F460757

General Info

Members Datasets Scaffolds Average Seq Length
536 272 536 308

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100064173|Ga0070698_1000641733
Length 328
Sequence MPILIAIAVFFLVALLVFMFGWALDQRSAKARLLRERLETVEKTAERKPGEELALVRDEMLSRFPALDNLLRRSERISDLQTLLSQADMGMRAGNVLGLCAVSALALGFAAFLVSSPLSANESLLFTVVGVMLGAIMPYSFASYRRSKRFQKFEELFPEAIDTLARAVRAGHAFTSALELIANEVGEPVSSEFRKLFEEQKFGLPVRDALLNLTERVPLVDVKFFVTAVMLQRETGGNLAEILDNLSYMIRERFKIMRQVRVHTAQGRLTMMLLMGLPPIIVISMQVLNPSFIHPLFSDPIGHILIVAGITLQTIGYFVIRKVIQIQV

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
249 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 4.85
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000414 3300000546 Bacteria 7542
2 rootL2_10384884 3300003322 Unclassified 1334
3 Ga0065712_10147271 3300005290 Bacteria 1398
4 Ga0065707_10008787 3300005295 Bacteria 3982
5 Ga0070658_10029968 3300005327 Bacteria 4372
6 Ga0070676_10017661 3300005328 Bacteria 3948
7 Ga0070683_100010459 3300005329 Bacteria 7978
8 Ga0070683_100176262 3300005329 Unclassified 2029
9 Ga0070690_100097953 3300005330 Unclassified 1940
10 Ga0070670_100006401 3300005331 Bacteria 9967
11 Ga0070666_10084609 3300005335 Bacteria 2171
12 Ga0070666_10277618 3300005335 Unclassified 1190
13 Ga0070680_100383901 3300005336 Bacteria 1196
14 Ga0070682_100081278 3300005337 Bacteria 2098
15 Ga0068868_100046683 3300005338 Unclassified 3391
16 Ga0068868_100055284 3300005338 Bacteria 3131
17 Ga0068868_100196991 3300005338 Bacteria 1677
18 Ga0070660_100009428 3300005339 Bacteria 6865
19 Ga0070660_100168390 3300005339 Bacteria 1768
20 Ga0070689_100033638 3300005340 Bacteria 3907
21 Ga0070687_100006423 3300005343 Bacteria 4818
22 Ga0070661_100006889 3300005344 Bacteria 7839
23 Ga0070692_10178482 3300005345 Bacteria 1229
24 Ga0070669_100001166 3300005353 Bacteria 19189
25 Ga0070669_100027978 3300005353 Bacteria 4059
26 Ga0070669_100086454 3300005353 Bacteria 2343
27 Ga0070675_100000654 3300005354 Bacteria 23952
28 Ga0070671_100006856 3300005355 Bacteria 9119
29 Ga0070671_100057183 3300005355 Bacteria 3245
30 Ga0070671_100426140 3300005355 Bacteria 1137
31 Ga0070688_100034156 3300005365 Bacteria 3078
32 Ga0070659_100034313 3300005366 Bacteria 3946
33 Ga0070659_100152536 3300005366 Bacteria 1886
34 Ga0070667_100019066 3300005367 Bacteria 5688
35 Ga0070709_10001805 3300005434 Bacteria 11603
36 Ga0070709_10010112 3300005434 Bacteria 5216
37 Ga0070709_10032594 3300005434 Bacteria 3143
38 Ga0070709_10117665 3300005434 Unclassified 1796
39 Ga0070714_100000675 3300005435 Bacteria 24172
40 Ga0070714_100001060 3300005435 Bacteria 19644
41 Ga0070714_100082609 3300005435 Bacteria 2799
42 Ga0070713_100000037 3300005436 Bacteria 85487
43 Ga0070713_100003819 3300005436 Bacteria 9969
44 Ga0070713_100033550 3300005436 Bacteria 4113
45 Ga0070713_100035722 3300005436 Bacteria 4004
46 Ga0070713_100049297 3300005436 Bacteria 3474
47 Ga0070713_100052415 3300005436 Bacteria 3378
48 Ga0070713_100135290 3300005436 Bacteria 2177
49 Ga0070713_100142904 3300005436 Bacteria 2121
50 Ga0070713_100251464 3300005436 Unclassified 1612
51 Ga0070710_10002533 3300005437 Bacteria 8671
52 Ga0070701_10091023 3300005438 Unclassified 1671
53 Ga0070711_100000165 3300005439 Bacteria 35832
54 Ga0070711_100005472 3300005439 Bacteria 7596
55 Ga0070711_100040247 3300005439 Bacteria 3151
56 Ga0070705_100016466 3300005440 Bacteria 3842
57 Ga0070700_100011334 3300005441 Bacteria 4935
58 Ga0070694_100111556 3300005444 Bacteria 1949
59 Ga0070708_100001600 3300005445 Bacteria 17349
60 Ga0070708_100003416 3300005445 Bacteria 12432
61 Ga0070708_100003764 3300005445 Bacteria 11907
62 Ga0070708_100003921 3300005445 Bacteria 11685
63 Ga0070708_100006654 3300005445 Bacteria 9204
64 Ga0070708_100177217 3300005445 Bacteria 1992
65 Ga0070708_100512690 3300005445 Bacteria 1131
66 Ga0070663_100008014 3300005455 Bacteria 6473
67 Ga0070663_100268588 3300005455 Bacteria 1355
68 Ga0070662_100000756 3300005457 Bacteria 19848
69 Ga0070681_10050993 3300005458 Bacteria 4128
70 Ga0070681_10097760 3300005458 Bacteria 2883
71 Ga0070681_10257650 3300005458 Bacteria 1656
72 Ga0068867_100001663 3300005459 Bacteria 15488
73 Ga0068867_100029046 3300005459 Bacteria 3984
74 Ga0068867_100271685 3300005459 Unclassified 1386
75 Ga0070685_10105487 3300005466 Bacteria 1727
76 Ga0070685_10203809 3300005466 Bacteria 1287
77 Ga0070685_10217579 3300005466 Bacteria 1250
78 Ga0070706_100001489 3300005467 Bacteria 24577
79 Ga0070706_100009224 3300005467 Bacteria 9192
80 Ga0070706_100009996 3300005467 Bacteria 8813
81 Ga0070706_100013772 3300005467 Bacteria 7479
82 Ga0070706_100043917 3300005467 Bacteria 4128
83 Ga0070706_100155599 3300005467 Bacteria 2134
84 Ga0070707_100012585 3300005468 Bacteria 7903
85 Ga0070707_100013712 3300005468 Bacteria 7589
86 Ga0070707_100023057 3300005468 Bacteria 5888
87 Ga0070707_100034283 3300005468 Bacteria 4841
88 Ga0070698_100001870 3300005471 Bacteria 23453
89 Ga0070698_100005160 3300005471 Bacteria 14282
90 Ga0070698_100047622 3300005471 Bacteria 4382
91 Ga0070698_100057094 3300005471 Bacteria 3951
92 Ga0070698_100064173 3300005471 Bacteria 3701
93 Ga0070698_100273515 3300005471 Unclassified 1621
94 Ga0070698_100478567 3300005471 Bacteria 1182
95 Ga0070699_100000358 3300005518 Bacteria 44500
96 Ga0070699_100020455 3300005518 Bacteria 5708
97 Ga0070699_100040151 3300005518 Bacteria 4052
98 Ga0070699_100058471 3300005518 Bacteria 3340
99 Ga0070699_100072537 3300005518 Bacteria 2995
100 Ga0070699_100263693 3300005518 Bacteria 1541
101 Ga0070679_100172668 3300005530 Bacteria 2134
102 Ga0070679_100197890 3300005530 Unclassified 1976
103 Ga0070697_100000056 3300005536 Bacteria 86619
104 Ga0070697_100003837 3300005536 Bacteria 11540
105 Ga0070697_100003966 3300005536 Bacteria 11371
106 Ga0070697_100013301 3300005536 Bacteria 6455
107 Ga0070697_100016930 3300005536 Bacteria 5731
108 Ga0070697_100083286 3300005536 Bacteria 2638
109 Ga0070697_100093760 3300005536 Bacteria 2486
110 Ga0070697_100162717 3300005536 Bacteria 1886
111 Ga0068853_100026908 3300005539 Bacteria 4833
112 Ga0068853_100085452 3300005539 Bacteria 2766
113 Ga0070672_100025572 3300005543 Bacteria 4381
114 Ga0070686_100002556 3300005544 Bacteria 10034
115 Ga0070686_100060126 3300005544 Bacteria 2451
116 Ga0070695_100056040 3300005545 Bacteria 2542
117 Ga0070693_100100610 3300005547 Bacteria 1760
118 Ga0070665_100005886 3300005548 Bacteria 12562
119 Ga0070704_100000329 3300005549 Bacteria 21434
120 Ga0068855_100014986 3300005563 Bacteria 9336
121 Ga0070664_100003986 3300005564 Bacteria 11876
122 Ga0070664_100005738 3300005564 Bacteria 10007
123 Ga0070664_100022756 3300005564 Bacteria 5170
124 Ga0070664_100059254 3300005564 Bacteria 3257
125 Ga0068857_100042680 3300005577 Bacteria 4024
126 Ga0068857_100181265 3300005577 Bacteria 1917
127 Ga0068854_100014977 3300005578 Bacteria 5124
128 Ga0068856_100000819 3300005614 Bacteria 33504
129 Ga0068856_100179931 3300005614 Bacteria 2127
130 Ga0070702_100127349 3300005615 Unclassified 1603
131 Ga0068852_100069889 3300005616 Unclassified 3079
132 Ga0068852_100079745 3300005616 Bacteria 2901
133 Ga0068852_100453985 3300005616 Unclassified 1269
134 Ga0068859_100045826 3300005617 Bacteria 4392
135 Ga0068859_100048087 3300005617 Bacteria 4285
136 Ga0068859_100062971 3300005617 Bacteria 3739
137 Ga0068859_100076843 3300005617 Bacteria 3379
138 Ga0068864_100178520 3300005618 Unclassified 1940
139 Ga0068866_10135064 3300005718 Unclassified 1408
140 Ga0068861_100011546 3300005719 Bacteria 6146
141 Ga0068851_10039020 3300005834 Bacteria 2385
