | 3300009148 | Ga0105243_10385516 | Ga0105243_103855162 | 118 |
| 188 | 3300009148 | Ga0105243_11220768 | Ga0105243_112207682 | 118 |
| 189 | 3300009174 | Ga0105241_11940560 | Ga0105241_119405601 | 118 |
| 190 | 3300009176 | Ga0105242_10592373 | Ga0105242_105923732 | 118 |
| 191 | 3300009177 | Ga0105248_10091698 | Ga0105248_100916982 | 118 |
| 192 | 3300009545 | Ga0105237_10423417 | Ga0105237_104234173 | 118 |
| 193 | 3300009545 | Ga0105237_11558299 | Ga0105237_115582991 | 118 |
| 194 | 3300009551 | Ga0105238_10022903 | Ga0105238_100229036 | 118 |
| 195 | 3300009551 | Ga0105238_10417392 | Ga0105238_104173922 | 118 |
| 196 | 3300009551 | Ga0105238_11077875 | Ga0105238_110778752 | 118 |
| 197 | 3300010375 | Ga0105239_10530738 | Ga0105239_105307382 | 118 |
| 198 | 3300013105 | Ga0157369_10000349 | Ga0157369_1000034916 | 118 |
| 199 | 3300013105 | Ga0157369_11040001 | Ga0157369_110400012 | 118 |
| 200 | 3300013296 | Ga0157374_10091399 | Ga0157374_100913993 | 118 |
| 201 | 3300013297 | Ga0157378_10024945 | Ga0157378_100249453 | 118 |
| 202 | 3300013297 | Ga0157378_10464938 | Ga0157378_104649382 | 118 |
| 203 | 3300013306 | Ga0163162_10082280 | Ga0163162_100822804 | 118 |
| 204 | 3300013306 | Ga0163162_11203905 | Ga0163162_112039052 | 118 |
| 205 | 3300013307 | Ga0157372_10006727 | Ga0157372_100067277 | 118 |
| 206 | 3300013308 | Ga0157375_10265407 | Ga0157375_102654072 | 118 |
| 207 | 3300013308 | Ga0157375_10829115 | Ga0157375_108291152 | 118 |
| 208 | 3300013308 | Ga0157375_12025647 | Ga0157375_120256472 | 118 |
| 209 | 3300013308 | Ga0157375_13373738 | Ga0157375_133737381 | 118 |
| 210 | 3300013308 | Ga0157375_13571319 | Ga0157375_135713191 | 118 |
| 211 | 3300014325 | Ga0163163_10225064 | Ga0163163_102250643 | 118 |
| 212 | 3300014326 | Ga0157380_10543341 | Ga0157380_105433412 | 118 |
| 213 | 3300014326 | Ga0157380_10635255 | Ga0157380_106352552 | 118 |
| 214 | 3300014326 | Ga0157380_11046732 | Ga0157380_110467322 | 118 |
| 215 | 3300014326 | Ga0157380_12763270 | Ga0157380_127632702 | 118 |
| 216 | 3300014968 | Ga0157379_10002758 | Ga0157379_1000275812 | 118 |
| 217 | 3300014968 | Ga0157379_10144347 | Ga0157379_101443472 | 118 |
| 218 | 3300014969 | Ga0157376_10081887 | Ga0157376_100818875 | 118 |
| 219 | 3300014969 | Ga0157376_11836956 | Ga0157376_118369562 | 118 |
| 220 | 3300017792 | Ga0163161_10139463 | Ga0163161_101394632 | 118 |
| 221 | 3300017792 | Ga0163161_11195488 | Ga0163161_111954882 | 118 |
| 222 | 3300021377 | Ga0213874_10062254 | Ga0213874_100622542 | 118 |
| 223 | 3300021388 | Ga0213875_10194698 | Ga0213875_101946982 | 118 |
| 224 | 3300025290 | Ga0207673_1012200 | Ga0207673_10122003 | 118 |
| 225 | 3300025321 | Ga0207656_10002335 | Ga0207656_100023353 | 118 |
| 226 | 3300025321 | Ga0207656_10035316 | Ga0207656_100353163 | 118 |
| 227 | 3300025321 | Ga0207656_10566617 | Ga0207656_105666171 | 118 |
| 228 | 3300025885 | Ga0207653_10255785 | Ga0207653_102557852 | 118 |
| 229 | 3300025893 | Ga0207682_10004221 | Ga0207682_100042216 | 118 |
| 230 | 3300025898 | Ga0207692_10653771 | Ga0207692_106537712 | 118 |
| 231 | 3300025901 | Ga0207688_10041948 | Ga0207688_100419482 | 118 |
| 232 | 3300025901 | Ga0207688_10078230 | Ga0207688_100782302 | 118 |
| 233 | 3300025901 | Ga0207688_10313994 | Ga0207688_103139942 | 118 |
| 234 | 3300025903 | Ga0207680_10065193 | Ga0207680_100651932 | 118 |
| 235 | 3300025906 | Ga0207699_10085530 | Ga0207699_100855303 | 118 |
