F460799

General Info

Members Datasets Scaffolds Average Seq Length
536 233 1072 211

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10138669|Ga0207665_101386692
Length 252
Sequence MEKFVLARRQNQHAGRVRYPAAHAPPELGAGLTMNERSFIFRPMSQPQPDPTLDRPAQILDAALVCFAQRGFHQTSMHDISAEAGISVGLIYRYFANKEAVISAMADRHKNEIQDVLERARQAPTLLESLEILFTAHCCENSPKLLSAFVVDLYAEASRNPQVANLVRDVLQTSMDGVTDLIARSPEGKNAAGGLTPNELSKLIFAVARGMLMRDVLQPQEMTEAERRTAQLEVVRRLWRLLFTNTMELAGV

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
179 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.13
Rhizosphere 86.94
Stem 0
Stem Tuber 0
Unclassified 36.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10138669 3300025939 Unclassified 1732
2 SwRhRL2b_contig_3097388 2162886007 Unclassified 1458
3 MBSR1b_contig_1964708 2162886012 Unclassified 1070
4 CNXas_1000187 3300000545 Bacteria 9494
5 CNXas_1000188 3300000545 Bacteria 9423
6 Ga0065704_10018623 3300005289 Unclassified 1757
7 Ga0065704_10093381 3300005289 Bacteria 2600
8 Ga0065712_10000501 3300005290 Bacteria 10883
9 Ga0065712_10094053 3300005290 Bacteria 2263
10 Ga0065715_10000456 3300005293 Bacteria 17468
11 Ga0065715_10036866 3300005293 Bacteria 1394
12 Ga0065715_10100065 3300005293 Bacteria 3340
13 Ga0065715_10286105 3300005293 Unclassified 1065
14 Ga0065715_10413516 3300005293 Unclassified 867
15 Ga0065707_10019113 3300005295 Unclassified 1583
16 Ga0070658_10442709 3300005327 Unclassified 1119
17 Ga0070676_10002455 3300005328 Bacteria 9494
18 Ga0070676_10022695 3300005328 Unclassified 3521
19 Ga0070676_10029041 3300005328 Bacteria 3143
20 Ga0070683_100016490 3300005329 Bacteria 6517
21 Ga0070683_100134024 3300005329 Bacteria 2345
22 Ga0070683_100250215 3300005329 Bacteria 1685
23 Ga0070690_100213761 3300005330 Bacteria 1348
24 Ga0070670_100134322 3300005331 Unclassified 2137
25 Ga0070670_100508782 3300005331 Unclassified 1071
26 Ga0070670_100669748 3300005331 Bacteria 932
27 Ga0070677_10126790 3300005333 Unclassified 1160
28 Ga0068869_100595796 3300005334 Bacteria 933
29 Ga0070666_10084241 3300005335 Bacteria 2176
30 Ga0070666_10405146 3300005335 Unclassified 981
31 Ga0068868_100018069 3300005338 Bacteria 5263
32 Ga0068868_100651395 3300005338 Unclassified 938
33 Ga0070660_100255921 3300005339 Bacteria 1429
34 Ga0070660_100579927 3300005339 Bacteria 937
35 Ga0070689_100002934 3300005340 Bacteria 11216
36 Ga0070689_100090373 3300005340 Bacteria 2413
37 Ga0070689_100209859 3300005340 Bacteria 1593
38 Ga0070689_100422775 3300005340 Unclassified 1130
39 Ga0070687_100001928 3300005343 Bacteria 7567
40 Ga0070661_100606903 3300005344 Bacteria 885
41 Ga0070668_100034121 3300005347 Bacteria 3877
42 Ga0070668_100139031 3300005347 Bacteria 1956
43 Ga0070668_100497613 3300005347 Bacteria 1055
44 Ga0070668_100526653 3300005347 Unclassified 1026
45 Ga0070669_100003260 3300005353 Bacteria 11659
46 Ga0070669_100375368 3300005353 Unclassified 1159
47 Ga0070675_100011978 3300005354 Bacteria 6796
48 Ga0070675_100276971 3300005354 Unclassified 1473
49 Ga0070675_100361274 3300005354 Bacteria 1289
50 Ga0070675_100667474 3300005354 Unclassified 945
51 Ga0070671_100005130 3300005355 Bacteria 10428
52 Ga0070671_100034524 3300005355 Unclassified 4186
53 Ga0070671_100060816 3300005355 Bacteria 3145
54 Ga0070671_100097552 3300005355 Bacteria 2465
55 Ga0070671_100111363 3300005355 Unclassified 2299
56 Ga0070671_100712743 3300005355 Unclassified 871
57 Ga0070674_100016040 3300005356 Bacteria 4691
58 Ga0070674_100263463 3300005356 Bacteria 1359
59 Ga0070673_100011059 3300005364 Bacteria 6148
60 Ga0070673_100013382 3300005364 Bacteria 5673
61 Ga0070673_100360202 3300005364 Bacteria 1293
62 Ga0070673_100451398 3300005364 Bacteria 1157
63 Ga0070688_100024070 3300005365 Bacteria 3587
64 Ga0070688_100062994 3300005365 Unclassified 2349
65 Ga0070688_100190688 3300005365 Bacteria 1428
66 Ga0070688_100401046 3300005365 Unclassified 1015
67 Ga0070688_100465915 3300005365 Unclassified 947
68 Ga0070688_100489451 3300005365 Unclassified 926
69 Ga0070659_100138884 3300005366 Bacteria 1978
70 Ga0070667_100005003 3300005367 Bacteria 11095
71 Ga0070667_100095564 3300005367 Unclassified 2562
72 Ga0070667_100422345 3300005367 Unclassified 1215
73 Ga0070709_10188412 3300005434 Unclassified 1453
74 Ga0070709_10286875 3300005434 Bacteria 1198
75 Ga0070709_10371223 3300005434 Bacteria 1061
76 Ga0070714_100156721 3300005435 Bacteria 2056
77 Ga0070714_100261528 3300005435 Unclassified 1603
78 Ga0070713_100179734 3300005436 Unclassified 1900
79 Ga0070713_100218432 3300005436 Bacteria 1728
80 Ga0070713_100271009 3300005436 Bacteria 1554
81 Ga0070713_100528275 3300005436 Unclassified 1115
82 Ga0070710_10658935 3300005437 Unclassified 735
83 Ga0070701_10128741 3300005438 Bacteria 1436
84 Ga0070711_100328591 3300005439 Unclassified 1224
85 Ga0070711_100420923 3300005439 Bacteria 1088
86 Ga0070705_100074492 3300005440 Bacteria 2064
87 Ga0070705_100170058 3300005440 Bacteria 1466
88 Ga0070705_100226447 3300005440 Bacteria 1298
89 Ga0070708_100077329 3300005445 Bacteria 3007
90 Ga0070708_100254786 3300005445 Unclassified 1649
91 Ga0070708_100694535 3300005445 Unclassified 958