142 Ga0068870_10041688 3300005840 Bacteria 2387
143 Ga0068863_100125826 3300005841 Bacteria 2445
144 Ga0068863_100185143 3300005841 Bacteria 2000
145 Ga0068858_100000678 3300005842 Bacteria 35515
146 Ga0068858_100015600 3300005842 Bacteria 7146
147 Ga0068858_100082222 3300005842 Bacteria 2993
148 Ga0068858_100253147 3300005842 Bacteria 1673
149 Ga0068860_100007217 3300005843 Bacteria 11109
150 Ga0068860_100020021 3300005843 Bacteria 6483
151 Ga0068860_100041544 3300005843 Bacteria 4392
152 Ga0068862_100048423 3300005844 Bacteria 3628
153 Ga0081455_10060619 3300005937 Bacteria 3188
154 Ga0070717_10000462 3300006028 Bacteria 25844
155 Ga0070717_10000853 3300006028 Bacteria 20209
156 Ga0070717_10002516 3300006028 Bacteria 12901
157 Ga0070717_10005248 3300006028 Bacteria 9443
158 Ga0070717_10022147 3300006028 Bacteria 5019
159 Ga0070717_10050580 3300006028 Bacteria 3416
160 Ga0070717_10124927 3300006028 Bacteria 2208
161 Ga0070717_10209325 3300006028 Unclassified 1711
162 Ga0070715_10122067 3300006163 Bacteria 1243
163 Ga0070716_100000047 3300006173 Bacteria 48702
164 Ga0070716_100006880 3300006173 Bacteria 5575
165 Ga0070716_100040361 3300006173 Bacteria 2596
166 Ga0070716_100217410 3300006173 Bacteria 1281
167 Ga0070712_100000074 3300006175 Bacteria 51442
168 Ga0070712_100000637 3300006175 Bacteria 20638
169 Ga0070712_100009340 3300006175 Bacteria 6179
170 Ga0070712_100049288 3300006175 Bacteria 2924
171 Ga0070712_100222158 3300006175 Bacteria 1496
172 Ga0097621_100024908 3300006237 Bacteria 4678
173 Ga0097621_100076310 3300006237 Bacteria 2780
174 Ga0068871_100000524 3300006358 Bacteria 26278
175 Ga0068871_100051120 3300006358 Bacteria 3345
176 Ga0068871_100086670 3300006358 Bacteria 2602
177 Ga0068871_100182015 3300006358 Unclassified 1806
178 Ga0068871_100187440 3300006358 Bacteria 1780
179 Ga0068871_100191231 3300006358 Unclassified 1763
180 Ga0075428_100111007 3300006844 Bacteria 2987
181 Ga0075428_100148108 3300006844 Bacteria 2551
182 Ga0075433_10001640 3300006852 Bacteria 16620
183 Ga0075434_100002201 3300006871 Bacteria 16988
184 Ga0075434_100106140 3300006871 Bacteria 2819
185 Ga0075434_100152723 3300006871 Bacteria 2329
186 Ga0075434_100251344 3300006871 Bacteria 1787
187 Ga0068865_100070642 3300006881 Bacteria 2474
188 Ga0075436_100024644 3300006914 Bacteria 4137
189 Ga0075436_100081615 3300006914 Bacteria 2242
190 Ga0097620_100045825 3300006931 Bacteria 4392
191 Ga0097620_100048086 3300006931 Bacteria 4285
192 Ga0097620_100062971 3300006931 Bacteria 3739
193 Ga0097620_100076843 3300006931 Bacteria 3379
194 Ga0075435_100001852 3300007076 Bacteria 13729
195 Ga0075435_100020201 3300007076 Bacteria 5098
196 Ga0105240_10021126 3300009093 Bacteria 8664
197 Ga0105240_10030490 3300009093 Bacteria 7009
198 Ga0105240_10298644 3300009093 Bacteria 1843
199 Ga0111539_10031809 3300009094 Bacteria 6411
200 Ga0111539_10125261 3300009094 Bacteria 3011
201 Ga0105245_10003679 3300009098 Bacteria 13693
202 Ga0105245_10035536 3300009098 Unclassified 4423
203 Ga0105247_10026509 3300009101 Bacteria 3500
204 Ga0114129_10003383 3300009147 Bacteria 22408
205 Ga0114129_10221502 3300009147 Bacteria 2552
206 Ga0114129_10485348 3300009147 Bacteria 1616
207 Ga0105243_10008987 3300009148 Bacteria 7636
208 Ga0105241_10003926 3300009174 Bacteria 11011
209 Ga0105241_10252139 3300009174 Bacteria 1497
210 Ga0105242_10014878 3300009176 Bacteria 6028
211 Ga0105242_10143944 3300009176 Unclassified 2071
212 Ga0105248_10006167 3300009177 Bacteria 13143
213 Ga0105248_10176521 3300009177 Bacteria 2407
214 Ga0105248_10243526 3300009177 Bacteria 2024
215 Ga0105237_10018819 3300009545 Bacteria 7143
216 Ga0105237_10026241 3300009545 Bacteria 5954
217 Ga0105238_10020002 3300009551 Bacteria 6814
218 Ga0105238_10029958 3300009551 Bacteria 5540
219 Ga0105249_10002731 3300009553 Bacteria 15264
220 Ga0105249_10002811 3300009553 Bacteria 15029
221 Ga0105239_10026103 3300010375 Bacteria 6431
222 Ga0105239_10026729 3300010375 Bacteria 6353
223 Ga0157373_10007012 3300013100 Bacteria 8396
224 Ga0157371_10008442 3300013102 Bacteria 8201
225 Ga0157370_10065909 3300013104 Bacteria 3426
226 Ga0157370_10492840 3300013104 Bacteria 1126
227 Ga0157369_10036072 3300013105 Bacteria 5420
228 Ga0157369_10055718 3300013105 Unclassified 4267
229 Ga0157369_10066176 3300013105 Bacteria 3888
230 Ga0157369_10407505 3300013105 Bacteria 1410
231 Ga0157374_10003560 3300013296 Bacteria 13114
232 Ga0157374_10006942 3300013296 Bacteria 9631
233 Ga0157374_10049110 3300013296 Bacteria 3918
234 Ga0157374_10059653 3300013296 Bacteria 3568
235 Ga0157378_10000500 3300013297 Bacteria 37186
236 Ga0157378_10060459 3300013297 Bacteria 3381
237 Ga0157378_10115059 3300013297 Bacteria 2471
238 Ga0157378_10155978 3300013297 Unclassified 2131
239 Ga0163162_10004996 3300013306 Bacteria 12781
240 Ga0163162_10015112 3300013306 Bacteria 7538
241 Ga0163162_10028897 3300013306 Bacteria 5488
242 Ga0163162_10245147 3300013306 Unclassified 1923
243 Ga0157372_10010844 3300013307 Bacteria 9701
244 Ga0157372_10015125 3300013307 Bacteria 8259
245 Ga0157372_10022762 3300013307 Bacteria 6784
246 Ga0157372_10084436 3300013307 Bacteria 3599
247 Ga0157372_10516318 3300013307 Bacteria 1393
248 Ga0157375_10056732 3300013308 Bacteria 3869
249 Ga0157375_10103319 3300013308 Bacteria 2937
250 Ga0163163_10023391 3300014325 Bacteria 5864
251 Ga0163163_10094353 3300014325 Bacteria 3010
252 Ga0163163_10381575 3300014325 Bacteria 1467
253 Ga0182008_10039405 3300014497 Bacteria 2361
254 Ga0157377_10064594 3300014745 Bacteria 2100
255 Ga0157377_10122784 3300014745 Unclassified 1576
256 Ga0157379_10005298 3300014968 Bacteria 11083
257 Ga0157379_10013385 3300014968 Bacteria 7185
258 Ga0157379_10129843 3300014968 Bacteria 2267
259 Ga0157376_10001020 3300014969 Bacteria 18283
260 Ga0157376_10013798 3300014969 Bacteria 6041
261 Ga0157376_10174120 3300014969 Unclassified 1962
262 Ga0182007_10002600 3300015262 Bacteria 8891
263 Ga0213875_10019852 3300021388 Bacteria 3229
264 Ga0224572_1003795 3300024225 Bacteria 2580
265 Ga0228598_1000225 3300024227 Bacteria 10703
266 Ga0228598_1003519 3300024227 Bacteria 3367
267 Ga0207656_10005631 3300025321 Bacteria 4443
268 Ga0207682_10039072 3300025893 Bacteria 1928
269 Ga0207692_10008695 3300025898 Bacteria 4214
270 Ga0207710_10007811 3300025900 Bacteria 4528
271 Ga0207680_10248798 3300025903 Unclassified 1227
272 Ga0207647_10017506 3300025904 Bacteria 4871
273 Ga0207685_10016120 3300025905 Bacteria 2384
274 Ga0207685_10115010 3300025905 Bacteria 1172
275 Ga0207699_10027170 3300025906 Bacteria 3165
276 Ga0207645_10019923 3300025907 Bacteria 4391
277 Ga0207643_10037715 3300025908 Bacteria 2712
278 Ga0207684_10001076 3300025910 Bacteria 30590
279 Ga0207684_10005233 3300025910 Bacteria 12038
280 Ga0207684_10008256 3300025910 Bacteria 9271
281 Ga0207684_10082372 3300025910 Bacteria 2740
282 Ga0207684_10142767 3300025910 Bacteria 2059
283 Ga0207654_10008510 3300025911 Bacteria 5191
284 Ga0207707_10025099 3300025912 Bacteria 5213
285 Ga0207707_10052058 3300025912 Bacteria 3566
286 Ga0207707_10171059 3300025912 Bacteria 1898
287 Ga0207707_10197804 3300025912 Bacteria 1753
288 Ga0207695_10041628 3300025913 Bacteria 4916
289 Ga0207695_10084879 3300025913 Bacteria 3196
290 Ga0207671_10015459 3300025914 Bacteria 5973
291 Ga0207671_10025418 3300025914 Bacteria 4448
292 Ga0207671_10206444 3300025914 Bacteria 1535
293 Ga0207693_10000004 3300025915 Bacteria 193261
294 Ga0207693_10000727 3300025915 Bacteria 29670
295 Ga0207693_10043153 3300025915 Bacteria 3550