| 236 | 3300025907 | Ga0207645_10142794 | Ga0207645_101427942 | 118 |
| 237 | 3300025908 | Ga0207643_10000682 | Ga0207643_100006825 | 118 |
| 238 | 3300025909 | Ga0207705_10019349 | Ga0207705_100193494 | 118 |
| 239 | 3300025909 | Ga0207705_10061629 | Ga0207705_100616293 | 118 |
| 240 | 3300025910 | Ga0207684_11334355 | Ga0207684_113343552 | 118 |
| 241 | 3300025912 | Ga0207707_10003106 | Ga0207707_100031062 | 118 |
| 242 | 3300025912 | Ga0207707_10041225 | Ga0207707_100412252 | 118 |
| 243 | 3300025913 | Ga0207695_10347870 | Ga0207695_103478702 | 118 |
| 244 | 3300025914 | Ga0207671_10365337 | Ga0207671_103653373 | 118 |
| 245 | 3300025915 | Ga0207693_10007023 | Ga0207693_100070234 | 118 |
| 246 | 3300025916 | Ga0207663_10008656 | Ga0207663_100086564 | 118 |
| 247 | 3300025917 | Ga0207660_10060992 | Ga0207660_100609923 | 118 |
| 248 | 3300025917 | Ga0207660_10144000 | Ga0207660_101440003 | 118 |
| 249 | 3300025918 | Ga0207662_10123418 | Ga0207662_101234182 | 118 |
| 250 | 3300025919 | Ga0207657_10118861 | Ga0207657_101188613 | 118 |
| 251 | 3300025920 | Ga0207649_10231208 | Ga0207649_102312083 | 118 |
| 252 | 3300025920 | Ga0207649_10236024 | Ga0207649_102360242 | 118 |
| 253 | 3300025920 | Ga0207649_10346601 | Ga0207649_103466012 | 118 |
| 254 | 3300025921 | Ga0207652_10102555 | Ga0207652_101025553 | 118 |
| 255 | 3300025921 | Ga0207652_10225334 | Ga0207652_102253342 | 118 |
| 256 | 3300025921 | Ga0207652_10585365 | Ga0207652_105853652 | 118 |
| 257 | 3300025921 | Ga0207652_11624798 | Ga0207652_116247981 | 118 |
| 258 | 3300025923 | Ga0207681_10056525 | Ga0207681_100565253 | 118 |
| 259 | 3300025924 | Ga0207694_10290970 | Ga0207694_102909702 | 118 |
| 260 | 3300025925 | Ga0207650_10000503 | Ga0207650_1000050331 | 118 |
| 261 | 3300025925 | Ga0207650_10043652 | Ga0207650_100436524 | 118 |
| 262 | 3300025925 | Ga0207650_10379669 | Ga0207650_103796692 | 118 |
| 263 | 3300025925 | Ga0207650_11107143 | Ga0207650_111071432 | 118 |
| 264 | 3300025926 | Ga0207659_10003703 | Ga0207659_100037033 | 118 |
| 265 | 3300025926 | Ga0207659_10010298 | Ga0207659_100102982 | 118 |
| 266 | 3300025926 | Ga0207659_10127163 | Ga0207659_101271632 | 118 |
| 267 | 3300025926 | Ga0207659_10354724 | Ga0207659_103547241 | 118 |
| 268 | 3300025927 | Ga0207687_10238079 | Ga0207687_102380792 | 118 |
| 269 | 3300025927 | Ga0207687_10498400 | Ga0207687_104984002 | 118 |
| 270 | 3300025928 | Ga0207700_10031558 | Ga0207700_100315585 | 118 |
| 271 | 3300025928 | Ga0207700_10064311 | Ga0207700_100643112 | 118 |
| 272 | 3300025928 | Ga0207700_10271559 | Ga0207700_102715593 | 118 |
| 273 | 3300025928 | Ga0207700_10437676 | Ga0207700_104376762 | 118 |
| 274 | 3300025928 | Ga0207700_10483911 | Ga0207700_104839112 | 118 |
| 275 | 3300025929 | Ga0207664_10026705 | Ga0207664_100267052 | 118 |
| 276 | 3300025929 | Ga0207664_10296440 | Ga0207664_102964402 | 118 |
| 277 | 3300025931 | Ga0207644_10014234 | Ga0207644_100142343 | 118 |
| 278 | 3300025931 | Ga0207644_10476984 | Ga0207644_104769843 | 118 |
| 279 | 3300025932 | Ga0207690_10029406 | Ga0207690_100294063 | 118 |
| 280 | 3300025932 | Ga0207690_10107326 | Ga0207690_101073262 | 118 |
| 281 | 3300025933 | Ga0207706_10003306 | Ga0207706_100033063 | 118 |
| 282 | 3300025933 | Ga0207706_10289713 | Ga0207706_102897132 | 118 |
| 283 | 3300025933 | Ga0207706_10346374 | Ga0207706_103463743 | 118 |