92 Ga0070708_101169011 3300005445 Bacteria 720
93 Ga0070678_100009207 3300005456 Bacteria 5967
94 Ga0070678_100166380 3300005456 Bacteria 1792
95 Ga0070662_100063708 3300005457 Bacteria 2697
96 Ga0070662_100160027 3300005457 Bacteria 1761
97 Ga0070662_100321593 3300005457 Bacteria 1261
98 Ga0070681_10305480 3300005458 Unclassified 1500
99 Ga0068867_100124358 3300005459 Bacteria 1997
100 Ga0068867_100610171 3300005459 Unclassified 953
101 Ga0070685_10211565 3300005466 Unclassified 1266
102 Ga0070685_10224402 3300005466 Bacteria 1233
103 Ga0070685_10259969 3300005466 Unclassified 1154
104 Ga0070706_100000069 3300005467 Bacteria 119582
105 Ga0070706_100065240 3300005467 Unclassified 3367
106 Ga0070706_100102286 3300005467 Bacteria 2663
107 Ga0070706_100190663 3300005467 Unclassified 1915
108 Ga0070706_100228206 3300005467 Unclassified 1738
109 Ga0070706_100798713 3300005467 Unclassified 873
110 Ga0070707_100000320 3300005468 Bacteria 47282
111 Ga0070707_100052487 3300005468 Bacteria 3909
112 Ga0070707_100066419 3300005468 Bacteria 3466
113 Ga0070707_100080354 3300005468 Bacteria 3147
114 Ga0070707_100111213 3300005468 Bacteria 2657
115 Ga0070707_100147730 3300005468 Bacteria 2288
116 Ga0070707_100261808 3300005468 Bacteria 1682
117 Ga0070698_100021493 3300005471 Bacteria 6759
118 Ga0070698_100159217 3300005471 Bacteria 2202
119 Ga0070699_100071145 3300005518 Bacteria 3025
120 Ga0070699_100632292 3300005518 Unclassified 977
121 Ga0070679_100575948 3300005530 Unclassified 1069
122 Ga0070684_100000277 3300005535 Bacteria 35509
123 Ga0070684_100023395 3300005535 Bacteria 5167
124 Ga0070684_100522304 3300005535 Unclassified 1100
125 Ga0070697_100027433 3300005536 Bacteria 4556
126 Ga0070697_100050624 3300005536 Unclassified 3372
127 Ga0070697_100051711 3300005536 Bacteria 3339
128 Ga0070697_100092440 3300005536 Bacteria 2503
129 Ga0070672_100001802 3300005543 Bacteria 13393
130 Ga0070672_100119145 3300005543 Unclassified 2159
131 Ga0070686_100054475 3300005544 Bacteria 2558
132 Ga0070665_100033465 3300005548 Bacteria 5171
133 Ga0070665_100089305 3300005548 Bacteria 3087
134 Ga0070665_100265082 3300005548 Unclassified 1719
135 Ga0070665_101429044 3300005548 Unclassified 701
136 Ga0070664_100105827 3300005564 Bacteria 2450
137 Ga0070664_100236165 3300005564 Bacteria 1640
138 Ga0070664_100943249 3300005564 Unclassified 810
139 Ga0068856_100818726 3300005614 Bacteria 951
140 Ga0068852_101427970 3300005616 Unclassified 714
141 Ga0068859_100043320 3300005617 Bacteria 4523
142 Ga0068861_100257383 3300005719 Bacteria 1493
143 Ga0068861_100322510 3300005719 Bacteria 1346
144 Ga0068863_101084707 3300005841 Unclassified 805
145 Ga0068858_100629196 3300005842 Unclassified 1042
146 Ga0068860_100041033 3300005843 Bacteria 4421
147 Ga0068862_100081921 3300005844 Bacteria 2800
148 Ga0081455_10000547 3300005937 Bacteria 48774
149 Ga0081455_10020664 3300005937 Bacteria 6192
150 Ga0081455_10057518 3300005937 Unclassified 3295
151 Ga0081455_10103342 3300005937 Unclassified 2282
152 Ga0081455_10181701 3300005937 Bacteria 1592
153 Ga0081455_10240763 3300005937 Bacteria 1330
154 Ga0081540_1000016 3300005983 Bacteria 165370
155 Ga0081539_10003219 3300005985 Bacteria 20616
156 Ga0081539_10087614 3300005985 Unclassified 1617
157 Ga0070717_10003436 3300006028 Bacteria 11330
158 Ga0070717_10009547 3300006028 Bacteria 7296
159 Ga0070717_10116938 3300006028 Bacteria 2280
160 Ga0070717_10167677 3300006028 Unclassified 1908
161 Ga0070717_10772518 3300006028 Unclassified 873
162 Ga0070715_10045416 3300006163 Bacteria 1862
163 Ga0070716_100044327 3300006173 Bacteria 2491
164 Ga0070716_100426077 3300006173 Unclassified 961
165 Ga0070716_100480884 3300006173 Bacteria 912
166 Ga0070716_100590926 3300006173 Bacteria 834
167 Ga0070716_100686152 3300006173 Unclassified 781
168 Ga0070712_100005541 3300006175 Bacteria 7812
169 Ga0070712_100010726 3300006175 Bacteria 5789
170 Ga0070712_100031294 3300006175 Bacteria 3583
171 Ga0070712_100035134 3300006175 Unclassified 3401
172 Ga0070712_100685098 3300006175 Bacteria 873
173 Ga0097621_100022438 3300006237 Bacteria 4901
174 Ga0097621_100311761 3300006237 Unclassified 1392
175 Ga0097621_101012189 3300006237 Bacteria 778
176 Ga0068871_100018134 3300006358 Bacteria 5343
177 Ga0068871_100074305 3300006358 Bacteria 2804
178 Ga0068871_100464247 3300006358 Bacteria 1137
179 Ga0068871_100820786 3300006358 Unclassified 858
180 Ga0068871_101186297 3300006358 Unclassified 716
181 Ga0075433_10586825 3300006852 Unclassified 979
182 Ga0075434_100301871 3300006871 Bacteria 1622
183 Ga0075434_100642908 3300006871 Bacteria 1079
184 Ga0075436_100117807 3300006914 Bacteria 1857
185 Ga0097620_100043321 3300006931 Bacteria 4523
186 Ga0099795_10005489 3300007788 Bacteria 3379
187 Ga0111539_10300953 3300009094 Unclassified 1867
188 Ga0111539_10532008 3300009094 Bacteria 1369
189 Ga0105245_10113431 3300009098 Bacteria 2524
190 Ga0105245_10414782 3300009098 Unclassified 1348
191 Ga0105245_10891930 3300009098 Bacteria 931
192 Ga0114129_10122752 3300009147 Bacteria 3574
193 Ga0114129_10143184 3300009147 Unclassified 3276