296 Ga0207693_10051351 3300025915 Bacteria 3236
297 Ga0207693_10305801 3300025915 Bacteria 1245
298 Ga0207663_10005219 3300025916 Bacteria 6537
299 Ga0207663_10012168 3300025916 Unclassified 4643
300 Ga0207663_10018808 3300025916 Bacteria 3880
301 Ga0207660_10051789 3300025917 Bacteria 2920
302 Ga0207662_10007299 3300025918 Bacteria 6009
303 Ga0207657_10000808 3300025919 Bacteria 33057
304 Ga0207657_10001448 3300025919 Bacteria 25392
305 Ga0207652_10162252 3300025921 Bacteria 2004
306 Ga0207646_10003039 3300025922 Bacteria 19301
307 Ga0207646_10003502 3300025922 Bacteria 17698
308 Ga0207681_10009341 3300025923 Bacteria 5992
309 Ga0207681_10024297 3300025923 Bacteria 3888
310 Ga0207681_10094807 3300025923 Bacteria 2139
311 Ga0207694_10023360 3300025924 Bacteria 4693
312 Ga0207694_10074469 3300025924 Bacteria 2657
313 Ga0207650_10018729 3300025925 Bacteria 4862
314 Ga0207659_10000450 3300025926 Bacteria 24770
315 Ga0207659_10220624 3300025926 Bacteria 1524
316 Ga0207687_10001057 3300025927 Bacteria 18672
317 Ga0207687_10006098 3300025927 Bacteria 7981
318 Ga0207700_10002030 3300025928 Bacteria 11575
319 Ga0207700_10049243 3300025928 Unclassified 3133
320 Ga0207700_10080621 3300025928 Bacteria 2539
321 Ga0207700_10296092 3300025928 Bacteria 1396
322 Ga0207664_10001047 3300025929 Bacteria 18529
323 Ga0207664_10014317 3300025929 Bacteria 5724
324 Ga0207644_10165012 3300025931 Bacteria 1725
325 Ga0207690_10045479 3300025932 Bacteria 2900
326 Ga0207690_10053028 3300025932 Bacteria 2719
327 Ga0207706_10000453 3300025933 Bacteria 43644
328 Ga0207706_10002974 3300025933 Bacteria 16348
329 Ga0207669_10056963 3300025937 Bacteria 2377
330 Ga0207704_10067106 3300025938 Bacteria 2255
331 Ga0207665_10000125 3300025939 Bacteria 50974
332 Ga0207665_10002729 3300025939 Bacteria 11847
333 Ga0207665_10005403 3300025939 Bacteria 8532
334 Ga0207665_10138011 3300025939 Bacteria 1736
335 Ga0207691_10023919 3300025940 Bacteria 5749
336 Ga0207711_10001089 3300025941 Bacteria 25934
337 Ga0207689_10001035 3300025942 Bacteria 26688
338 Ga0207689_10048673 3300025942 Bacteria 3497
339 Ga0207661_10491068 3300025944 Unclassified 1121
340 Ga0207679_10007345 3300025945 Bacteria 6987
341 Ga0207679_10019017 3300025945 Bacteria 4611
342 Ga0207679_10044468 3300025945 Bacteria 3204
343 Ga0207667_10003812 3300025949 Bacteria 18542
344 Ga0207667_10088931 3300025949 Bacteria 3193
345 Ga0207651_10177170 3300025960 Bacteria 1687
346 Ga0207668_10048328 3300025972 Bacteria 2919
347 Ga0207640_10025176 3300025981 Bacteria 3599
348 Ga0207640_10155255 3300025981 Bacteria 1686
349 Ga0207677_10009762 3300026023 Bacteria 5407
350 Ga0207703_10003341 3300026035 Bacteria 13475
351 Ga0207703_10003863 3300026035 Bacteria 12451
352 Ga0207703_10279365 3300026035 Unclassified 1516
353 Ga0207639_10005735 3300026041 Bacteria 8409
354 Ga0207678_10019875 3300026067 Bacteria 5902
355 Ga0207678_10414189 3300026067 Bacteria 1168
356 Ga0207708_10181942 3300026075 Bacteria 1669
357 Ga0207702_10004940 3300026078 Bacteria 11714
358 Ga0207702_10222276 3300026078 Bacteria 1760
359 Ga0207702_10500609 3300026078 Bacteria 1184
360 Ga0207641_10125211 3300026088 Bacteria 2300
361 Ga0207641_10134350 3300026088 Bacteria 2225
362 Ga0207648_10002317 3300026089 Bacteria 20547
363 Ga0207648_10051552 3300026089 Bacteria 3597
364 Ga0207676_10289832 3300026095 Bacteria 1490
365 Ga0207674_10055905 3300026116 Bacteria 4009
366 Ga0207674_10059721 3300026116 Bacteria 3858
367 Ga0207674_10205872 3300026116 Bacteria 1917
368 Ga0207675_100006838 3300026118 Bacteria 10800
369 Ga0207675_100056010 3300026118 Bacteria 3678
370 Ga0207683_10080805 3300026121 Bacteria 2884
371 Ga0268266_10013491 3300028379 Bacteria 7034
372 Ga0268265_10001583 3300028380 Bacteria 18841
373 Ga0268264_10016715 3300028381 Bacteria 6006
374 Ga0268264_10053197 3300028381 Bacteria 3377
375 Ga0268264_10056266 3300028381 Bacteria 3288
376 Ga0268264_10081399 3300028381 Bacteria 2767
377 Ga0265770_1000977 3300030878 Bacteria 3954
378 Ga0265760_10000110 3300031090 Bacteria 20840
379 Ga0265760_10002688 3300031090 Bacteria 5201
380 Ga0265340_10034618 3300031247 Bacteria 2511
381 Ga0307408_100022297 3300031548 Bacteria 4301
382 Ga0265314_10148244 3300031711 Bacteria 1442
383 Ga0307405_10048428 3300031731 Bacteria 2621
384 Ga0307413_10057861 3300031824 Bacteria 2373
385 Ga0307413_10203916 3300031824 Bacteria 1430
386 Ga0307410_10001023 3300031852 Bacteria 12126
387 Ga0307410_10035954 3300031852 Bacteria 3221
388 Ga0307410_10059658 3300031852 Bacteria 2605
389 Ga0307406_10018117 3300031901 Bacteria 4109
390 Ga0307406_10187756 3300031901 Bacteria 1510
391 Ga0307407_10005601 3300031903 Bacteria 5471
392 Ga0307407_10012830 3300031903 Bacteria 4045
393 Ga0307407_10194921 3300031903 Bacteria 1353
394 Ga0307412_10099328 3300031911 Bacteria 2055
395 Ga0307412_10216814 3300031911 Bacteria 1464
396 Ga0307409_100005350 3300031995 Bacteria 7372
397 Ga0307409_100010358 3300031995 Bacteria 5792
398 Ga0307409_100023786 3300031995 Bacteria 4255
399 Ga0307416_100002617 3300032002 Bacteria 10402
400 Ga0307416_100329546 3300032002 Bacteria 1533
401 Ga0307416_100456816 3300032002 Bacteria 1331
402 Ga0307414_10008759 3300032004 Bacteria 5767
403 Ga0307411_10005425 3300032005 Bacteria 6262
404 Ga0307411_10118424 3300032005 Bacteria 1910
405 Ga0307411_10154864 3300032005 Bacteria 1708
406 Ga0307415_100008949 3300032126 Bacteria 5582
407 Ga0307415_100025396 3300032126 Bacteria 3716
408 Ga0307415_100089003 3300032126 Bacteria 2229
409 Ga0316583_10071050 3300032133 Bacteria 1218
410 Ga0373926_0053341 3300035083 Unclassified 1463
411 Ga0373934_0012782 3300035086 Bacteria 3172
412 Ga0373934_0110292 3300035086 Bacteria 1115
413 Ga0373952_0009277 3300035092 Bacteria 1881
414 Ga0373923_0039584 3300035111 Bacteria 1936
415 Ga0373936_0004855 3300035113 Bacteria 5070
416 Ga0373945_0045074 3300035116 Bacteria 1605
417 Ga0373954_0069192 3300035118 Bacteria 1675
418 Ga0373954_0072593 3300035118 Bacteria 1637
419 Ga0373956_0008566 3300035119 Bacteria 4142
420 Ga0373943_0000156 3300035170 Bacteria 26674
421 Ga0373946_0001066 3300035171 Bacteria 9440
422 Ga0373955_0029411 3300035172 Bacteria 2856
423 Ga0373955_0070244 3300035172 Bacteria 1956
424 Ga0373962_0039232 3300035242 Bacteria 1328
425 Ga0373931_0038908 3300035691 Bacteria 2490
426 Ga0373935_0004164 3300035692 Bacteria 8470
427 Ga0373935_0012715 3300035692 Bacteria 5067
428 Ga0373927_0000278 3300035695 Bacteria 40183
429 Ga0373927_0022075 3300035695 Bacteria 4171
430 Ga0373927_0199704 3300035695 Bacteria 1313
431 Ga0373947_0000052 3300035725 Bacteria 59070
432 Ga0373947_0042557 3300035725 Bacteria 2711
433 Ga0373937_0063490 3300036401 Bacteria 3397
434 Ga0373925_0000889 3300037068 Bacteria 27310
435 Ga0373925_0002168 3300037068 Bacteria 15997
436 Ga0373925_0015177 3300037068 Bacteria 5569
437 Ga0373925_0038210 3300037068 Bacteria 3548
438 Ga0395905_0137056 3300037471 Bacteria 2303
439 Ga0395905_0272965 3300037471 Bacteria 1577
440 Ga0436364_0781622 3300037853 Bacteria 5144
441 Ga0436364_1201968 3300037853 Bacteria 5366
442 Ga0436360_0212334 3300039438 Bacteria 2850
443 Ga0451577_0016613 3300042876 Bacteria 6810
444 Ga0453683_0160749 3300044673 Bacteria 1421
445 Ga0466959_0003780 3300045049 Bacteria 10032
446 Ga0451576_0015550 3300045051 Bacteria 8424
447 Ga0451576_0109400 3300045051 Bacteria 2876
448 Ga0451576_0138077 3300045051 Bacteria 2542
449 Ga0451576_0172299 3300045051 Bacteria 2259
450 Ga0466967_0009481 3300045976 Bacteria 7226
451 Ga0466967_0046502 3300045976 Bacteria 3779
452 Ga0495603_0033787 3300046455 Bacteria 3077