| 284 | 3300025934 | Ga0207686_10321612 | Ga0207686_103216122 | 118 |
| 285 | 3300025935 | Ga0207709_10121576 | Ga0207709_101215763 | 118 |
| 286 | 3300025935 | Ga0207709_10326083 | Ga0207709_103260832 | 118 |
| 287 | 3300025936 | Ga0207670_10180538 | Ga0207670_101805383 | 118 |
| 288 | 3300025936 | Ga0207670_10344830 | Ga0207670_103448302 | 118 |
| 289 | 3300025938 | Ga0207704_10352971 | Ga0207704_103529712 | 118 |
| 290 | 3300025938 | Ga0207704_10503153 | Ga0207704_105031532 | 118 |
| 291 | 3300025938 | Ga0207704_10781929 | Ga0207704_107819292 | 118 |
| 292 | 3300025938 | Ga0207704_11961866 | Ga0207704_119618661 | 118 |
| 293 | 3300025940 | Ga0207691_10063492 | Ga0207691_100634922 | 118 |
| 294 | 3300025940 | Ga0207691_10177110 | Ga0207691_101771103 | 118 |
| 295 | 3300025940 | Ga0207691_10352511 | Ga0207691_103525112 | 118 |
| 296 | 3300025942 | Ga0207689_10056136 | Ga0207689_100561363 | 118 |
| 297 | 3300025944 | Ga0207661_10044841 | Ga0207661_100448414 | 118 |
| 298 | 3300025944 | Ga0207661_11256791 | Ga0207661_112567912 | 118 |
| 299 | 3300025944 | Ga0207661_11499663 | Ga0207661_114996632 | 118 |
| 300 | 3300025949 | Ga0207667_10069772 | Ga0207667_100697723 | 118 |
| 301 | 3300025949 | Ga0207667_10133910 | Ga0207667_101339102 | 118 |
| 302 | 3300025960 | Ga0207651_10209677 | Ga0207651_102096772 | 118 |
| 303 | 3300025960 | Ga0207651_10230251 | Ga0207651_102302513 | 118 |
| 304 | 3300025972 | Ga0207668_10649565 | Ga0207668_106495651 | 118 |
| 305 | 3300025972 | Ga0207668_10786748 | Ga0207668_107867481 | 118 |
| 306 | 3300025972 | Ga0207668_11825129 | Ga0207668_118251291 | 118 |
| 307 | 3300025981 | Ga0207640_10167566 | Ga0207640_101675662 | 118 |
| 308 | 3300025986 | Ga0207658_10522874 | Ga0207658_105228741 | 118 |
| 309 | 3300026023 | Ga0207677_10187143 | Ga0207677_101871432 | 118 |
| 310 | 3300026035 | Ga0207703_10023215 | Ga0207703_100232155 | 118 |
| 311 | 3300026067 | Ga0207678_10018252 | Ga0207678_100182521 | 118 |
| 312 | 3300026067 | Ga0207678_10273128 | Ga0207678_102731283 | 118 |
| 313 | 3300026075 | Ga0207708_10759885 | Ga0207708_107598852 | 118 |
| 314 | 3300026078 | Ga0207702_10455605 | Ga0207702_104556052 | 118 |
| 315 | 3300026088 | Ga0207641_10031886 | Ga0207641_100318863 | 118 |
| 316 | 3300026088 | Ga0207641_11291989 | Ga0207641_112919892 | 118 |
| 317 | 3300026089 | Ga0207648_10001351 | Ga0207648_1000135120 | 118 |
| 318 | 3300026089 | Ga0207648_10363789 | Ga0207648_103637892 | 118 |
| 319 | 3300026095 | Ga0207676_10018991 | Ga0207676_100189916 | 118 |
| 320 | 3300026095 | Ga0207676_11711935 | Ga0207676_117119352 | 118 |
| 321 | 3300026118 | Ga0207675_100568465 | Ga0207675_1005684652 | 118 |
| 322 | 3300026121 | Ga0207683_10240784 | Ga0207683_102407843 | 118 |
| 323 | 3300026121 | Ga0207683_11152318 | Ga0207683_111523182 | 118 |
| 324 | 3300026142 | Ga0207698_10003142 | Ga0207698_100031427 | 118 |
| 325 | 3300026142 | Ga0207698_10003270 | Ga0207698_100032703 | 118 |
| 326 | 3300026142 | Ga0207698_10051317 | Ga0207698_100513174 | 118 |
| 327 | 3300026142 | Ga0207698_10104015 | Ga0207698_101040152 | 118 |
| 328 | 3300026142 | Ga0207698_10804725 | Ga0207698_108047252 | 118 |
| 329 | 3300027907 | Ga0207428_10037058 | Ga0207428_100370584 | 118 |
| 330 | 3300028379 | Ga0268266_10012719 | Ga0268266_100127193 | 118 |
| 331 | 3300028379 | Ga0268266_10078103 | Ga0268266_100781036 | 118 |
| 332 | 3300028379 | Ga0268266_10581415 | Ga0268266_105814152 | 118 |