194 Ga0114129_10169841 3300009147 Bacteria 2974
195 Ga0105242_10152569 3300009176 Unclassified 2016
196 Ga0105242_10293595 3300009176 Unclassified 1481
197 Ga0105242_10303308 3300009176 Bacteria 1459
198 Ga0105242_10636928 3300009176 Bacteria 1035
199 Ga0105248_10150559 3300009177 Bacteria 2625
200 Ga0105237_10703236 3300009545 Unclassified 1017
201 Ga0105238_11093387 3300009551 Unclassified 820
202 Ga0105249_11378195 3300009553 Bacteria 777
203 Ga0099796_10044629 3300010159 Bacteria 1515
204 Ga0105239_10106661 3300010375 Bacteria 3103
205 Ga0105239_10333201 3300010375 Bacteria 1712
206 Ga0105239_10993698 3300010375 Unclassified 965
207 Ga0105246_10648122 3300011119 Unclassified 919
208 Ga0157371_10436177 3300013102 Bacteria 962
209 Ga0157370_10831265 3300013104 Unclassified 840
210 Ga0157369_11009134 3300013105 Bacteria 852
211 Ga0157369_11013859 3300013105 Unclassified 850
212 Ga0157374_10036202 3300013296 Bacteria 4519
213 Ga0157374_10121321 3300013296 Bacteria 2523
214 Ga0157374_10256098 3300013296 Bacteria 1723
215 Ga0157378_10058172 3300013297 Bacteria 3447
216 Ga0157378_10076420 3300013297 Bacteria 3017
217 Ga0157378_10106383 3300013297 Bacteria 2566
218 Ga0157378_10126147 3300013297 Bacteria 2364
219 Ga0157378_10159914 3300013297 Unclassified 2106
220 Ga0157378_10172225 3300013297 Unclassified 2031
221 Ga0157378_10195564 3300013297 Unclassified 1910
222 Ga0157378_10282351 3300013297 Bacteria 1601
223 Ga0157378_10547512 3300013297 Bacteria 1162
224 Ga0157378_10634404 3300013297 Unclassified 1083
225 Ga0157378_10673312 3300013297 Unclassified 1052
226 Ga0157378_11023997 3300013297 Bacteria 861
227 Ga0163162_10052874 3300013306 Bacteria 4081
228 Ga0163162_10063305 3300013306 Bacteria 3741
229 Ga0163162_10079174 3300013306 Bacteria 3352
230 Ga0163162_10126853 3300013306 Bacteria 2658
231 Ga0163162_10151895 3300013306 Bacteria 2434
232 Ga0163162_10559553 3300013306 Bacteria 1271
233 Ga0157372_10061045 3300013307 Bacteria 4220
234 Ga0157375_10012466 3300013308 Bacteria 7546
235 Ga0157375_10038444 3300013308 Bacteria 4595
236 Ga0157375_10050408 3300013308 Bacteria 4084
237 Ga0157375_10193940 3300013308 Unclassified 2186
238 Ga0157375_10543805 3300013308 Bacteria 1323
239 Ga0163163_10353052 3300014325 Unclassified 1527
240 Ga0163163_11307296 3300014325 Bacteria 787
241 Ga0157379_10052700 3300014968 Bacteria 3634
242 Ga0157379_10393634 3300014968 Bacteria 1273
243 Ga0157379_10557284 3300014968 Unclassified 1067
244 Ga0157376_10179204 3300014969 Unclassified 1935
245 Ga0157376_10204369 3300014969 Unclassified 1820
246 Ga0157376_10253022 3300014969 Bacteria 1646
247 Ga0157376_10312745 3300014969 Unclassified 1491
248 Ga0157376_10391192 3300014969 Bacteria 1342
249 Ga0157376_10408287 3300014969 Bacteria 1315
250 Ga0157376_11173785 3300014969 Unclassified 795
251 Ga0182005_1011950 3300015265 Unclassified 2461
252 Ga0163161_10197501 3300017792 Bacteria 1549
253 Ga0163161_10361143 3300017792 Bacteria 1157
254 Ga0213875_10251538 3300021388 Unclassified 833
255 Ga0207666_1000718 3300025271 Unclassified 3971
256 Ga0207666_1001383 3300025271 Unclassified 2854
257 Ga0207673_1002745 3300025290 Bacteria 2025
258 Ga0207697_10001549 3300025315 Bacteria 12450
259 Ga0207697_10002789 3300025315 Bacteria 8901
260 Ga0207697_10003209 3300025315 Bacteria 8138
261 Ga0207697_10006050 3300025315 Bacteria 5532
262 Ga0207697_10007627 3300025315 Unclassified 4804
263 Ga0207697_10011028 3300025315 Bacteria 3835
264 Ga0207697_10042350 3300025315 Bacteria 1871
265 Ga0207697_10060051 3300025315 Unclassified 1581
266 Ga0207697_10129377 3300025315 Bacteria 1090
267 Ga0207697_10188648 3300025315 Unclassified 905
268 Ga0207682_10073391 3300025893 Bacteria 1453
269 Ga0207692_10020648 3300025898 Bacteria 3001
270 Ga0207692_10269993 3300025898 Bacteria 1025
271 Ga0207692_10286276 3300025898 Unclassified 999
272 Ga0207642_10161953 3300025899 Bacteria 1202
273 Ga0207642_10527797 3300025899 Unclassified 726
274 Ga0207688_10028787 3300025901 Bacteria 3055
275 Ga0207688_10192707 3300025901 Bacteria 1220
276 Ga0207688_10320935 3300025901 Unclassified 950
277 Ga0207680_10010922 3300025903 Bacteria 4566
278 Ga0207680_10019200 3300025903 Bacteria 3651
279 Ga0207680_10200505 3300025903 Bacteria 1359
280 Ga0207647_10009736 3300025904 Bacteria 6818
281 Ga0207647_10218629 3300025904 Bacteria 1098
282 Ga0207685_10028721 3300025905 Bacteria 1962
283 Ga0207699_10119808 3300025906 Unclassified 1700
284 Ga0207645_10005042 3300025907 Bacteria 9673
285 Ga0207645_10014962 3300025907 Bacteria 5170
286 Ga0207645_10048365 3300025907 Bacteria 2716
287 Ga0207684_10000243 3300025910 Bacteria 81628
288 Ga0207684_10008405 3300025910 Bacteria 9178
289 Ga0207684_10008877 3300025910 Bacteria 8925
290 Ga0207684_10012404 3300025910 Bacteria 7414
291 Ga0207684_10023041 3300025910 Bacteria 5319
292 Ga0207684_10051909 3300025910 Unclassified 3479
293 Ga0207684_10053106 3300025910 Unclassified 3440
294 Ga0207684_10076721 3300025910 Unclassified 2841
295 Ga0207684_10143692 3300025910 Unclassified 2052
296 Ga0207684_10180884 3300025910 Bacteria 1818
297 Ga0207707_10050311 3300025912 Bacteria 3630