453 Ga0495590_0090516 3300046457 Unclassified 1082
454 Ga0495629_0040662 3300046459 Bacteria 3271
455 Ga0495629_0294424 3300046459 Unclassified 1112
456 Ga0495653_0191464 3300046463 Unclassified 1395
457 Ga0495580_0000647 3300046472 Bacteria 29570
458 Ga0495580_0001660 3300046472 Bacteria 19562
459 Ga0495580_0005174 3300046472 Bacteria 10849
460 Ga0495580_0030628 3300046472 Bacteria 3894
461 Ga0495580_0049084 3300046472 Bacteria 2986
462 Ga0495580_0050753 3300046472 Bacteria 2933
463 Ga0495580_0071550 3300046472 Bacteria 2423
464 Ga0495584_0134046 3300046491 Unclassified 1257
465 Ga0495608_0068937 3300046511 Bacteria 2312
466 Ga0495630_0137610 3300046517 Bacteria 1856
467 Ga0495630_0254195 3300046517 Unclassified 1342
468 Ga0495621_0004553 3300046539 Bacteria 3911
469 Ga0495645_0106076 3300046543 Bacteria 1993
470 Ga0495659_0007275 3300046664 Bacteria 3509
471 Ga0495659_0088404 3300046664 Bacteria 1186
472 Ga0495647_0060948 3300046681 Bacteria 1489
473 Ga0495658_0013294 3300046683 Bacteria 4188
474 Ga0495669_0027949 3300046684 Bacteria 2468
475 Ga0495674_0014256 3300047319 Bacteria 7444
476 Ga0495674_0117697 3300047319 Bacteria 2247
477 Ga0495602_0068921 3300048088 Bacteria 3036
478 Ga0496100_0007148 3300048903 Bacteria 6133
479 Ga0496100_0051058 3300048903 Bacteria 2683
480 Ga0496101_0051203 3300048904 Bacteria 2975
481 Ga0496101_0057738 3300048904 Bacteria 2808
482 Ga0496102_0127956 3300048905 Unclassified 2375
483 Ga0496102_0418245 3300048905 Bacteria 1259
484 Ga0496103_0065522 3300048906 Bacteria 2266
485 Ga0496104_0090083 3300048907 Bacteria 2931
486 Ga0496104_0096777 3300048907 Bacteria 2824
487 Ga0496104_0162100 3300048907 Bacteria 2145
488 Ga0496106_0011472 3300048909 Bacteria 6553
489 Ga0496106_0088363 3300048909 Unclassified 2389
490 Ga0496107_0033361 3300048910 Bacteria 3683
491 Ga0496107_0226430 3300048910 Unclassified 1391
492 Ga0496108_0001985 3300048911 Bacteria 16372
493 Ga0496109_0072225 3300048912 Bacteria 3169
494 Ga0496110_0449145 3300048913 Unclassified 1175
495 Ga0496111_0009834 3300048914 Bacteria 6391
496 Ga0496111_0276799 3300048914 Bacteria 1245
497 Ga0496112_0032512 3300048915 Bacteria 5067
498 Ga0496112_0208575 3300048915 Bacteria 1911
499 Ga0496113_0004198 3300048916 Bacteria 8805
500 Ga0496113_0042640 3300048916 Bacteria 3354
501 Ga0496114_0575516 3300048917 Bacteria 994
502 Ga0496115_0004044 3300048918 Bacteria 10585
503 Ga0496115_0114846 3300048918 Bacteria 2213
504 Ga0501296_006614 3300049519 Unclassified 1318
505 Ga0501298_001778 3300049521 Bacteria 3188
506 Ga0501067_0224558 3300049583 Bacteria 1046
507 Ga0501283_005364 3300049779 Bacteria 1761
508 nmdc:mga05p37_156261_c1 3300050507 Bacteria 2787
509 nmdc:mga05p37_340153_c1 3300050507 Bacteria 1770
510 nmdc:mga09592_93233_c1 3300050508 Bacteria 2575
511 nmdc:mga0n895_143739_c1 3300050512 Bacteria 2415
512 nmdc:mga0n895_28070_c1 3300050512 Bacteria 5351
513 nmdc:mga0n895_316248_c1 3300050512 Bacteria 1582
514 nmdc:mga0n895_85245_c1 3300050512 Bacteria 3154
515 nmdc:mga0rr50_4157_c1 3300050513 Bacteria 8463
516 nmdc:mga08x19_4064_c1 3300050514 Bacteria 8684
517 nmdc:mga0a205_1358_c1 3300050515 Bacteria 11338
518 nmdc:mga0a205_300575_c1 3300050515 Bacteria 1478
519 Ga0495601_0047528 3300053077 Bacteria 2702
520 Ga0495612_0067558 3300053078 Bacteria 1487
521 Ga0495619_0314568 3300053085 Bacteria 1084
522 Ga0500590_130094 3300053148 Bacteria 1166
523 Ga0590071_000396 3300059421 Bacteria 12810
524 Ga0590071_000959 3300059421 Bacteria 7965
525 Ga0590074_000025 3300059423 Bacteria 14748
526 Ga0590075_000757 3300059424 Bacteria 8561
527 Ga0590075_000785 3300059424 Bacteria 8371
528 Ga0590077_002191 3300059426 Bacteria 4265
529 Ga0590077_004448 3300059426 Bacteria 2877
530 Ga0587080_006974 3300059503 Bacteria 1573
531 Ga0587088_003551 3300059508 Bacteria 1897
532 Ga0587067_005152 3300059640 Bacteria 1750
533 Ga0587076_004106 3300059645 Bacteria 1793
534 Ga0587102_004883 3300059649 Bacteria 1164
535 Ga0587107_003729 3300059652 Bacteria 1499
536 Ga0587071_007776 3300060344 Bacteria 1720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0134046 Ga0495584_0134046_18_812 263
2 3300037471 Ga0395905_0137056 Ga0395905_0137056_628_1596 268
3 3300021388 Ga0213875_10019852 Ga0213875_100198522 269
4 3300037853 Ga0436364_1201968 Ga0436364_1201968_1311_2273 269
5 3300048914 Ga0496111_0276799 Ga0496111_0276799_365_1192 275
6 3300045976 Ga0466967_0046502 Ga0466967_0046502_2414_3394 277
7 3300005434 Ga0070709_10032594 Ga0070709_100325943 278
8 3300025906 Ga0207699_10027170 Ga0207699_100271703 278
9 3300005841 Ga0068863_100125826 Ga0068863_1001258262 280
10 3300025937 Ga0207669_10056963 Ga0207669_100569632 280
11 3300045051 Ga0451576_0109400 Ga0451576_0109400_348_1316 280
12 3300053148 Ga0500590_130094 Ga0500590_130094_38_1006 281
13 3300049519 Ga0501296_006614 Ga0501296_006614_259_1230 284
14 3300037853 Ga0436364_0781622 Ga0436364_0781622_801_1763 285
15 3300005466 Ga0070685_10203809 Ga0070685_102038092 288
16 3300005617 Ga0068859_100045826 Ga0068859_1000458262 288
17 3300005842 Ga0068858_100000678 Ga0068858_10000067816 288
18 3300005843 Ga0068860_100007217 Ga0068860_1000072179 288
19 3300006881 Ga0068865_100070642 Ga0068865_1000706422 288
20 3300006931 Ga0097620_100045825 Ga0097620_1000458252 288
21 3300013306 Ga0163162_10028897 Ga0163162_100288974 288
22 3300013308 Ga0157375_10103319 Ga0157375_101033192 288
23 3300014745 Ga0157377_10122784 Ga0157377_101227842 288
24 3300014968 Ga0157379_10013385 Ga0157379_100133853 288
25 3300025914 Ga0207671_10025418 Ga0207671_100254184 288
26 3300025938 Ga0207704_10067106 Ga0207704_100671062 288
27 3300026035 Ga0207703_10003341 Ga0207703_100033419 288
28 3300028381 Ga0268264_10081399 Ga0268264_100813994 288
29 3300003322 rootL2_10384884 rootL2_103848842 289
30 3300035242 Ga0373962_0039232 Ga0373962_0039232_134_1099 292
31 3300045051 Ga0451576_0172299 Ga0451576_0172299_36_1001 292
32 3300005458 Ga0070681_10097760 Ga0070681_100977602 294
33 3300006028 Ga0070717_10000462 Ga0070717_1000046221 294
34 3300009093 Ga0105240_10298644 Ga0105240_102986442 294
35 3300025912 Ga0207707_10052058 Ga0207707_100520584 294
36 3300049583 Ga0501067_0224558 Ga0501067_0224558_29_916 295
37 3300005328 Ga0070676_10017661 Ga0070676_100176612 296
38 3300005329 Ga0070683_100176262 Ga0070683_1001762622 296
39 3300005335 Ga0070666_10277618 Ga0070666_102776181 296
40 3300005339 Ga0070660_100009428 Ga0070660_1000094283 296
41 3300005344 Ga0070661_100006889 Ga0070661_1000068896 296
42 3300005353 Ga0070669_100027978 Ga0070669_1000279784 296
43 3300005365 Ga0070688_100034156 Ga0070688_1000341562 296
44 3300005367 Ga0070667_100019066 Ga0070667_1000190664 296
45 3300005438 Ga0070701_10091023 Ga0070701_100910232 296
46 3300005455 Ga0070663_100008014 Ga0070663_1000080144 296
47 3300005457 Ga0070662_100000756 Ga0070662_1000007564 296
48 3300005466 Ga0070685_10105487 Ga0070685_101054872 296
49 3300005530 Ga0070679_100197890 Ga0070679_1001978902 296
50 3300005544 Ga0070686_100002556 Ga0070686_1000025568 296
51 3300005547 Ga0070693_100100610 Ga0070693_1001006102 296
52 3300005548 Ga0070665_100005886 Ga0070665_1000058863 296
53 3300005564 Ga0070664_100005738 Ga0070664_1000057384 296
54 3300005616 Ga0068852_100069889 Ga0068852_1000698894 296
55 3300005617 Ga0068859_100076843 Ga0068859_1000768434 296
56 3300005618 Ga0068864_100178520 Ga0068864_1001785201 296
57 3300005718 Ga0068866_10135064 Ga0068866_101350642 296
58 3300005842 Ga0068858_100015600 Ga0068858_1000156004 296
59 3300005843 Ga0068860_100020021 Ga0068860_1000200213 296