| 333 | 3300028379 | Ga0268266_11195274 | Ga0268266_111952742 | 118 |
| 334 | 3300028380 | Ga0268265_10590433 | Ga0268265_105904332 | 118 |
| 335 | 3300028380 | Ga0268265_12179760 | Ga0268265_121797601 | 118 |
| 336 | 3300028381 | Ga0268264_11129989 | Ga0268264_111299892 | 118 |
| 337 | 3300031240 | Ga0265320_10006897 | Ga0265320_100068977 | 118 |
| 338 | 3300031548 | Ga0307408_100100499 | Ga0307408_1001004992 | 118 |
| 339 | 3300031595 | Ga0265313_10079766 | Ga0265313_100797663 | 118 |
| 340 | 3300031731 | Ga0307405_11724818 | Ga0307405_117248181 | 118 |
| 341 | 3300031824 | Ga0307413_10882083 | Ga0307413_108820832 | 118 |
| 342 | 3300031852 | Ga0307410_10346464 | Ga0307410_103464642 | 118 |
| 343 | 3300031852 | Ga0307410_11498601 | Ga0307410_114986012 | 118 |
| 344 | 3300031901 | Ga0307406_10465755 | Ga0307406_104657552 | 118 |
| 345 | 3300031911 | Ga0307412_10342486 | Ga0307412_103424862 | 118 |
| 346 | 3300031911 | Ga0307412_10485339 | Ga0307412_104853392 | 118 |
| 347 | 3300031995 | Ga0307409_100729750 | Ga0307409_1007297502 | 118 |
| 348 | 3300031995 | Ga0307409_101776628 | Ga0307409_1017766282 | 118 |
| 349 | 3300032002 | Ga0307416_100351814 | Ga0307416_1003518142 | 118 |
| 350 | 3300032002 | Ga0307416_101247756 | Ga0307416_1012477562 | 118 |
| 351 | 3300032126 | Ga0307415_100802856 | Ga0307415_1008028562 | 118 |
| 352 | 3300034820 | Ga0373959_0104398 | Ga0373959_0104398_57_461 | 118 |
| 353 | 3300035083 | Ga0373926_0045799 | Ga0373926_0045799_378_758 | 118 |
| 354 | 3300035086 | Ga0373934_0000150 | Ga0373934_0000150_1712_2116 | 118 |
| 355 | 3300035086 | Ga0373934_0012965 | Ga0373934_0012965_2511_2915 | 118 |
| 356 | 3300035088 | Ga0373940_0079129 | Ga0373940_0079129_547_951 | 118 |
| 357 | 3300035090 | Ga0373949_0042919 | Ga0373949_0042919_586_990 | 118 |
| 358 | 3300035111 | Ga0373923_0013544 | Ga0373923_0013544_1824_2228 | 118 |
| 359 | 3300035111 | Ga0373923_0155415 | Ga0373923_0155415_414_818 | 118 |
| 360 | 3300035114 | Ga0373939_0455078 | Ga0373939_0455078_48_452 | 118 |
| 361 | 3300035115 | Ga0373941_0025182 | Ga0373941_0025182_306_710 | 118 |
| 362 | 3300035115 | Ga0373941_0444747 | Ga0373941_0444747_89_493 | 118 |
| 363 | 3300035116 | Ga0373945_0514972 | Ga0373945_0514972_25_420 | 118 |
| 364 | 3300035117 | Ga0373953_0050933 | Ga0373953_0050933_504_908 | 118 |
| 365 | 3300035118 | Ga0373954_0025781 | Ga0373954_0025781_954_1358 | 118 |
| 366 | 3300035119 | Ga0373956_0000118 | Ga0373956_0000118_23189_23593 | 118 |
| 367 | 3300035119 | Ga0373956_0034133 | Ga0373956_0034133_1247_1651 | 118 |
| 368 | 3300035119 | Ga0373956_0355266 | Ga0373956_0355266_169_573 | 118 |
| 369 | 3300035120 | Ga0373957_0035241 | Ga0373957_0035241_746_1150 | 118 |
| 370 | 3300035120 | Ga0373957_0057611 | Ga0373957_0057611_567_971 | 118 |
| 371 | 3300035121 | Ga0373960_0023150 | Ga0373960_0023150_1006_1410 | 118 |
| 372 | 3300035121 | Ga0373960_0086634 | Ga0373960_0086634_122_550 | 118 |
| 373 | 3300035171 | Ga0373946_0505059 | Ga0373946_0505059_34_429 | 118 |
| 374 | 3300035171 | Ga0373946_0600045 | Ga0373946_0600045_172_552 | 118 |
| 375 | 3300035172 | Ga0373955_0000871 | Ga0373955_0000871_2232_2636 | 118 |
| 376 | 3300035172 | Ga0373955_0060164 | Ga0373955_0060164_678_1082 | 118 |
| 377 | 3300035241 | Ga0373961_0362079 | Ga0373961_0362079_118_522 | 118 |
| 378 | 3300035242 | Ga0373962_0035723 | Ga0373962_0035723_637_1041 | 118 |