298 Ga0207693_10006040 3300025915 Bacteria 10032
299 Ga0207693_10010796 3300025915 Bacteria 7415
300 Ga0207693_10153029 3300025915 Unclassified 1814
301 Ga0207663_10020625 3300025916 Unclassified 3735
302 Ga0207663_10049770 3300025916 Bacteria 2601
303 Ga0207660_10063003 3300025917 Bacteria 2672
304 Ga0207662_10004176 3300025918 Bacteria 7567
305 Ga0207657_10028219 3300025919 Bacteria 5123
306 Ga0207649_10382719 3300025920 Bacteria 1049
307 Ga0207646_10001827 3300025922 Bacteria 25695
308 Ga0207646_10003425 3300025922 Bacteria 17922
309 Ga0207646_10075424 3300025922 Unclassified 3013
310 Ga0207646_10077008 3300025922 Unclassified 2981
311 Ga0207646_10081023 3300025922 Bacteria 2902
312 Ga0207646_10081488 3300025922 Bacteria 2893
313 Ga0207646_10085640 3300025922 Bacteria 2819
314 Ga0207646_10147711 3300025922 Bacteria 2119
315 Ga0207681_10011824 3300025923 Bacteria 5371
316 Ga0207650_10016265 3300025925 Bacteria 5196
317 Ga0207650_10208513 3300025925 Bacteria 1569
318 Ga0207650_10917909 3300025925 Unclassified 744
319 Ga0207659_10011713 3300025926 Bacteria 5551
320 Ga0207659_10081097 3300025926 Unclassified 2398
321 Ga0207659_10314115 3300025926 Unclassified 1291
322 Ga0207659_10369893 3300025926 Bacteria 1193
323 Ga0207687_10595653 3300025927 Unclassified 931
324 Ga0207700_10149805 3300025928 Unclassified 1927
325 Ga0207700_10210878 3300025928 Bacteria 1642
326 Ga0207700_10383025 3300025928 Bacteria 1230
327 Ga0207700_10391052 3300025928 Unclassified 1217
328 Ga0207664_10257316 3300025929 Bacteria 1525
329 Ga0207664_10449238 3300025929 Unclassified 1150
330 Ga0207644_10015228 3300025931 Bacteria 5160
331 Ga0207644_10019251 3300025931 Bacteria 4628
332 Ga0207644_10084232 3300025931 Unclassified 2356
333 Ga0207644_10264570 3300025931 Unclassified 1376
334 Ga0207644_10280938 3300025931 Bacteria 1337
335 Ga0207644_10353660 3300025931 Unclassified 1193
336 Ga0207644_10415656 3300025931 Bacteria 1101
337 Ga0207644_10423455 3300025931 Unclassified 1091
338 Ga0207706_10097422 3300025933 Unclassified 2587
339 Ga0207706_10196306 3300025933 Bacteria 1770
340 Ga0207706_10447269 3300025933 Unclassified 1118
341 Ga0207686_10049090 3300025934 Bacteria 2618
342 Ga0207686_10097777 3300025934 Bacteria 1953
343 Ga0207670_10028666 3300025936 Bacteria 3539
344 Ga0207670_10032365 3300025936 Bacteria 3362
345 Ga0207670_10176472 3300025936 Bacteria 1606
346 Ga0207669_10201491 3300025937 Bacteria 1445
347 Ga0207704_10186661 3300025938 Bacteria 1504
348 Ga0207665_10219336 3300025939 Unclassified 1393
349 Ga0207665_10308450 3300025939 Bacteria 1185
350 Ga0207665_10348285 3300025939 Bacteria 1118
351 Ga0207665_10567626 3300025939 Unclassified 883
352 Ga0207665_10590491 3300025939 Bacteria 866
353 Ga0207691_10000306 3300025940 Bacteria 48746
354 Ga0207691_10006701 3300025940 Bacteria 11110
355 Ga0207691_10125815 3300025940 Unclassified 2268
356 Ga0207691_10559161 3300025940 Bacteria 970
357 Ga0207711_10183017 3300025941 Bacteria 1906
358 Ga0207661_10213866 3300025944 Bacteria 1700
359 Ga0207679_10030483 3300025945 Bacteria 3767
360 Ga0207679_10225297 3300025945 Bacteria 1579
361 Ga0207667_10747112 3300025949 Unclassified 978
362 Ga0207667_11024227 3300025949 Unclassified 812
363 Ga0207651_10042373 3300025960 Bacteria 3029
364 Ga0207712_10171588 3300025961 Bacteria 1696
365 Ga0207668_10131978 3300025972 Bacteria 1908
366 Ga0207668_10154606 3300025972 Bacteria 1780
367 Ga0207640_10088892 3300025981 Bacteria 2134
368 Ga0207658_10031663 3300025986 Unclassified 3758
369 Ga0207658_10082963 3300025986 Bacteria 2462
370 Ga0207677_10114528 3300026023 Bacteria 2015
371 Ga0207677_10314069 3300026023 Bacteria 1300
372 Ga0207677_11036316 3300026023 Bacteria 745
373 Ga0207703_10274766 3300026035 Bacteria 1528
374 Ga0207703_10320149 3300026035 Bacteria 1420
375 Ga0207639_10740752 3300026041 Unclassified 913
376 Ga0207678_10036538 3300026067 Bacteria 4276
377 Ga0207708_10779474 3300026075 Unclassified 822
378 Ga0207641_10428051 3300026088 Bacteria 1276
379 Ga0207648_10362491 3300026089 Bacteria 1308
380 Ga0207683_10005329 3300026121 Bacteria 11029
381 Ga0207683_10014599 3300026121 Bacteria 6689
382 Ga0207683_10107066 3300026121 Bacteria 2501
383 Ga0207683_10162866 3300026121 Unclassified 2017
384 Ga0207683_10293260 3300026121 Bacteria 1487
385 Ga0207698_10379098 3300026142 Bacteria 1345
386 Ga0209974_10114902 3300027876 Bacteria 950
387 Ga0268266_10217310 3300028379 Unclassified 1755
388 Ga0268266_10408742 3300028379 Bacteria 1284
389 Ga0268266_10440424 3300028379 Bacteria 1237
390 Ga0268266_11185328 3300028379 Unclassified 739
391 Ga0268265_10079413 3300028380 Bacteria 2584
392 Ga0268265_10941031 3300028380 Bacteria 851
393 Ga0268264_10184682 3300028381 Bacteria 1896
394 Ga0268264_10625141 3300028381 Unclassified 1064
395 Ga0307513_10147313 3300031456 Unclassified 2270
396 Ga0373926_0166991 3300035083 Unclassified 841
397 Ga0373939_0012231 3300035114 Bacteria 2185
398 Ga0373945_0051567 3300035116 Bacteria 1514
399 Ga0373945_0148797 3300035116 Unclassified 948
400 Ga0373943_0389644 3300035170 Bacteria 803
401 Ga0373946_0074699 3300035171 Unclassified 1472