60 3300006871 Ga0075434_100152723 Ga0075434_1001527232 296
61 3300006914 Ga0075436_100081615 Ga0075436_1000816152 296
62 3300006931 Ga0097620_100076843 Ga0097620_1000768434 296
63 3300009093 Ga0105240_10021126 Ga0105240_100211265 296
64 3300009098 Ga0105245_10035536 Ga0105245_100355364 296
65 3300009101 Ga0105247_10026509 Ga0105247_100265092 296
66 3300009176 Ga0105242_10143944 Ga0105242_101439442 296
67 3300009177 Ga0105248_10006167 Ga0105248_1000616710 296
68 3300009551 Ga0105238_10020002 Ga0105238_100200024 296
69 3300009553 Ga0105249_10002811 Ga0105249_100028113 296
70 3300013102 Ga0157371_10008442 Ga0157371_100084425 296
71 3300013105 Ga0157369_10055718 Ga0157369_100557182 296
72 3300013296 Ga0157374_10003560 Ga0157374_1000356010 296
73 3300013297 Ga0157378_10155978 Ga0157378_101559782 296
74 3300013306 Ga0163162_10015112 Ga0163162_100151122 296
75 3300013307 Ga0157372_10022762 Ga0157372_100227623 296
76 3300014325 Ga0163163_10023391 Ga0163163_100233914 296
77 3300014968 Ga0157379_10005298 Ga0157379_100052984 296
78 3300014969 Ga0157376_10013798 Ga0157376_100137982 296
79 3300025321 Ga0207656_10005631 Ga0207656_100056313 296
80 3300025900 Ga0207710_10007811 Ga0207710_100078113 296
81 3300025903 Ga0207680_10248798 Ga0207680_102487981 296
82 3300025907 Ga0207645_10019923 Ga0207645_100199233 296
83 3300025913 Ga0207695_10041628 Ga0207695_100416284 296
84 3300025914 Ga0207671_10015459 Ga0207671_100154594 296
85 3300025915 Ga0207693_10305801 Ga0207693_103058012 296
86 3300025919 Ga0207657_10000808 Ga0207657_1000080810 296
87 3300025923 Ga0207681_10024297 Ga0207681_100242974 296
88 3300025924 Ga0207694_10023360 Ga0207694_100233604 296
89 3300025927 Ga0207687_10001057 Ga0207687_1000105715 296
90 3300025932 Ga0207690_10053028 Ga0207690_100530283 296
91 3300025933 Ga0207706_10000453 Ga0207706_1000045323 296
92 3300025941 Ga0207711_10001089 Ga0207711_1000108915 296
93 3300025944 Ga0207661_10491068 Ga0207661_104910681 296
94 3300025945 Ga0207679_10044468 Ga0207679_100444683 296
95 3300025949 Ga0207667_10003812 Ga0207667_1000381215 296
96 3300025972 Ga0207668_10048328 Ga0207668_100483283 296
97 3300025981 Ga0207640_10025176 Ga0207640_100251764 296
98 3300026023 Ga0207677_10009762 Ga0207677_100097623 296
99 3300026041 Ga0207639_10005735 Ga0207639_100057355 296
100 3300026067 Ga0207678_10019875 Ga0207678_100198754 296
101 3300026089 Ga0207648_10051552 Ga0207648_100515522 296
102 3300026116 Ga0207674_10059721 Ga0207674_100597212 296
103 3300026118 Ga0207675_100056010 Ga0207675_1000560102 296
104 3300026121 Ga0207683_10080805 Ga0207683_100808053 296
105 3300028379 Ga0268266_10013491 Ga0268266_100134913 296
106 3300028381 Ga0268264_10053197 Ga0268264_100531974 296
107 3300035092 Ga0373952_0009277 Ga0373952_0009277_822_1790 296
108 3300035691 Ga0373931_0038908 Ga0373931_0038908_873_1841 296
109 3300046455 Ga0495603_0033787 Ga0495603_0033787_693_1652 296
110 3300048905 Ga0496102_0127956 Ga0496102_0127956_438_1406 296
111 3300048910 Ga0496107_0033361 Ga0496107_0033361_1077_2045 296
112 3300050512 nmdc:mga0n895_143739_c1 nmdc:mga0n895_143739_c1_346_1314 296
113 3300005330 Ga0070690_100097953 Ga0070690_1000979532 297
114 3300005345 Ga0070692_10178482 Ga0070692_101784821 297
115 3300006028 Ga0070717_10050580 Ga0070717_100505803 297
116 3300006173 Ga0070716_100217410 Ga0070716_1002174102 297
117 3300009148 Ga0105243_10008987 Ga0105243_100089874 297
118 3300025939 Ga0207665_10138011 Ga0207665_101380112 297
119 3300026075 Ga0207708_10181942 Ga0207708_101819422 297
120 3300005340 Ga0070689_100033638 Ga0070689_1000336382 298
121 3300005343 Ga0070687_100006423 Ga0070687_1000064236 298
122 3300005354 Ga0070675_100000654 Ga0070675_10000065423 298
123 3300005617 Ga0068859_100062971 Ga0068859_1000629712 298
124 3300005842 Ga0068858_100082222 Ga0068858_1000822222 298
125 3300005843 Ga0068860_100041544 Ga0068860_1000415443 298
126 3300006931 Ga0097620_100062971 Ga0097620_1000629712 298
127 3300009177 Ga0105248_10243526 Ga0105248_102435262 298
128 3300014745 Ga0157377_10064594 Ga0157377_100645942 298
129 3300025926 Ga0207659_10000450 Ga0207659_100004505 298
130 3300025960 Ga0207651_10177170 Ga0207651_101771702 298
131 3300026035 Ga0207703_10003863 Ga0207703_1000386310 298
132 3300028381 Ga0268264_10016715 Ga0268264_100167154 298
133 3300032126 Ga0307415_100089003 Ga0307415_1000890032 298
134 3300006358 Ga0068871_100182015 Ga0068871_1001820152 299
135 3300013307 Ga0157372_10010844 Ga0157372_100108448 299
136 3300005434 Ga0070709_10117665 Ga0070709_101176652 300
137 3300005436 Ga0070713_100035722 Ga0070713_1000357222 300
138 3300005436 Ga0070713_100251464 Ga0070713_1002514642 300
139 3300005445 Ga0070708_100003416 Ga0070708_1000034166 300
140 3300005467 Ga0070706_100013772 Ga0070706_1000137726 300
141 3300005468 Ga0070707_100012585 Ga0070707_1000125857 300
142 3300005471 Ga0070698_100001870 Ga0070698_1000018708 300
143 3300005518 Ga0070699_100072537 Ga0070699_1000725374 300
144 3300005536 Ga0070697_100016930 Ga0070697_1000169304 300
145 3300006175 Ga0070712_100009340 Ga0070712_1000093402 300
146 3300006358 Ga0068871_100187440 Ga0068871_1001874402 300
147 3300006844 Ga0075428_100148108 Ga0075428_1001481083 300
148 3300025893 Ga0207682_10039072 Ga0207682_100390722 300
149 3300025910 Ga0207684_10005233 Ga0207684_100052338 300
150 3300025922 Ga0207646_10003039 Ga0207646_1000303910 300
151 3300025928 Ga0207700_10296092 Ga0207700_102960922 300
152 3300031852 Ga0307410_10059658 Ga0307410_100596582 300
153 3300031901 Ga0307406_10018117 Ga0307406_100181172 300
154 3300031995 Ga0307409_100005350 Ga0307409_1000053502 300
155 3300032002 Ga0307416_100329546 Ga0307416_1003295462 300
156 3300032005 Ga0307411_10005425 Ga0307411_100054256 300
157 3300032126 Ga0307415_100025396 Ga0307415_1000253962 300
158 3300005471 Ga0070698_100273515 Ga0070698_1002735152 301
159 3300005471 Ga0070698_100478567 Ga0070698_1004785671 301
160 3300005518 Ga0070699_100058471 Ga0070699_1000584712 301
161 3300006844 Ga0075428_100111007 Ga0075428_1001110072 301
162 3300006871 Ga0075434_100106140 Ga0075434_1001061403 301
163 3300009147 Ga0114129_10003383 Ga0114129_1000338313 301
164 3300050507 nmdc:mga05p37_340153_c1 nmdc:mga05p37_340153_c1_723_1691 301
165 3300050508 nmdc:mga09592_93233_c1 nmdc:mga09592_93233_c1_1574_2542 301
166 3300050512 nmdc:mga0n895_28070_c1 nmdc:mga0n895_28070_c1_307_1275 301
167 3300005331 Ga0070670_100006401 Ga0070670_1000064014 302
168 3300005366 Ga0070659_100152536 Ga0070659_1001525362 302
169 3300005518 Ga0070699_100040151 Ga0070699_1000401511 302
170 3300005614 Ga0068856_100000819 Ga0068856_10000081912 302
171 3300006028 Ga0070717_10022147 Ga0070717_100221474 302
172 3300024225 Ga0224572_1003795 Ga0224572_10037952 302
173 3300024227 Ga0228598_1000225 Ga0228598_10002254 302
174 3300025917 Ga0207660_10051789 Ga0207660_100517892 302
175 3300025923 Ga0207681_10094807 Ga0207681_100948072 302
176 3300025925 Ga0207650_10018729 Ga0207650_100187294 302
177 3300025940 Ga0207691_10023919 Ga0207691_100239192 302
178 3300025945 Ga0207679_10019017 Ga0207679_100190173 302
179 3300026095 Ga0207676_10289832 Ga0207676_102898322 302
180 3300046457 Ga0495590_0090516 Ga0495590_0090516_62_1033 302
181 3300005436 Ga0070713_100003819 Ga0070713_1000038197 303
182 3300025928 Ga0207700_10049243 Ga0207700_100492434 303
183 3300005467 Ga0070706_100009996 Ga0070706_1000099966 304
184 3300005471 Ga0070698_100047622 Ga0070698_1000476222 304
185 3300013306 Ga0163162_10245147 Ga0163162_102451472 304
186 3300025910 Ga0207684_10082372 Ga0207684_100823722 304