| 379 | 3300035410 | Ga0373924_0002351 | Ga0373924_0002351_2981_3385 | 118 |
| 380 | 3300035410 | Ga0373924_0043242 | Ga0373924_0043242_1068_1472 | 118 |
| 381 | 3300035410 | Ga0373924_0072149 | Ga0373924_0072149_120_524 | 118 |
| 382 | 3300035410 | Ga0373924_0093648 | Ga0373924_0093648_496_876 | 118 |
| 383 | 3300035691 | Ga0373931_0077484 | Ga0373931_0077484_1287_1691 | 118 |
| 384 | 3300035692 | Ga0373935_0568399 | Ga0373935_0568399_260_664 | 118 |
| 385 | 3300035695 | Ga0373927_0112254 | Ga0373927_0112254_1171_1551 | 118 |
| 386 | 3300035695 | Ga0373927_0197813 | Ga0373927_0197813_48_452 | 118 |
| 387 | 3300035695 | Ga0373927_0219637 | Ga0373927_0219637_559_963 | 118 |
| 388 | 3300035695 | Ga0373927_0461115 | Ga0373927_0461115_416_820 | 118 |
| 389 | 3300035724 | Ga0373933_0000264 | Ga0373933_0000264_13969_14373 | 118 |
| 390 | 3300035724 | Ga0373933_0022468 | Ga0373933_0022468_490_894 | 118 |
| 391 | 3300035724 | Ga0373933_0289497 | Ga0373933_0289497_475_879 | 118 |
| 392 | 3300035725 | Ga0373947_0025083 | Ga0373947_0025083_2193_2573 | 118 |
| 393 | 3300035725 | Ga0373947_0091689 | Ga0373947_0091689_856_1260 | 118 |
| 394 | 3300035725 | Ga0373947_0124264 | Ga0373947_0124264_145_549 | 118 |
| 395 | 3300035725 | Ga0373947_0623228 | Ga0373947_0623228_66_461 | 118 |
| 396 | 3300036401 | Ga0373937_0000187 | Ga0373937_0000187_57222_57626 | 118 |
| 397 | 3300036401 | Ga0373937_0007297 | Ga0373937_0007297_5463_5867 | 118 |
| 398 | 3300036401 | Ga0373937_0106260 | Ga0373937_0106260_2120_2524 | 118 |
| 399 | 3300036401 | Ga0373937_0116544 | Ga0373937_0116544_2085_2465 | 118 |
| 400 | 3300037068 | Ga0373925_0059884 | Ga0373925_0059884_1645_2025 | 118 |
| 401 | 3300037068 | Ga0373925_0131753 | Ga0373925_0131753_70_474 | 118 |
| 402 | 3300037068 | Ga0373925_0172968 | Ga0373925_0172968_597_1007 | 118 |
| 403 | 3300037068 | Ga0373925_1134383 | Ga0373925_1134383_82_486 | 118 |
| 404 | 3300037312 | Ga0395899_0402143 | Ga0395899_0402143_168_554 | 118 |
| 405 | 3300037471 | Ga0395905_0859089 | Ga0395905_0859089_294_680 | 118 |
| 406 | 3300037853 | Ga0436364_0438451 | Ga0436364_0438451_240_644 | 118 |
| 407 | 3300038443 | Ga0395901_1084037 | Ga0395901_1084037_365_751 | 118 |
| 408 | 3300039437 | Ga0436365_1629968 | Ga0436365_1629968_53_457 | 118 |
| 409 | 3300039450 | Ga0436363_1218882 | Ga0436363_1218882_1550_1957 | 118 |
| 410 | 3300041406 | Ga0439439_0007000 | Ga0439439_0007000_1769_2173 | 118 |
| 411 | 3300042436 | Ga0439435_0031011 | Ga0439435_0031011_714_1118 | 118 |
| 412 | 3300042876 | Ga0451577_0006157 | Ga0451577_0006157_6223_6627 | 118 |
| 413 | 3300044658 | Ga0466972_0003193 | Ga0466972_0003193_7307_7723 | 118 |
| 414 | 3300044694 | Ga0466963_0415644 | Ga0466963_0415644_182_613 | 118 |
| 415 | 3300044712 | Ga0453684_0049328 | Ga0453684_0049328_292_696 | 118 |
| 416 | 3300045051 | Ga0451576_0003736 | Ga0451576_0003736_17405_17809 | 118 |
| 417 | 3300046454 | Ga0495592_0002947 | Ga0495592_0002947_1485_1889 | 118 |
| 418 | 3300046454 | Ga0495592_0223721 | Ga0495592_0223721_834_1238 | 118 |
| 419 | 3300046455 | Ga0495603_0356354 | Ga0495603_0356354_27_431 | 118 |
| 420 | 3300046459 | Ga0495629_0097869 | Ga0495629_0097869_226_630 | 118 |
| 421 | 3300046459 | Ga0495629_0244965 | Ga0495629_0244965_208_618 | 118 |
| 422 | 3300046459 | Ga0495629_0744311 | Ga0495629_0744311_10_390 | 118 |
| 423 | 3300046462 | Ga0495651_0000909 | Ga0495651_0000909_2346_2750 | 118 |