402 Ga0373955_0334722 3300035172 Bacteria 915
403 Ga0373935_0147237 3300035692 Bacteria 1595
404 Ga0373927_0184011 3300035695 Unclassified 1371
405 Ga0373927_0468700 3300035695 Unclassified 832
406 Ga0373933_0171690 3300035724 Bacteria 1380
407 Ga0373947_0615175 3300035725 Unclassified 740
408 Ga0373937_0035058 3300036401 Bacteria 4565
409 Ga0373937_0414637 3300036401 Bacteria 1278
410 Ga0373937_0560601 3300036401 Unclassified 1085
411 Ga0373925_0074592 3300037068 Bacteria 2570
412 Ga0373925_0118478 3300037068 Bacteria 2053
413 Ga0373925_0769453 3300037068 Bacteria 794
414 Ga0395899_0019603 3300037312 Bacteria 5135
415 Ga0395900_0023018 3300037418 Bacteria 6377
416 Ga0395900_0210744 3300037418 Unclassified 1962
417 Ga0395898_0003094 3300037466 Bacteria 18828
418 Ga0395905_0045433 3300037471 Bacteria 4119
419 Ga0436364_1179917 3300037853 Bacteria 2761
420 Ga0436364_1361011 3300037853 Unclassified 738
421 Ga0395901_0001836 3300038443 Bacteria 21943
422 Ga0395901_0322142 3300038443 Unclassified 1599
423 Ga0451853_0327296 3300041512 Unclassified 807
424 Ga0439451_014043 3300042009 Unclassified 1616
425 Ga0439454_002031 3300042011 Unclassified 2066
426 Ga0439455_0076510 3300042012 Unclassified 905
427 Ga0439458_0037430 3300042157 Unclassified 1170
428 Ga0439458_0055265 3300042157 Bacteria 985
429 Ga0439444_0045238 3300042437 Unclassified 878
430 Ga0451576_0158166 3300045051 Bacteria 2364
431 Ga0495603_0283196 3300046455 Unclassified 953
432 Ga0495590_0097044 3300046457 Unclassified 1046
433 Ga0495641_0150988 3300046461 Unclassified 1038
434 Ga0495651_0122844 3300046462 Bacteria 1905
435 Ga0495651_0502724 3300046462 Unclassified 776
436 Ga0495653_0254510 3300046463 Bacteria 1164
437 Ga0495580_0133435 3300046472 Bacteria 1722
438 Ga0495580_0457732 3300046472 Unclassified 856
439 Ga0495582_0070740 3300046473 Unclassified 1930
440 Ga0495594_0234937 3300046499 Unclassified 1045
441 Ga0495607_0142531 3300046501 Bacteria 1235
442 Ga0495628_0092691 3300046516 Bacteria 2336
443 Ga0495630_0365425 3300046517 Bacteria 1105
444 Ga0495666_0195579 3300046526 Unclassified 931
445 Ga0495642_0054183 3300046528 Bacteria 1654
446 Ga0495652_0047582 3300046529 Bacteria 3677
447 Ga0495587_0372488 3300046536 Bacteria 795
448 Ga0495645_0017712 3300046543 Bacteria 5107
449 Ga0495635_0356796 3300046663 Unclassified 975
450 Ga0495599_0145209 3300046678 Bacteria 1471
451 Ga0495623_0111909 3300046679 Bacteria 1654
452 Ga0495669_0054218 3300046684 Bacteria 1804
453 Ga0495624_0283572 3300046690 Unclassified 1000
454 Ga0495671_0163452 3300046692 Bacteria 1083
455 Ga0495600_0280090 3300046809 Unclassified 1056
456 Ga0495604_0256671 3300047317 Bacteria 1190
457 Ga0495684_0139337 3300047471 Bacteria 1819
458 Ga0496100_0023963 3300048903 Unclassified 3716
459 Ga0496100_0077065 3300048903 Bacteria 2240
460 Ga0496100_0285123 3300048903 Bacteria 1232
461 Ga0496101_0020383 3300048904 Bacteria 4537
462 Ga0496101_0163140 3300048904 Bacteria 1710
463 Ga0496101_0314768 3300048904 Bacteria 1228
464 Ga0496101_0481737 3300048904 Unclassified 980
465 Ga0496101_0586532 3300048904 Unclassified 881
466 Ga0496102_0022074 3300048905 Bacteria 5638
467 Ga0496102_0102243 3300048905 Bacteria 2664
468 Ga0496102_0366990 3300048905 Unclassified 1355
469 Ga0496102_0401763 3300048905 Bacteria 1288
470 Ga0496103_0110844 3300048906 Bacteria 1743
471 Ga0496103_0176441 3300048906 Unclassified 1373
472 Ga0496104_0043109 3300048907 Bacteria 4237
473 Ga0496104_0114736 3300048907 Bacteria 2584
474 Ga0496104_0232517 3300048907 Unclassified 1755
475 Ga0496104_0244439 3300048907 Unclassified 1707
476 Ga0496104_0406706 3300048907 Bacteria 1273
477 Ga0496104_1091453 3300048907 Unclassified 702
478 Ga0496105_0091755 3300048908 Bacteria 2508
479 Ga0496105_0498683 3300048908 Unclassified 956
480 Ga0496105_0721904 3300048908 Bacteria 763
481 Ga0496106_0021818 3300048909 Bacteria 4756
482 Ga0496106_0024129 3300048909 Bacteria 4521
483 Ga0496106_0582284 3300048909 Unclassified 897
484 Ga0496107_0106065 3300048910 Bacteria 2063
485 Ga0496107_0218687 3300048910 Unclassified 1417
486 Ga0496107_0360953 3300048910 Unclassified 1081
487 Ga0496107_0501219 3300048910 Bacteria 901
488 Ga0496108_0028990 3300048911 Bacteria 4580
489 Ga0496108_0068559 3300048911 Bacteria 2993
490 Ga0496108_0107032 3300048911 Unclassified 2388
491 Ga0496108_0129980 3300048911 Unclassified 2165
492 Ga0496108_0517093 3300048911 Unclassified 1042
493 Ga0496109_0005070 3300048912 Bacteria 11004
494 Ga0496109_0122287 3300048912 Unclassified 2425
495 Ga0496109_0126153 3300048912 Bacteria 2387
496 Ga0496109_0223318 3300048912 Bacteria 1772
497 Ga0496109_0291460 3300048912 Unclassified 1539
498 Ga0496109_0461123 3300048912 Unclassified 1200
499 Ga0496110_0217383 3300048913 Unclassified 1738
500 Ga0496110_0256721 3300048913 Unclassified 1591
501 Ga0496110_0423401 3300048913 Unclassified 1214
502 Ga0496110_0681094 3300048913 Bacteria 929
503 Ga0496111_0035563 3300048914 Bacteria 3561
504 Ga0496111_0461828 3300048914 Unclassified 936
505 Ga0496112_0030001 3300048915 Bacteria 5262
506 Ga0496112_0086731 3300048915 Unclassified 3097
507 Ga0496112_0183765 3300048915 Unclassified 2054