187 3300031731 Ga0307405_10048428 Ga0307405_100484282 304
188 3300031903 Ga0307407_10194921 Ga0307407_101949212 304
189 3300031911 Ga0307412_10099328 Ga0307412_100993282 304
190 3300031995 Ga0307409_100023786 Ga0307409_1000237862 304
191 3300046539 Ga0495621_0004553 Ga0495621_0004553_2723_3688 304
192 3300046664 Ga0495659_0007275 Ga0495659_0007275_534_1499 304
193 3300046684 Ga0495669_0027949 Ga0495669_0027949_338_1303 304
194 3300049521 Ga0501298_001778 Ga0501298_001778_1513_2481 304
195 3300049779 Ga0501283_005364 Ga0501283_005364_520_1488 304
196 3300005335 Ga0070666_10084609 Ga0070666_100846091 305
197 3300005338 Ga0068868_100046683 Ga0068868_1000466834 305
198 3300005353 Ga0070669_100001166 Ga0070669_10000116618 305
199 3300005436 Ga0070713_100052415 Ga0070713_1000524153 305
200 3300005440 Ga0070705_100016466 Ga0070705_1000164663 305
201 3300005441 Ga0070700_100011334 Ga0070700_1000113344 305
202 3300005444 Ga0070694_100111556 Ga0070694_1001115562 305
203 3300005445 Ga0070708_100003764 Ga0070708_1000037647 305
204 3300005445 Ga0070708_100177217 Ga0070708_1001772171 305
205 3300005459 Ga0068867_100001663 Ga0068867_1000016633 305
206 3300005459 Ga0068867_100271685 Ga0068867_1002716852 305
207 3300005466 Ga0070685_10217579 Ga0070685_102175791 305
208 3300005467 Ga0070706_100155599 Ga0070706_1001555992 305
209 3300005471 Ga0070698_100057094 Ga0070698_1000570943 305
210 3300005518 Ga0070699_100020455 Ga0070699_1000204552 305
211 3300005543 Ga0070672_100025572 Ga0070672_1000255722 305
212 3300005544 Ga0070686_100060126 Ga0070686_1000601262 305
213 3300005549 Ga0070704_100000329 Ga0070704_10000032911 305
214 3300005577 Ga0068857_100042680 Ga0068857_1000426801 305
215 3300005615 Ga0070702_100127349 Ga0070702_1001273492 305
216 3300005617 Ga0068859_100048087 Ga0068859_1000480872 305
217 3300005719 Ga0068861_100011546 Ga0068861_1000115463 305
218 3300005840 Ga0068870_10041688 Ga0068870_100416882 305
219 3300005842 Ga0068858_100253147 Ga0068858_1002531472 305
220 3300005844 Ga0068862_100048423 Ga0068862_1000484232 305
221 3300006358 Ga0068871_100000524 Ga0068871_10000052418 305
222 3300006931 Ga0097620_100048086 Ga0097620_1000480862 305
223 3300009094 Ga0111539_10031809 Ga0111539_100318091 305
224 3300009098 Ga0105245_10003679 Ga0105245_1000367910 305
225 3300009176 Ga0105242_10014878 Ga0105242_100148785 305
226 3300009177 Ga0105248_10176521 Ga0105248_101765212 305
227 3300009553 Ga0105249_10002731 Ga0105249_100027316 305
228 3300013297 Ga0157378_10000500 Ga0157378_100005005 305
229 3300013306 Ga0163162_10004996 Ga0163162_100049968 305
230 3300013308 Ga0157375_10056732 Ga0157375_100567324 305
231 3300014969 Ga0157376_10174120 Ga0157376_101741202 305
232 3300025908 Ga0207643_10037715 Ga0207643_100377152 305
233 3300025910 Ga0207684_10142767 Ga0207684_101427672 305
234 3300025918 Ga0207662_10007299 Ga0207662_100072992 305
235 3300025923 Ga0207681_10009341 Ga0207681_100093413 305
236 3300025927 Ga0207687_10006098 Ga0207687_100060983 305
237 3300025942 Ga0207689_10048673 Ga0207689_100486733 305
238 3300026089 Ga0207648_10002317 Ga0207648_100023178 305
239 3300026116 Ga0207674_10055905 Ga0207674_100559053 305
240 3300026118 Ga0207675_100006838 Ga0207675_1000068384 305
241 3300028380 Ga0268265_10001583 Ga0268265_100015837 305
242 3300028381 Ga0268264_10056266 Ga0268264_100562662 305
243 3300005435 Ga0070714_100082609 Ga0070714_1000826092 306
244 3300005436 Ga0070713_100135290 Ga0070713_1001352902 306
245 3300006871 Ga0075434_100251344 Ga0075434_1002513441 306
246 3300009174 Ga0105241_10252139 Ga0105241_102521392 306
247 3300025916 Ga0207663_10005219 Ga0207663_100052192 306
248 3300035695 Ga0373927_0199704 Ga0373927_0199704_11_958 306
249 3300037471 Ga0395905_0272965 Ga0395905_0272965_203_1174 306
250 3300046472 Ga0495580_0000647 Ga0495580_0000647_23155_24126 306
251 3300046472 Ga0495580_0049084 Ga0495580_0049084_818_1789 306
252 3300046681 Ga0495647_0060948 Ga0495647_0060948_200_1171 306
253 3300050512 nmdc:mga0n895_316248_c1 nmdc:mga0n895_316248_c1_148_1113 306
254 3300005435 Ga0070714_100001060 Ga0070714_1000010605 307
255 3300005437 Ga0070710_10002533 Ga0070710_100025335 307
256 3300005439 Ga0070711_100005472 Ga0070711_1000054724 307
257 3300005445 Ga0070708_100003921 Ga0070708_1000039217 307
258 3300005467 Ga0070706_100001489 Ga0070706_1000014895 307
259 3300005518 Ga0070699_100263693 Ga0070699_1002636932 307
260 3300005536 Ga0070697_100003966 Ga0070697_1000039667 307
261 3300005841 Ga0068863_100185143 Ga0068863_1001851432 307
262 3300006173 Ga0070716_100000047 Ga0070716_10000004732 307
263 3300006173 Ga0070716_100040361 Ga0070716_1000403612 307
264 3300006175 Ga0070712_100000637 Ga0070712_10000063718 307
265 3300013296 Ga0157374_10049110 Ga0157374_100491102 307
266 3300025898 Ga0207692_10008695 Ga0207692_100086952 307
267 3300025905 Ga0207685_10016120 Ga0207685_100161202 307
268 3300025910 Ga0207684_10008256 Ga0207684_100082564 307
269 3300025915 Ga0207693_10000727 Ga0207693_1000072717 307
270 3300025916 Ga0207663_10018808 Ga0207663_100188082 307
271 3300025928 Ga0207700_10080621 Ga0207700_100806212 307
272 3300025929 Ga0207664_10001047 Ga0207664_100010474 307
273 3300025939 Ga0207665_10000125 Ga0207665_1000012523 307
274 3300025939 Ga0207665_10002729 Ga0207665_100027292 307
275 3300026088 Ga0207641_10134350 Ga0207641_101343502 307
276 3300035086 Ga0373934_0012782 Ga0373934_0012782_926_1897 307
277 3300035111 Ga0373923_0039584 Ga0373923_0039584_232_1203 307
278 3300035116 Ga0373945_0045074 Ga0373945_0045074_466_1437 307
279 3300035118 Ga0373954_0069192 Ga0373954_0069192_461_1432 307
280 3300035119 Ga0373956_0008566 Ga0373956_0008566_563_1534 307
281 3300035170 Ga0373943_0000156 Ga0373943_0000156_15768_16739 307
282 3300035171 Ga0373946_0001066 Ga0373946_0001066_5410_6381 307
283 3300035172 Ga0373955_0029411 Ga0373955_0029411_1415_2386 307
284 3300035692 Ga0373935_0004164 Ga0373935_0004164_1849_2820 307
285 3300035695 Ga0373927_0000278 Ga0373927_0000278_24583_25554 307
286 3300035725 Ga0373947_0000052 Ga0373947_0000052_44573_45544 307
287 3300037068 Ga0373925_0000889 Ga0373925_0000889_3611_4582 307
288 3300046459 Ga0495629_0294424 Ga0495629_0294424_121_1092 307
289 3300046463 Ga0495653_0191464 Ga0495653_0191464_246_1217 307
290 3300046472 Ga0495580_0050753 Ga0495580_0050753_1567_2532 307
291 3300046472 Ga0495580_0071550 Ga0495580_0071550_187_1158 307
292 3300046511 Ga0495608_0068937 Ga0495608_0068937_563_1534 307
293 3300046517 Ga0495630_0254195 Ga0495630_0254195_152_1123 307
294 3300047319 Ga0495674_0117697 Ga0495674_0117697_563_1534 307
295 3300048088 Ga0495602_0068921 Ga0495602_0068921_1050_2021 307
296 3300048918 Ga0496115_0114846 Ga0496115_0114846_228_1199 307
297 3300053078 Ga0495612_0067558 Ga0495612_0067558_340_1311 307
298 3300005338 Ga0068868_100196991 Ga0068868_1001969912 308
299 3300005434 Ga0070709_10001805 Ga0070709_100018052 308
300 3300005435 Ga0070714_100000675 Ga0070714_10000067512 308
301 3300005436 Ga0070713_100000037 Ga0070713_10000003736 308
302 3300005439 Ga0070711_100000165 Ga0070711_10000016530 308
303 3300005616 Ga0068852_100453985 Ga0068852_1004539851 308
304 3300006028 Ga0070717_10005248 Ga0070717_100052484 308
305 3300006163 Ga0070715_10122067 Ga0070715_101220672 308
306 3300006175 Ga0070712_100000074 Ga0070712_10000007424 308
307 3300006175 Ga0070712_100222158 Ga0070712_1002221582 308
308 3300006237 Ga0097621_100024908 Ga0097621_1000249084 308
309 3300006237 Ga0097621_100076310 Ga0097621_1000763102 308
310 3300006358 Ga0068871_100051120 Ga0068871_1000511202 308
311 3300006358 Ga0068871_100191231 Ga0068871_1001912312 308
312 3300013296 Ga0157374_10059653 Ga0157374_100596533 308
313 3300013297 Ga0157378_10115059 Ga0157378_101150592 308
314 3300014325 Ga0163163_10094353 Ga0163163_100943533 308
315 3300014968 Ga0157379_10129843 Ga0157379_101298432 308
316 3300025905 Ga0207685_10115010 Ga0207685_101150101 308
317 3300025915 Ga0207693_10000004 Ga0207693_1000000434 308
318 3300025916 Ga0207663_10012168 Ga0207663_100121684 308
319 3300025924 Ga0207694_10074469 Ga0207694_100744692 308
320 3300025928 Ga0207700_10002030 Ga0207700_100020304 308
321 3300025929 Ga0207664_10014317 Ga0207664_100143172 308
322 3300025939 Ga0207665_10005403 Ga0207665_100054033 308
323 3300026035 Ga0207703_10279365 Ga0207703_102793652 308
324 3300037068 Ga0373925_0015177 Ga0373925_0015177_4240_5208 308
325 3300045051 Ga0451576_0138077 Ga0451576_0138077_1555_2520 308
326 3300045976 Ga0466967_0009481 Ga0466967_0009481_1306_2286 308
327 3300048903 Ga0496100_0007148 Ga0496100_0007148_2940_3908 308
328 3300048904 Ga0496101_0057738 Ga0496101_0057738_428_1396 308
329 3300048907 Ga0496104_0162100 Ga0496104_0162100_1095_2063 308
330 3300048909 Ga0496106_0088363 Ga0496106_0088363_1366_2334 308
331 3300048910 Ga0496107_0226430 Ga0496107_0226430_48_1016 308
332 3300048913 Ga0496110_0449145 Ga0496110_0449145_63_1028 308
333 3300048917 Ga0496114_0575516 Ga0496114_0575516_11_982 308
334 3300048918 Ga0496115_0004044 Ga0496115_0004044_9457_10425 308
335 3300053085 Ga0495619_0314568 Ga0495619_0314568_35_1003 308
336 3300005434 Ga0070709_10010112 Ga0070709_100101123 309
337 3300005436 Ga0070713_100033550 Ga0070713_1000335504 309
338 3300005436 Ga0070713_100142904 Ga0070713_1001429042 309
339 3300006028 Ga0070717_10209325 Ga0070717_102093252 309
340 3300006175 Ga0070712_100049288 Ga0070712_1000492882 309
341 3300025915 Ga0207693_10051351 Ga0207693_100513512 309
342 3300030878 Ga0265770_1000977 Ga0265770_10009773 309
343 3300031090 Ga0265760_10000110 Ga0265760_1000011011 309
344 3300026078 Ga0207702_10500609 Ga0207702_105006091 310
345 3300005290 Ga0065712_10147271 Ga0065712_101472712 311
346 3300005327 Ga0070658_10029968 Ga0070658_100299684 311
347 3300005329 Ga0070683_100010459 Ga0070683_1000104596 311
348 3300005337 Ga0070682_100081278 Ga0070682_1000812782 311
349 3300005338 Ga0068868_100055284 Ga0068868_1000552842 311
350 3300005339 Ga0070660_100168390 Ga0070660_1001683901 311
351 3300005353 Ga0070669_100086454 Ga0070669_1000864542 311
352 3300005355 Ga0070671_100057183 Ga0070671_1000571832 311
353 3300005366 Ga0070659_100034313 Ga0070659_1000343133 311
354 3300005455 Ga0070663_100268588 Ga0070663_1002685882 311
355 3300005458 Ga0070681_10257650 Ga0070681_102576502 311
356 3300005530 Ga0070679_100172668 Ga0070679_1001726682 311
357 3300005539 Ga0068853_100026908 Ga0068853_1000269082 311
358 3300005563 Ga0068855_100014986 Ga0068855_1000149864 311
359 3300005564 Ga0070664_100003986 Ga0070664_10000398611 311
360 3300005577 Ga0068857_100181265 Ga0068857_1001812652 311
361 3300005578 Ga0068854_100014977 Ga0068854_1000149772 311
362 3300005614 Ga0068856_100179931 Ga0068856_1001799312 311
363 3300005616 Ga0068852_100079745 Ga0068852_1000797452 311
364 3300005834 Ga0068851_10039020 Ga0068851_100390202 311
365 3300009093 Ga0105240_10030490 Ga0105240_100304904 311
366 3300009545 Ga0105237_10026241 Ga0105237_100262412 311
367 3300009551 Ga0105238_10029958 Ga0105238_100299582 311
368 3300010375 Ga0105239_10026103 Ga0105239_100261034 311
369 3300013104 Ga0157370_10492840 Ga0157370_104928401 311
370 3300013105 Ga0157369_10066176 Ga0157369_100661763 311
371 3300013307 Ga0157372_10084436 Ga0157372_100844363 311
372 3300014497 Ga0182008_10039405 Ga0182008_100394052 311
373 3300015262 Ga0182007_10002600 Ga0182007_100026002 311
374 3300025912 Ga0207707_10197804 Ga0207707_101978042 311
375 3300025913 Ga0207695_10084879 Ga0207695_100848792 311
376 3300025914 Ga0207671_10206444 Ga0207671_102064442 311
377 3300025919 Ga0207657_10001448 Ga0207657_100014487 311
378 3300025921 Ga0207652_10162252 Ga0207652_101622522 311
379 3300025926 Ga0207659_10220624 Ga0207659_102206242 311
380 3300025932 Ga0207690_10045479 Ga0207690_100454792 311
381 3300025933 Ga0207706_10002974 Ga0207706_1000297414 311
382 3300025945 Ga0207679_10007345 Ga0207679_100073456 311
383 3300025949 Ga0207667_10088931 Ga0207667_100889313 311
384 3300025981 Ga0207640_10155255 Ga0207640_101552552 311
385 3300026067 Ga0207678_10414189 Ga0207678_104141892 311
386 3300026078 Ga0207702_10222276 Ga0207702_102222762 311
387 3300026088 Ga0207641_10125211 Ga0207641_101252112 311
388 3300026116 Ga0207674_10205872 Ga0207674_102058722 311
389 3300048903 Ga0496100_0051058 Ga0496100_0051058_384_1352 311
390 3300048904 Ga0496101_0051203 Ga0496101_0051203_1877_2845 311
391 3300048906 Ga0496103_0065522 Ga0496103_0065522_238_1206 311
392 3300048907 Ga0496104_0090083 Ga0496104_0090083_1233_2201 311
393 3300048909 Ga0496106_0011472 Ga0496106_0011472_3752_4720 311
394 3300048911 Ga0496108_0001985 Ga0496108_0001985_5616_6584 311
395 3300048912 Ga0496109_0072225 Ga0496109_0072225_595_1563 311
396 3300048914 Ga0496111_0009834 Ga0496111_0009834_4041_5009 311
397 3300048915 Ga0496112_0208575 Ga0496112_0208575_27_995 311
398 3300048916 Ga0496113_0004198 Ga0496113_0004198_2408_3376 311
399 3300059503 Ga0587080_006974 Ga0587080_006974_432_1400 311
400 3300059508 Ga0587088_003551 Ga0587088_003551_486_1454 311
401 3300059640 Ga0587067_005152 Ga0587067_005152_403_1371 311
402 3300059645 Ga0587076_004106 Ga0587076_004106_491_1459 311
403 3300059649 Ga0587102_004883 Ga0587102_004883_125_1093 311
404 3300059652 Ga0587107_003729 Ga0587107_003729_235_1203 311
405 3300060344 Ga0587071_007776 Ga0587071_007776_35_1003 311
406 3300005536 Ga0070697_100000056 Ga0070697_1000000565 312
407 3300014969 Ga0157376_10001020 Ga0157376_100010205 312
408 3300031852 Ga0307410_10001023 Ga0307410_100010236 313
409 3300005336 Ga0070680_100383901 Ga0070680_1003839011 314
410 3300005564 Ga0070664_100059254 Ga0070664_1000592543 314
411 3300009174 Ga0105241_10003926 Ga0105241_100039266 314
412 3300013100 Ga0157373_10007012 Ga0157373_100070122 314
413 3300013104 Ga0157370_10065909 Ga0157370_100659092 314
414 3300013105 Ga0157369_10036072 Ga0157369_100360724 314
415 3300013307 Ga0157372_10015125 Ga0157372_100151256 314
416 3300025911 Ga0207654_10008510 Ga0207654_100085102 314
417 3300025912 Ga0207707_10171059 Ga0207707_101710592 314
418 3300026078 Ga0207702_10004940 Ga0207702_100049405 314
419 3300035083 Ga0373926_0053341 Ga0373926_0053341_234_1205 314
420 3300035113 Ga0373936_0004855 Ga0373936_0004855_1307_2278 314
421 3300035692 Ga0373935_0012715 Ga0373935_0012715_976_1947 314
422 3300035725 Ga0373947_0042557 Ga0373947_0042557_299_1270 314
423 3300037068 Ga0373925_0038210 Ga0373925_0038210_2267_3238 314
424 3300046459 Ga0495629_0040662 Ga0495629_0040662_1718_2689 314
425 3300046472 Ga0495580_0001660 Ga0495580_0001660_3073_4044 314
426 3300046517 Ga0495630_0137610 Ga0495630_0137610_623_1594 314
427 3300046543 Ga0495645_0106076 Ga0495645_0106076_765_1736 314
428 3300046683 Ga0495658_0013294 Ga0495658_0013294_1691_2662 314
429 3300047319 Ga0495674_0014256 Ga0495674_0014256_6108_7079 314
430 3300053077 Ga0495601_0047528 Ga0495601_0047528_686_1657 314
431 3300044673 Ga0453683_0160749 Ga0453683_0160749_437_1408 315
432 3300045051 Ga0451576_0015550 Ga0451576_0015550_4731_5690 315
433 3300005295 Ga0065707_10008787 Ga0065707_100087874 316
434 3300005355 Ga0070671_100006856 Ga0070671_1000068566 316
435 3300005355 Ga0070671_100426140 Ga0070671_1004261402 316