| 424 | 3300046462 | Ga0495651_0008040 | Ga0495651_0008040_4475_4879 | 118 |
| 425 | 3300046462 | Ga0495651_0459613 | Ga0495651_0459613_18_422 | 118 |
| 426 | 3300046463 | Ga0495653_0000455 | Ga0495653_0000455_22118_22522 | 118 |
| 427 | 3300046472 | Ga0495580_0479839 | Ga0495580_0479839_310_714 | 118 |
| 428 | 3300046472 | Ga0495580_0520146 | Ga0495580_0520146_12_392 | 118 |
| 429 | 3300046476 | Ga0495662_0188540 | Ga0495662_0188540_91_495 | 118 |
| 430 | 3300046499 | Ga0495594_0408021 | Ga0495594_0408021_207_611 | 118 |
| 431 | 3300046507 | Ga0495606_0000011 | Ga0495606_0000011_50362_50796 | 118 |
| 432 | 3300046511 | Ga0495608_0000235 | Ga0495608_0000235_2897_3301 | 118 |
| 433 | 3300046514 | Ga0495618_0094389 | Ga0495618_0094389_1363_1767 | 118 |
| 434 | 3300046516 | Ga0495628_0000373 | Ga0495628_0000373_38821_39225 | 118 |
| 435 | 3300046517 | Ga0495630_0000265 | Ga0495630_0000265_12068_12472 | 118 |
| 436 | 3300046528 | Ga0495642_0072187 | Ga0495642_0072187_405_809 | 118 |
| 437 | 3300046528 | Ga0495642_0141607 | Ga0495642_0141607_447_842 | 118 |
| 438 | 3300046529 | Ga0495652_0000781 | Ga0495652_0000781_2979_3383 | 118 |
| 439 | 3300046529 | Ga0495652_0439526 | Ga0495652_0439526_311_715 | 118 |
| 440 | 3300046531 | Ga0495665_0280145 | Ga0495665_0280145_71_475 | 118 |
| 441 | 3300046535 | Ga0495586_0084442 | Ga0495586_0084442_210_614 | 118 |
| 442 | 3300046536 | Ga0495587_0000650 | Ga0495587_0000650_21556_21960 | 118 |
| 443 | 3300046536 | Ga0495587_0047953 | Ga0495587_0047953_618_1022 | 118 |
| 444 | 3300046537 | Ga0495598_0050348 | Ga0495598_0050348_736_1152 | 118 |
| 445 | 3300046539 | Ga0495621_0338196 | Ga0495621_0338196_228_617 | 118 |
| 446 | 3300046543 | Ga0495645_0000654 | Ga0495645_0000654_21624_22028 | 118 |
| 447 | 3300046559 | Ga0495667_0001539 | Ga0495667_0001539_13019_13423 | 118 |
| 448 | 3300046615 | Ga0495656_0537272 | Ga0495656_0537272_198_602 | 118 |
| 449 | 3300046616 | Ga0495668_0485086 | Ga0495668_0485086_92_508 | 118 |
| 450 | 3300046642 | Ga0495634_0073353 | Ga0495634_0073353_1590_1994 | 118 |
| 451 | 3300046663 | Ga0495635_0000129 | Ga0495635_0000129_9430_9834 | 118 |
| 452 | 3300046663 | Ga0495635_0330528 | Ga0495635_0330528_102_506 | 118 |
| 453 | 3300046663 | Ga0495635_0584708 | Ga0495635_0584708_273_677 | 118 |
| 454 | 3300046675 | Ga0495657_0000184 | Ga0495657_0000184_20199_20603 | 118 |
| 455 | 3300046678 | Ga0495599_0001198 | Ga0495599_0001198_11362_11766 | 118 |
| 456 | 3300046678 | Ga0495599_0050607 | Ga0495599_0050607_2098_2502 | 118 |
| 457 | 3300046678 | Ga0495599_0722030 | Ga0495599_0722030_107_529 | 118 |
| 458 | 3300046679 | Ga0495623_0000213 | Ga0495623_0000213_16582_16986 | 118 |
| 459 | 3300046680 | Ga0495646_0000096 | Ga0495646_0000096_22968_23372 | 118 |
| 460 | 3300046683 | Ga0495658_0810989 | Ga0495658_0810989_166_561 | 118 |
| 461 | 3300046689 | Ga0495613_0032268 | Ga0495613_0032268_547_951 | 118 |
| 462 | 3300046689 | Ga0495613_0260676 | Ga0495613_0260676_442_846 | 118 |
| 463 | 3300046690 | Ga0495624_0959969 | Ga0495624_0959969_17_421 | 118 |
| 464 | 3300046691 | Ga0495670_0126458 | Ga0495670_0126458_303_707 | 118 |
| 465 | 3300046809 | Ga0495600_0000374 | Ga0495600_0000374_884_1288 | 118 |
| 466 | 3300046809 | Ga0495600_0541914 | Ga0495600_0541914_178_582 | 118 |
| 467 | 3300047315 | Ga0495581_0166109 | Ga0495581_0166109_419_823 | 118 |