508 Ga0496112_0355747 3300048915 Bacteria 1407
509 Ga0496112_0427396 3300048915 Bacteria 1263
510 Ga0496112_0595733 3300048915 Bacteria 1037
511 Ga0496112_0687413 3300048915 Bacteria 951
512 Ga0496113_0002003 3300048916 Bacteria 11677
513 Ga0496113_0023944 3300048916 Bacteria 4335
514 Ga0496113_0370526 3300048916 Unclassified 1149
515 Ga0496113_0411013 3300048916 Unclassified 1087
516 Ga0496114_0043750 3300048917 Bacteria 3713
517 Ga0496114_0060962 3300048917 Bacteria 3154
518 Ga0496114_1056330 3300048917 Unclassified 696
519 Ga0496115_0001436 3300048918 Bacteria 17058
520 Ga0496115_0002747 3300048918 Bacteria 12642
521 Ga0496115_0094408 3300048918 Bacteria 2447
522 Ga0496115_0103433 3300048918 Unclassified 2336
523 nmdc:mga05p37_170054_c1 3300050507 Bacteria 2658
524 nmdc:mga05p37_433738_c1 3300050507 Unclassified 1526
525 nmdc:mga05p37_533990_c1 3300050507 Bacteria 1339
526 nmdc:mga08y16_298980_c1 3300050511 Unclassified 1659
527 nmdc:mga08y16_915363_c1 3300050511 Unclassified 862
528 nmdc:mga0n895_230700_c1 3300050512 Bacteria 1879
529 nmdc:mga0n895_867627_c1 3300050512 Bacteria 889
530 nmdc:mga0rr50_806027_c1 3300050513 Unclassified 801
531 nmdc:mga08x19_121375_c1 3300050514 Bacteria 1752
532 nmdc:mga08x19_215370_c1 3300050514 Unclassified 1319
533 nmdc:mga0a205_260055_c1 3300050515 Bacteria 1613
534 Ga0495601_0008906 3300053077 Bacteria 5923
535 Ga0495612_0042629 3300053078 Unclassified 1853
536 Ga0495595_0181036 3300053084 Bacteria 1045
537 Ga0207665_10138669
538 SwRhRL2b_contig_3097388
539 MBSR1b_contig_1964708
540 CNXas_1000187
541 CNXas_1000188
542 Ga0065704_10018623
543 Ga0065704_10093381
544 Ga0065712_10000501
545 Ga0065712_10094053
546 Ga0065715_10000456
547 Ga0065715_10036866
548 Ga0065715_10100065
549 Ga0065715_10286105
550 Ga0065715_10413516
551 Ga0065707_10019113
552 Ga0070658_10442709
553 Ga0070676_10002455
554 Ga0070676_10022695
555 Ga0070676_10029041
556 Ga0070683_100016490
557 Ga0070683_100134024
558 Ga0070683_100250215
559 Ga0070690_100213761
560 Ga0070670_100134322
561 Ga0070670_100508782
562 Ga0070670_100669748
563 Ga0070677_10126790
564 Ga0068869_100595796
565 Ga0070666_10084241
566 Ga0070666_10405146
567 Ga0068868_100018069
568 Ga0068868_100651395
569 Ga0070660_100255921
570 Ga0070660_100579927
571 Ga0070689_100002934
572 Ga0070689_100090373
573 Ga0070689_100209859
574 Ga0070689_100422775
575 Ga0070687_100001928
576 Ga0070661_100606903
577 Ga0070668_100034121
578 Ga0070668_100139031
579 Ga0070668_100497613
580 Ga0070668_100526653
581 Ga0070669_100003260
582 Ga0070669_100375368
583 Ga0070675_100011978
584 Ga0070675_100276971
585 Ga0070675_100361274
586 Ga0070675_100667474
587 Ga0070671_100005130
588 Ga0070671_100034524
589 Ga0070671_100060816
590 Ga0070671_100097552
591 Ga0070671_100111363
592 Ga0070671_100712743
593 Ga0070674_100016040
594 Ga0070674_100263463
595 Ga0070673_100011059
596 Ga0070673_100013382
597 Ga0070673_100360202
598 Ga0070673_100451398
599 Ga0070688_100024070
600 Ga0070688_100062994
601 Ga0070688_100190688
602 Ga0070688_100401046
603 Ga0070688_100465915
604 Ga0070688_100489451
605 Ga0070659_100138884
606 Ga0070667_100005003
607 Ga0070667_100095564
608 Ga0070667_100422345
609 Ga0070709_10188412
610 Ga0070709_10286875
611 Ga0070709_10371223
612 Ga0070714_100156721
613 Ga0070714_100261528
614 Ga0070713_100179734
615 Ga0070713_100218432
616 Ga0070713_100271009
617 Ga0070713_100528275
618 Ga0070710_10658935
619 Ga0070701_10128741
620 Ga0070711_100328591
621 Ga0070711_100420923
622 Ga0070705_100074492
623 Ga0070705_100170058
624 Ga0070705_100226447
625 Ga0070708_100077329
626 Ga0070708_100254786
627 Ga0070708_100694535
628 Ga0070708_101169011
629 Ga0070678_100009207
630 Ga0070678_100166380
631 Ga0070662_100063708
632 Ga0070662_100160027
633 Ga0070662_100321593
634 Ga0070681_10305480
635 Ga0068867_100124358
636 Ga0068867_100610171
637 Ga0070685_10211565
638 Ga0070685_10224402
639 Ga0070685_10259969
640 Ga0070706_100000069
641 Ga0070706_100065240
642 Ga0070706_100102286
643 Ga0070706_100190663
644 Ga0070706_100228206
645 Ga0070706_100798713
646 Ga0070707_100000320
647 Ga0070707_100052487
648 Ga0070707_100066419
649 Ga0070707_100080354
650 Ga0070707_100111213
651 Ga0070707_100147730
652 Ga0070707_100261808
653 Ga0070698_100021493
654 Ga0070698_100159217
655 Ga0070699_100071145
656 Ga0070699_100632292
657 Ga0070679_100575948
658 Ga0070684_100000277
659 Ga0070684_100023395
660 Ga0070684_100522304
661 Ga0070697_100027433
662 Ga0070697_100050624
663 Ga0070697_100051711
664 Ga0070697_100092440
665 Ga0070672_100001802
666 Ga0070672_100119145
667 Ga0070686_100054475
668 Ga0070665_100033465
669 Ga0070665_100089305
670 Ga0070665_100265082
671 Ga0070665_101429044
672 Ga0070664_100105827
673 Ga0070664_100236165
674 Ga0070664_100943249
675 Ga0068856_100818726
676 Ga0068852_101427970
677 Ga0068859_100043320
678 Ga0068861_100257383
679 Ga0068861_100322510
680 Ga0068863_101084707
681 Ga0068858_100629196
682 Ga0068860_100041033
683 Ga0068862_100081921
684 Ga0081455_10000547
685 Ga0081455_10020664
686 Ga0081455_10057518
687 Ga0081455_10103342
688 Ga0081455_10181701
689 Ga0081455_10240763
690 Ga0081540_1000016
691 Ga0081539_10003219
692 Ga0081539_10087614
693 Ga0070717_10003436
694 Ga0070717_10009547
695 Ga0070717_10116938
696 Ga0070717_10167677
697 Ga0070717_10772518
698 Ga0070715_10045416
699 Ga0070716_100044327
700 Ga0070716_100426077
701 Ga0070716_100480884
702 Ga0070716_100590926
703 Ga0070716_100686152
704 Ga0070712_100005541
705 Ga0070712_100010726
706 Ga0070712_100031294
707 Ga0070712_100035134
708 Ga0070712_100685098
709 Ga0097621_100022438
710 Ga0097621_100311761
711 Ga0097621_101012189
712 Ga0068871_100018134
713 Ga0068871_100074305
714 Ga0068871_100464247
715 Ga0068871_100820786
716 Ga0068871_101186297
717 Ga0075433_10586825
718 Ga0075434_100301871
719 Ga0075434_100642908
720 Ga0075436_100117807
721 Ga0097620_100043321
722 Ga0099795_10005489
723 Ga0111539_10300953
724 Ga0111539_10532008
725 Ga0105245_10113431
726 Ga0105245_10414782
727 Ga0105245_10891930
728 Ga0114129_10122752
729 Ga0114129_10143184
730 Ga0114129_10169841
731 Ga0105242_10152569
732 Ga0105242_10293595
733 Ga0105242_10303308
734 Ga0105242_10636928
735 Ga0105248_10150559
736 Ga0105237_10703236
737 Ga0105238_11093387
738 Ga0105249_11378195
739 Ga0099796_10044629
740 Ga0105239_10106661
741 Ga0105239_10333201
742 Ga0105239_10993698
743 Ga0105246_10648122
744 Ga0157371_10436177
745 Ga0157370_10831265
746 Ga0157369_11009134
747 Ga0157369_11013859
748 Ga0157374_10036202
749 Ga0157374_10121321
750 Ga0157374_10256098
751 Ga0157378_10058172
752 Ga0157378_10076420
753 Ga0157378_10106383
754 Ga0157378_10126147
755 Ga0157378_10159914
756 Ga0157378_10172225
757 Ga0157378_10195564
758 Ga0157378_10282351
759 Ga0157378_10547512
760 Ga0157378_10634404
761 Ga0157378_10673312
762 Ga0157378_11023997
763 Ga0163162_10052874
764 Ga0163162_10063305
765 Ga0163162_10079174
766 Ga0163162_10126853
767 Ga0163162_10151895
768 Ga0163162_10559553
769 Ga0157372_10061045
770 Ga0157375_10012466
771 Ga0157375_10038444
772 Ga0157375_10050408
773 Ga0157375_10193940
774 Ga0157375_10543805
775 Ga0163163_10353052
776 Ga0163163_11307296
777 Ga0157379_10052700
778 Ga0157379_10393634
779 Ga0157379_10557284
780 Ga0157376_10179204
781 Ga0157376_10204369
782 Ga0157376_10253022
783 Ga0157376_10312745
784 Ga0157376_10391192
785 Ga0157376_10408287
786 Ga0157376_11173785
787 Ga0182005_1011950
788 Ga0163161_10197501
789 Ga0163161_10361143
790 Ga0213875_10251538
791 Ga0207666_1000718
792 Ga0207666_1001383
793 Ga0207673_1002745
794 Ga0207697_10001549
795 Ga0207697_10002789
796 Ga0207697_10003209
797 Ga0207697_10006050
798 Ga0207697_10007627
799 Ga0207697_10011028
800 Ga0207697_10042350
801 Ga0207697_10060051
802 Ga0207697_10129377
803 Ga0207697_10188648
804 Ga0207682_10073391
805 Ga0207692_10020648
806 Ga0207692_10269993
807 Ga0207692_10286276
808 Ga0207642_10161953
809 Ga0207642_10527797
810 Ga0207688_10028787
811 Ga0207688_10192707
812 Ga0207688_10320935
813 Ga0207680_10010922
814 Ga0207680_10019200
815 Ga0207680_10200505
816 Ga0207647_10009736
817 Ga0207647_10218629
818 Ga0207685_10028721
819 Ga0207699_10119808
820 Ga0207645_10005042
821 Ga0207645_10014962
822 Ga0207645_10048365
823 Ga0207684_10000243
824 Ga0207684_10008405
825 Ga0207684_10008877
826 Ga0207684_10012404
827 Ga0207684_10023041
828 Ga0207684_10051909
829 Ga0207684_10053106
830 Ga0207684_10076721
831 Ga0207684_10143692
832 Ga0207684_10180884
833 Ga0207707_10050311
834 Ga0207693_10006040
835 Ga0207693_10010796
836 Ga0207693_10153029
837 Ga0207663_10020625
838 Ga0207663_10049770
839 Ga0207660_10063003
840 Ga0207662_10004176
841 Ga0207657_10028219
842 Ga0207649_10382719
843 Ga0207646_10001827
844 Ga0207646_10003425
845 Ga0207646_10075424
846 Ga0207646_10077008
847 Ga0207646_10081023
848 Ga0207646_10081488
849 Ga0207646_10085640
850 Ga0207646_10147711
851 Ga0207681_10011824
852 Ga0207650_10016265
853 Ga0207650_10208513
854 Ga0207650_10917909
855 Ga0207659_10011713
856 Ga0207659_10081097
857 Ga0207659_10314115
858 Ga0207659_10369893
859 Ga0207687_10595653
860 Ga0207700_10149805
861 Ga0207700_10210878
862 Ga0207700_10383025
863 Ga0207700_10391052
864 Ga0207664_10257316
865 Ga0207664_10449238
866 Ga0207644_10015228
867 Ga0207644_10019251
868 Ga0207644_10084232
869 Ga0207644_10264570
870 Ga0207644_10280938
871 Ga0207644_10353660
872 Ga0207644_10415656
873 Ga0207644_10423455
874 Ga0207706_10097422
875 Ga0207706_10196306
876 Ga0207706_10447269
877 Ga0207686_10049090
878 Ga0207686_10097777
879 Ga0207670_10028666
880 Ga0207670_10032365
881 Ga0207670_10176472
882 Ga0207669_10201491
883 Ga0207704_10186661
884 Ga0207665_10219336
885 Ga0207665_10308450
886 Ga0207665_10348285
887 Ga0207665_10567626
888 Ga0207665_10590491
889 Ga0207691_10000306
890 Ga0207691_10006701
891 Ga0207691_10125815
892 Ga0207691_10559161
893 Ga0207711_10183017
894 Ga0207661_10213866
895 Ga0207679_10030483
896 Ga0207679_10225297
897 Ga0207667_10747112
898 Ga0207667_11024227
899 Ga0207651_10042373
900 Ga0207712_10171588
901 Ga0207668_10131978
902 Ga0207668_10154606
903 Ga0207640_10088892
904 Ga0207658_10031663
905 Ga0207658_10082963
906 Ga0207677_10114528
907 Ga0207677_10314069
908 Ga0207677_11036316
909 Ga0207703_10274766
910 Ga0207703_10320149
911 Ga0207639_10740752
912 Ga0207678_10036538
913 Ga0207708_10779474
914 Ga0207641_10428051
915 Ga0207648_10362491
916 Ga0207683_10005329
917 Ga0207683_10014599
918 Ga0207683_10107066
919 Ga0207683_10162866
920 Ga0207683_10293260
921 Ga0207698_10379098
922 Ga0209974_10114902
923 Ga0268266_10217310
924 Ga0268266_10408742
925 Ga0268266_10440424
926 Ga0268266_11185328
927 Ga0268265_10079413
928 Ga0268265_10941031
929 Ga0268264_10184682
930 Ga0268264_10625141
931 Ga0307513_10147313
932 Ga0373926_0166991
933 Ga0373939_0012231
934 Ga0373945_0051567
935 Ga0373945_0148797
936 Ga0373943_0389644
937 Ga0373946_0074699
938 Ga0373955_0334722
939 Ga0373935_0147237
940 Ga0373927_0184011
941 Ga0373927_0468700
942 Ga0373933_0171690
943 Ga0373947_0615175
944 Ga0373937_0035058
945 Ga0373937_0414637
946 Ga0373937_0560601
947 Ga0373925_0074592
948 Ga0373925_0118478
949 Ga0373925_0769453
950 Ga0395899_0019603
951 Ga0395900_0023018
952 Ga0395900_0210744
953 Ga0395898_0003094
954 Ga0395905_0045433
955 Ga0436364_1179917
956 Ga0436364_1361011
957 Ga0395901_0001836
958 Ga0395901_0322142
959 Ga0451853_0327296
960 Ga0439451_014043
961 Ga0439454_002031
962 Ga0439455_0076510
963 Ga0439458_0037430
964 Ga0439458_0055265
965 Ga0439444_0045238
966 Ga0451576_0158166
967 Ga0495603_0283196
968 Ga0495590_0097044
969 Ga0495641_0150988
970 Ga0495651_0122844
971 Ga0495651_0502724
972 Ga0495653_0254510
973 Ga0495580_0133435
974 Ga0495580_0457732
975 Ga0495582_0070740
976 Ga0495594_0234937
977 Ga0495607_0142531
978 Ga0495628_0092691
979 Ga0495630_0365425
980 Ga0495666_0195579
981 Ga0495642_0054183
982 Ga0495652_0047582
983 Ga0495587_0372488
984 Ga0495645_0017712
985 Ga0495635_0356796
986 Ga0495599_0145209
987 Ga0495623_0111909
988 Ga0495669_0054218
989 Ga0495624_0283572
990 Ga0495671_0163452
991 Ga0495600_0280090
992 Ga0495604_0256671
993 Ga0495684_0139337
994 Ga0496100_0023963
995 Ga0496100_0077065
996 Ga0496100_0285123
997 Ga0496101_0020383
998 Ga0496101_0163140
999 Ga0496101_0314768
1000 Ga0496101_0481737
1001 Ga0496101_0586532
1002 Ga0496102_0022074
1003 Ga0496102_0102243
1004 Ga0496102_0366990
1005 Ga0496102_0401763
1006 Ga0496103_0110844
1007 Ga0496103_0176441
1008 Ga0496104_0043109
1009 Ga0496104_0114736
1010 Ga0496104_0232517
1011 Ga0496104_0244439
1012 Ga0496104_0406706
1013 Ga0496104_1091453
1014 Ga0496105_0091755
1015 Ga0496105_0498683
1016 Ga0496105_0721904
1017 Ga0496106_0021818
1018 Ga0496106_0024129
1019 Ga0496106_0582284
1020 Ga0496107_0106065
1021 Ga0496107_0218687
1022 Ga0496107_0360953
1023 Ga0496107_0501219
1024 Ga0496108_0028990
1025 Ga0496108_0068559
1026 Ga0496108_0107032
1027 Ga0496108_0129980
1028 Ga0496108_0517093
1029 Ga0496109_0005070
1030 Ga0496109_0122287
1031 Ga0496109_0126153
1032 Ga0496109_0223318
1033 Ga0496109_0291460
1034 Ga0496109_0461123
1035 Ga0496110_0217383
1036 Ga0496110_0256721
1037 Ga0496110_0423401
1038 Ga0496110_0681094
1039 Ga0496111_0035563
1040 Ga0496111_0461828
1041 Ga0496112_0030001
1042 Ga0496112_0086731
1043 Ga0496112_0183765
1044 Ga0496112_0355747
1045 Ga0496112_0427396
1046 Ga0496112_0595733
1047 Ga0496112_0687413
1048 Ga0496113_0002003
1049 Ga0496113_0023944
1050 Ga0496113_0370526
1051 Ga0496113_0411013
1052 Ga0496114_0043750
1053 Ga0496114_0060962
1054 Ga0496114_1056330
1055 Ga0496115_0001436
1056 Ga0496115_0002747
1057 Ga0496115_0094408
1058 Ga0496115_0103433
1059 nmdc:mga05p37_170054_c1
1060 nmdc:mga05p37_433738_c1
1061 nmdc:mga05p37_533990_c1
1062 nmdc:mga08y16_298980_c1
1063 nmdc:mga08y16_915363_c1
1064 nmdc:mga0n895_230700_c1
1065 nmdc:mga0n895_867627_c1
1066 nmdc:mga0rr50_806027_c1
1067 nmdc:mga08x19_121375_c1
1068 nmdc:mga08x19_215370_c1
1069 nmdc:mga0a205_260055_c1
1070 Ga0495601_0008906
1071 Ga0495612_0042629
1072 Ga0495595_0181036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

59

105

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eh3-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8367 12 195
5gpa-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8336 14 192
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8302 11 88
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.8256 11 192
2eh3-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8237 12 195
ID Description Score Start End Superfamily
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.001 12 54 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.001 12 54 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9973 11 54 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9963 12 54 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9939 14 54 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7W1RQY6-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9763 22 201 GO:0000976
GO:0003700
AF-A0A2V5LIE6-F1-model_v4 BetI-type transcriptional repressor C-terminal domain-containing protein 0.9664 52 209
AF-A0A2V5LIE6-F1-model_v4 BetI-type transcriptional repressor C-terminal domain-containing protein 0.9605 52 209
AF-A0A2V6H5X9-F1-model_v4 HTH tetR-type domain-containing protein 0.9579 35 170 GO:0003677
GO:0006355
AF-A0A2V6H5X9-F1-model_v4 HTH tetR-type domain-containing protein 0.9378 35 170 GO:0003677
GO:0006355

Map