436 3300005458 Ga0070681_10050993 Ga0070681_100509932 316
437 3300005468 Ga0070707_100034283 Ga0070707_1000342833 316
438 3300005536 Ga0070697_100003837 Ga0070697_1000038374 316
439 3300005536 Ga0070697_100162717 Ga0070697_1001627171 316
440 3300005545 Ga0070695_100056040 Ga0070695_1000560402 316
441 3300005564 Ga0070664_100022756 Ga0070664_1000227565 316
442 3300005937 Ga0081455_10060619 Ga0081455_100606192 316
443 3300009094 Ga0111539_10125261 Ga0111539_101252612 316
444 3300009147 Ga0114129_10221502 Ga0114129_102215022 316
445 3300013105 Ga0157369_10407505 Ga0157369_104075052 316
446 3300014325 Ga0163163_10381575 Ga0163163_103815752 316
447 3300025912 Ga0207707_10025099 Ga0207707_100250992 316
448 3300025931 Ga0207644_10165012 Ga0207644_101650122 316
449 3300032133 Ga0316583_10071050 Ga0316583_100710501 316
450 3300046664 Ga0495659_0088404 Ga0495659_0088404_190_1152 316
451 3300048907 Ga0496104_0096777 Ga0496104_0096777_1673_2638 316
452 3300048916 Ga0496113_0042640 Ga0496113_0042640_1351_2316 316
453 3300050507 nmdc:mga05p37_156261_c1 nmdc:mga05p37_156261_c1_1176_2138 316
454 3300007076 Ga0075435_100020201 Ga0075435_1000202012 317
455 3300025915 Ga0207693_10043153 Ga0207693_100431533 317
456 3300032002 Ga0307416_100456816 Ga0307416_1004568162 318
457 3300032005 Ga0307411_10154864 Ga0307411_101548642 318
458 3300059426 Ga0590077_004448 Ga0590077_004448_825_1796 318
459 3300005436 Ga0070713_100049297 Ga0070713_1000492973 319
460 3300005439 Ga0070711_100040247 Ga0070711_1000402473 319
461 3300005445 Ga0070708_100512690 Ga0070708_1005126901 319
462 3300006028 Ga0070717_10002516 Ga0070717_100025169 319
463 3300006358 Ga0068871_100086670 Ga0068871_1000866702 319
464 3300035695 Ga0373927_0022075 Ga0373927_0022075_2525_3502 319
465 3300037068 Ga0373925_0002168 Ga0373925_0002168_5432_6409 319
466 3300048915 Ga0496112_0032512 Ga0496112_0032512_3901_4881 319
467 3300059421 Ga0590071_000396 Ga0590071_000396_11370_12344 319
468 3300059423 Ga0590074_000025 Ga0590074_000025_2445_3419 319
469 3300059424 Ga0590075_000785 Ga0590075_000785_2953_3927 319
470 3300031548 Ga0307408_100022297 Ga0307408_1000222975 320
471 3300031824 Ga0307413_10057861 Ga0307413_100578612 320
472 3300031824 Ga0307413_10203916 Ga0307413_102039162 320
473 3300031852 Ga0307410_10035954 Ga0307410_100359542 320
474 3300031901 Ga0307406_10187756 Ga0307406_101877561 320
475 3300031903 Ga0307407_10005601 Ga0307407_100056013 320
476 3300031903 Ga0307407_10012830 Ga0307407_100128302 320
477 3300031911 Ga0307412_10216814 Ga0307412_102168142 320
478 3300031995 Ga0307409_100010358 Ga0307409_1000103585 320
479 3300032002 Ga0307416_100002617 Ga0307416_10000261710 320
480 3300032004 Ga0307414_10008759 Ga0307414_100087594 320
481 3300032005 Ga0307411_10118424 Ga0307411_101184242 320
482 3300032126 Ga0307415_100008949 Ga0307415_1000089494 320
483 3300045049 Ga0466959_0003780 Ga0466959_0003780_327_1292 320
484 3300046472 Ga0495580_0005174 Ga0495580_0005174_3206_4171 320
485 3300059421 Ga0590071_000959 Ga0590071_000959_3509_4486 320
486 3300059424 Ga0590075_000757 Ga0590075_000757_6268_7245 320
487 3300059426 Ga0590077_002191 Ga0590077_002191_594_1571 320
488 3300005467 Ga0070706_100043917 Ga0070706_1000439172 321
489 3300005468 Ga0070707_100013712 Ga0070707_1000137124 321
490 3300005471 Ga0070698_100064173 Ga0070698_1000641733 321
491 3300005536 Ga0070697_100083286 Ga0070697_1000832864 321
492 3300005536 Ga0070697_100093760 Ga0070697_1000937602 321
493 3300006028 Ga0070717_10000853 Ga0070717_100008538 321
494 3300006173 Ga0070716_100006880 Ga0070716_1000068802 321
495 3300006852 Ga0075433_10001640 Ga0075433_100016402 321
496 3300006871 Ga0075434_100002201 Ga0075434_1000022014 321
497 3300006914 Ga0075436_100024644 Ga0075436_1000246442 321
498 3300007076 Ga0075435_100001852 Ga0075435_10000185210 321
499 3300009147 Ga0114129_10485348 Ga0114129_104853482 321
500 3300031090 Ga0265760_10002688 Ga0265760_100026882 321
501 3300039438 Ga0436360_0212334 Ga0436360_0212334_779_1750 321
502 3300042876 Ga0451577_0016613 Ga0451577_0016613_2378_3355 321
503 3300046472 Ga0495580_0030628 Ga0495580_0030628_1908_2876 321
504 3300050512 nmdc:mga0n895_85245_c1 nmdc:mga0n895_85245_c1_821_1789 321
505 3300050513 nmdc:mga0rr50_4157_c1 nmdc:mga0rr50_4157_c1_1920_2888 321
506 3300050514 nmdc:mga08x19_4064_c1 nmdc:mga08x19_4064_c1_7280_8248 321
507 3300050515 nmdc:mga0a205_1358_c1 nmdc:mga0a205_1358_c1_9381_10349 321
508 3300050515 nmdc:mga0a205_300575_c1 nmdc:mga0a205_300575_c1_427_1407 321
509 3300005445 Ga0070708_100001600 Ga0070708_10000160012 322
510 3300005467 Ga0070706_100009224 Ga0070706_1000092244 322
511 3300005468 Ga0070707_100023057 Ga0070707_1000230574 322
512 3300005471 Ga0070698_100005160 Ga0070698_10000516013 322
513 3300005518 Ga0070699_100000358 Ga0070699_10000035819 322
514 3300005536 Ga0070697_100013301 Ga0070697_1000133016 322
515 3300024227 Ga0228598_1003519 Ga0228598_10035194 322
516 3300025910 Ga0207684_10001076 Ga0207684_100010764 322
517 3300025922 Ga0207646_10003502 Ga0207646_1000350211 322
518 3300000546 LJNas_1000414 LJNas_10004142 323
519 3300005445 Ga0070708_100006654 Ga0070708_1000066545 323
520 3300005459 Ga0068867_100029046 Ga0068867_1000290462 323
521 3300005539 Ga0068853_100085452 Ga0068853_1000854522 323
522 3300006028 Ga0070717_10124927 Ga0070717_101249271 323
523 3300009545 Ga0105237_10018819 Ga0105237_100188194 323
524 3300010375 Ga0105239_10026729 Ga0105239_100267294 323
525 3300013296 Ga0157374_10006942 Ga0157374_100069425 323
526 3300013297 Ga0157378_10060459 Ga0157378_100604592 323
527 3300013307 Ga0157372_10516318 Ga0157372_105163182 323
528 3300025904 Ga0207647_10017506 Ga0207647_100175064 323
529 3300025942 Ga0207689_10001035 Ga0207689_1000103516 323
530 3300031247 Ga0265340_10034618 Ga0265340_100346182 323
531 3300031711 Ga0265314_10148244 Ga0265314_101482442 323
532 3300035086 Ga0373934_0110292 Ga0373934_0110292_99_1070 323
533 3300035118 Ga0373954_0072593 Ga0373954_0072593_362_1333 323
534 3300035172 Ga0373955_0070244 Ga0373955_0070244_46_1017 323
535 3300036401 Ga0373937_0063490 Ga0373937_0063490_1891_2862 323
536 3300048905 Ga0496102_0418245 Ga0496102_0418245_11_985 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

160

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2whn-assembly2.cif.gz_B n-terminal domain from the pilc type iv pilus biogenesis protein 0.8512 149 251
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8492 149 251
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8446 149 261
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8411 149 256
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8307 148 255
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8765 156 279 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8516 156 279 1.20.81.30
2whnB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8512 149 251 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.833 147 248 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8105 153 258 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9124 90 323 GO:0005886
AF-A0A535R8U2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9051 90 323 GO:0005886
AF-A0A1Q7FJ45-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8893 87 323 GO:0005886
AF-A0A3C0EKV9-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8875 65 323 GO:0005886
AF-A0A3D0N5B2-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8708 90 323 GO:0005886

Feature Viewer

pLDDT pTM Quality
78.28 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map