| 468 | 3300047317 | Ga0495604_0000480 | Ga0495604_0000480_3644_4048 | 118 |
| 469 | 3300047319 | Ga0495674_0012522 | Ga0495674_0012522_2479_2883 | 118 |
| 470 | 3300047319 | Ga0495674_0253359 | Ga0495674_0253359_241_645 | 118 |
| 471 | 3300047320 | Ga0495672_0377078 | Ga0495672_0377078_11_415 | 118 |
| 472 | 3300047322 | Ga0495680_0006860 | Ga0495680_0006860_7097_7501 | 118 |
| 473 | 3300047444 | Ga0495675_0010372 | Ga0495675_0010372_2566_2970 | 118 |
| 474 | 3300047471 | Ga0495684_0000108 | Ga0495684_0000108_21966_22370 | 118 |
| 475 | 3300047471 | Ga0495684_0042153 | Ga0495684_0042153_1488_1868 | 118 |
| 476 | 3300047471 | Ga0495684_0654223 | Ga0495684_0654223_39_443 | 118 |
| 477 | 3300048088 | Ga0495602_0000954 | Ga0495602_0000954_2895_3299 | 118 |
| 478 | 3300048090 | Ga0495615_0126474 | Ga0495615_0126474_101_517 | 118 |
| 479 | 3300048903 | Ga0496100_0015213 | Ga0496100_0015213_2552_2947 | 118 |
| 480 | 3300048904 | Ga0496101_0026654 | Ga0496101_0026654_3559_3954 | 118 |
| 481 | 3300048904 | Ga0496101_0099785 | Ga0496101_0099785_393_809 | 118 |
| 482 | 3300048905 | Ga0496102_0011374 | Ga0496102_0011374_2504_2908 | 118 |
| 483 | 3300048905 | Ga0496102_0012907 | Ga0496102_0012907_5580_5996 | 118 |
| 484 | 3300048905 | Ga0496102_0163971 | Ga0496102_0163971_168_563 | 118 |
| 485 | 3300048905 | Ga0496102_1002217 | Ga0496102_1002217_88_504 | 118 |
| 486 | 3300048907 | Ga0496104_0004348 | Ga0496104_0004348_8633_9028 | 118 |
| 487 | 3300048907 | Ga0496104_0078991 | Ga0496104_0078991_997_1413 | 118 |
| 488 | 3300048908 | Ga0496105_0010792 | Ga0496105_0010792_1361_1786 | 118 |
| 489 | 3300048908 | Ga0496105_0055169 | Ga0496105_0055169_535_930 | 118 |
| 490 | 3300048908 | Ga0496105_0726516 | Ga0496105_0726516_104_487 | 118 |
| 491 | 3300048909 | Ga0496106_0118617 | Ga0496106_0118617_1039_1434 | 118 |
| 492 | 3300048910 | Ga0496107_0018151 | Ga0496107_0018151_1863_2258 | 118 |
| 493 | 3300048910 | Ga0496107_0535370 | Ga0496107_0535370_92_502 | 118 |
| 494 | 3300048911 | Ga0496108_0016356 | Ga0496108_0016356_5601_5996 | 118 |
| 495 | 3300048911 | Ga0496108_0116999 | Ga0496108_0116999_305_721 | 118 |
| 496 | 3300048911 | Ga0496108_0730901 | Ga0496108_0730901_118_543 | 118 |
| 497 | 3300048911 | Ga0496108_1175767 | Ga0496108_1175767_166_582 | 118 |
| 498 | 3300048912 | Ga0496109_0013720 | Ga0496109_0013720_4891_5286 | 118 |
| 499 | 3300048912 | Ga0496109_0077392 | Ga0496109_0077392_2164_2580 | 118 |
| 500 | 3300048912 | Ga0496109_0253331 | Ga0496109_0253331_55_456 | 118 |
| 501 | 3300048913 | Ga0496110_0045502 | Ga0496110_0045502_1114_1539 | 118 |
| 502 | 3300048913 | Ga0496110_0050375 | Ga0496110_0050375_1973_2368 | 118 |
| 503 | 3300048914 | Ga0496111_0054522 | Ga0496111_0054522_1103_1519 | 118 |
| 504 | 3300048914 | Ga0496111_0453205 | Ga0496111_0453205_223_648 | 118 |
| 505 | 3300048917 | Ga0496114_0038019 | Ga0496114_0038019_2597_2998 | 118 |
| 506 | 3300048917 | Ga0496114_0076107 | Ga0496114_0076107_1523_1939 | 118 |
| 507 | 3300048917 | Ga0496114_0122792 | Ga0496114_0122792_1589_1984 | 118 |
| 508 | 3300048929 | Ga0496126_0380724 | Ga0496126_0380724_366_773 | 118 |
| 509 | 3300049578 | Ga0501042_1302057 | Ga0501042_1302057_18_410 | 118 |
| 510 | 3300049661 | Ga0501217_183097 | Ga0501217_183097_162_590 | 118 |
| 511 | 3300049686 | Ga0501257_180191 | Ga0501257_180191_142_558 | 118 |
| 512 | 3300049741 | Ga0501079_0576318 | Ga0501079_0576318_83_499 | 118 |
| 513 | 3300049824 | Ga0501045_0880190 | Ga0501045_0880190_97_513 | 118 |
| 514 | 3300050491 | nmdc:mga00v17_209779_c1 | nmdc:mga00v17_209779_c1_145_567 | 118 |
| 515 | 3300050493 | nmdc:mga0k408_94915_c1 | nmdc:mga0k408_94915_c1_580_1002 | 118 |
| 516 | 3300050494 | nmdc:mga06z11_546148_c1 | nmdc:mga06z11_546148_c1_154_576 | 118 |
| 517 | 3300050509 | nmdc:mga0qj67_1103121_c1 | nmdc:mga0qj67_1103121_c1_203_607 | 118 |
| 518 | 3300050509 | nmdc:mga0qj67_166967_c1 | nmdc:mga0qj67_166967_c1_1366_1770 | 118 |
| 519 | 3300050510 | nmdc:mga06r32_27835_c1 | nmdc:mga06r32_27835_c1_1919_2323 | 118 |
| 520 | 3300050511 | nmdc:mga08y16_397104_c1 | nmdc:mga08y16_397104_c1_420_815 | 118 |
| 521 | 3300050511 | nmdc:mga08y16_54111_c1 | nmdc:mga08y16_54111_c1_2189_2593 | 118 |
| 522 | 3300050512 | nmdc:mga0n895_168573_c1 | nmdc:mga0n895_168573_c1_237_641 | 118 |
| 523 | 3300050515 | nmdc:mga0a205_225817_c1 | nmdc:mga0a205_225817_c1_1209_1613 | 118 |
| 524 | 3300053077 | Ga0495601_0064853 | Ga0495601_0064853_661_1065 | 118 |
| 525 | 3300053077 | Ga0495601_0072050 | Ga0495601_0072050_1000_1404 | 118 |
| 526 | 3300053078 | Ga0495612_0000510 | Ga0495612_0000510_2919_3323 | 118 |
| 527 | 3300053084 | Ga0495595_0003934 | Ga0495595_0003934_1811_2215 | 118 |
| 528 | 3300053084 | Ga0495595_0149704 | Ga0495595_0149704_561_965 | 118 |
| 529 | 3300053085 | Ga0495619_0005821 | Ga0495619_0005821_2921_3325 | 118 |
| 530 | 3300053085 | Ga0495619_0548832 | Ga0495619_0548832_347_778 | 118 |
| 531 | 3300053096 | Ga0500641_0008209 | Ga0500641_0008209_1820_2239 | 118 |
| 532 | 3300059421 | Ga0590071_000915 | Ga0590071_000915_4951_5376 | 118 |
| 533 | 3300059423 | Ga0590074_000991 | Ga0590074_000991_424_849 | 118 |
| 534 | 3300059424 | Ga0590075_006259 | Ga0590075_006259_426_851 | 118 |
| 535 | 3300059426 | Ga0590077_002195 | Ga0590077_002195_3080_3505 | 118 |
| 536 | iso_pu_bacteria | 2643221603 | 2644031629 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8498 | 1 | 116 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8301 | 1 | 116 |
| 1th8-assembly1.cif.gz_A-2 | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.7996 | 1 | 116 |
| 6m36-assembly2.cif.gz_I | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.7939 | 1 | 118 |
| 6m36-assembly2.cif.gz_O | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.7923 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.825 | 1 | 116 | 3.30.565.10 |
| af_Q4DBJ0_39_145_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8124 | 52 | 74 | 2.30.29.30 |
| 1tidC00 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.806 | 1 | 116 | 3.30.565.10 |
| af_Q2FWJ3_5_155_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7794 | 1 | 117 | 3.30.565.10 |
| af_Q5U2U3_71_143_2.20.140.10 | Mainly Beta;Single Sheet;q64v53_bacfr protein fold;WGR domain | 0.7787 | 51 | 68 | 2.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538PNY1-F1-model_v4 | Anti-sigma regulatory factor | 0.9857 | 2 | 118 |
|
| AF-A0A6H2D199-F1-model_v4 | Anti-sigma regulatory factor | 0.9832 | 1 | 118 |
|
| AF-A0A4V3T269-F1-model_v4 | ATP-binding protein | 0.9829 | 1 | 118 |
GO:0004674
GO:0005524 |
| AF-B9X9T7-F1-model_v4 | Putative anti-sigma regulatory factor, serine/threonine protein kinase | 0.9821 | 2 | 117 |
GO:0004674
|
| AF-A0A0U3L5K6-F1-model_v4 | Anti-sigma regulatory factor | 0.9815 | 1 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar