F460656

General Info

Members Datasets Scaffolds Average Seq Length
535 268 519 175

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10000483|Ga0157373_100004833
Length 197
Sequence MRAEIGDPEREPLLWAKSAPRRKLKGEMEVLLTEQEIAGRVEALAAEIAPRVDDETVAVCLLTGGIWFTADLTRALGRLGRNLRFDALWLSSYKDDRASSGRCQVRADLQRPLSGRKALIVDDVFDTGLSLSEAARLVRDAGASEVLTAVFARKPWPSARAIEPDFVAWEAPARFLVGYGMDSAGAMRGLPYIGALD

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
5 2643221640 Caulobacter sp. Root342 Isolate Unclassified
6 2643221642 Caulobacter sp. Root343 Isolate Unclassified
7 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
8 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
9 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
10 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
11 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
12 2849560528 Caulobacter zeae 410 Isolate Unclassified
13 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
14 2851153111 Caulobacter radicis 736 Isolate Unclassified
15 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
16 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
263 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
264 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
265 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
266 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
267 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.37
Nodule 0.37
Rhizoplane 3.74
Rhizosphere 67.66
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10082870 3300003215 Bacteria 794
2 rootH1_10010331 3300003316 Bacteria 2703
3 rootL2_10104603 3300003322 Bacteria 2007
4 Ga0055536_1000271 3300003781 Bacteria 39460
5 Ga0055536_1000307 3300003781 Bacteria 36826
6 Ga0055530_10000026 3300003791 Bacteria 129960
7 Ga0055530_10016026 3300003791 Bacteria 2415
8 Ga0055540_1034941 3300003792 Bacteria 1127
9 Ga0055531_10000899 3300003794 Bacteria 24257
10 Ga0055531_10001385 3300003794 Bacteria 17985
11 Ga0055531_10002897 3300003794 Bacteria 11172
12 Ga0055531_10036234 3300003794 Bacteria 1526
13 Ga0055531_10045156 3300003794 Bacteria 1226
14 Ga0065165_1001058 3300005262 Bacteria 32976
15 Ga0070670_100019351 3300005331 Bacteria 5841
16 Ga0070670_101095779 3300005331 Bacteria 726
17 Ga0070666_10004481 3300005335 Bacteria 8511
18 Ga0070666_10316287 3300005335 Bacteria 1113
19 Ga0070680_100090930 3300005336 Unclassified 2526
20 Ga0070680_100116049 3300005336 Bacteria 2231
21 Ga0070660_100025252 3300005339 Bacteria 4415
22 Ga0070660_100038099 3300005339 Bacteria 3647
23 Ga0070691_10148878 3300005341 Bacteria 1198
24 Ga0070668_100000733 3300005347 Bacteria 22420
25 Ga0070668_100001360 3300005347 Bacteria 17507
26 Ga0070668_100003875 3300005347 Bacteria 11044
27 Ga0070668_100022966 3300005347 Bacteria 4716
28 Ga0070668_100052603 3300005347 Bacteria 3139
29 Ga0070669_100014242 3300005353 Bacteria 5658
30 Ga0070669_100339889 3300005353 Bacteria 1216
31 Ga0070669_101093842 3300005353 Bacteria 686
32 Ga0070671_100001866 3300005355 Bacteria 16097
33 Ga0070671_100115923 3300005355 Bacteria 2252
34 Ga0070671_100430173 3300005355 Bacteria 1131
35 Ga0070671_100462822 3300005355 Unclassified 1088
36 Ga0070659_100000143 3300005366 Bacteria 55183
37 Ga0070659_100005171 3300005366 Bacteria 9360
38 Ga0070659_100033290 3300005366 Bacteria 4002
39 Ga0070667_100000146 3300005367 Bacteria 88847
40 Ga0070667_100007034 3300005367 Bacteria 9355
41 Ga0070667_100008886 3300005367 Bacteria 8316
42 Ga0070667_100020951 3300005367 Bacteria 5430
43 Ga0070663_100416060 3300005455 Bacteria 1102
44 Ga0070681_10019225 3300005458 Bacteria 6836
45 Ga0070681_10056881 3300005458 Bacteria 3892
46 Ga0070681_10371719 3300005458 Bacteria 1340
47 Ga0070685_10011937 3300005466 Bacteria 4555
48 Ga0070679_100142727 3300005530 Bacteria 2373
49 Ga0070679_100243060 3300005530 Bacteria 1757
50 Ga0068853_100010326 3300005539 Bacteria 7552
51 Ga0068853_100178453 3300005539 Bacteria 1925
52 Ga0070665_100000144 3300005548 Bacteria 132302
53 Ga0070665_100001180 3300005548 Bacteria 31967
54 Ga0070665_100002958 3300005548 Bacteria 18347
55 Ga0070665_100020082 3300005548 Bacteria 6707
56 Ga0068855_100035613 3300005563 Bacteria 5929
57 Ga0068855_100044018 3300005563 Bacteria 5285
58 Ga0068855_100094249 3300005563 Bacteria 3452
59 Ga0070664_100034800 3300005564 Bacteria 4227
60 Ga0070664_100491603 3300005564 Bacteria 1130
61 Ga0070664_100578948 3300005564 Bacteria 1040
62 Ga0068857_100719809 3300005577 Bacteria 949
63 Ga0068854_100634187 3300005578 Bacteria 916
64 Ga0068856_100532527 3300005614 Bacteria 1196
65 Ga0068856_100836017 3300005614 Bacteria 940
66 Ga0068856_100928254 3300005614 Bacteria 889
67 Ga0068852_101047648 3300005616 Unclassified 835
68 Ga0068859_100000437 3300005617 Bacteria 41851
69 Ga0068859_100006364 3300005617 Bacteria 11977
70 Ga0068859_100374165 3300005617 Bacteria 1520
71 Ga0068859_100604081 3300005617 Bacteria 1190
72 Ga0068864_100000313 3300005618 Bacteria 42907
73 Ga0068864_100000503 3300005618 Bacteria 33698
74 Ga0068864_100054401 3300005618 Bacteria 3454
75 Ga0068864_100078305 3300005618 Bacteria 2893
76 Ga0068864_100117042 3300005618 Bacteria 2379
77 Ga0068864_100824166 3300005618 Bacteria 913
78 Ga0068864_101287707 3300005618 Bacteria 731
79 Ga0068861_100271154 3300005719 Bacteria 1457
80 Ga0068863_100000158 3300005841 Bacteria 71918
81 Ga0068863_100000253 3300005841 Bacteria 56367
82 Ga0068863_100002531 3300005841 Bacteria 18136
83 Ga0068863_100018754 3300005841 Bacteria 6620
84 Ga0068863_100023756 3300005841 Bacteria 5848
85 Ga0068863_100093271 3300005841 Bacteria 2857
86 Ga0068863_100288099 3300005841 Bacteria 1592
87 Ga0068858_100000746 3300005842 Bacteria 34090
88 Ga0068858_100003737 3300005842 Bacteria 15059
89 Ga0068858_100028444 3300005842 Bacteria 5192
90 Ga0068858_100277338 3300005842 Bacteria 1596
91 Ga0068860_100000234 3300005843 Bacteria 85182
92 Ga0068860_100000308 3300005843 Bacteria 67784
93 Ga0068860_100005340 3300005843 Bacteria 13040
94 Ga0068860_100032620 3300005843 Bacteria 5003
95 Ga0068860_101566425 3300005843 Bacteria 681
96 Ga0068862_100000129 3300005844 Bacteria 88141
97 Ga0068862_100003825 3300005844 Bacteria 12817
98 Ga0068862_100209629 3300005844 Bacteria 1760
99 Ga0070717_11186826 3300006028 Bacteria 695
100 Ga0075365_10412176 3300006038 Bacteria 954
101 Ga0075363_100063502 3300006048 Bacteria 1993
102 Ga0075364_10000411 3300006051 Bacteria 21397
103 Ga0075367_10037498 3300006178 Bacteria 2817
104 Ga0075369_10013650 3300006186 Bacteria 3231
105 Ga0075369_10050924 3300006186 Bacteria 1792
106 Ga0075366_10146406 3300006195 Bacteria 1429
107 Ga0097621_100951954 3300006237 Bacteria 802
108 Ga0075370_10058310 3300006353 Bacteria 2195
109 Ga0075370_10397428 3300006353 Bacteria 827
110 Ga0068871_100722356 3300006358 Bacteria 914
111 Ga0068865_100034685 3300006881 Bacteria 3387
112 Ga0097620_100000437 3300006931 Bacteria 41851
113 Ga0097620_100006364 3300006931 Bacteria 11977
114 Ga0097620_100374163 3300006931 Bacteria 1520
115 Ga0097620_100604029 3300006931 Bacteria 1190
116 Ga0079104_1015810 3300006946 Bacteria 2225
117 Ga0105240_10022612 3300009093 Bacteria 8328
118 Ga0105240_10071568 3300009093 Bacteria 4288
119 Ga0105240_10102063 3300009093 Bacteria 3487
120 Ga0105240_11564385 3300009093 Unclassified 690
121 Ga0105247_10258579 3300009101 Bacteria 1193
122 Ga0105248_10000489 3300009177 Bacteria 45002
123 Ga0105248_10011458 3300009177 Bacteria 9771
124 Ga0105248_10036925 3300009177 Bacteria 5464
125 Ga0105248_10046013 3300009177 Bacteria 4892
126 Ga0105248_10065826 3300009177 Bacteria 4069
127 Ga0105248_10368099 3300009177 Bacteria 1618
128 Ga0105237_10346428 3300009545 Bacteria 1490
129 Ga0105238_10033188 3300009551 Bacteria 5253
130 Ga0105238_10039857 3300009551 Bacteria 4762
131 Ga0105238_10248466 3300009551 Bacteria 1757
132 Ga0105238_10290071 3300009551 Bacteria 1618
133 Ga0105238_10887696 3300009551 Bacteria 909
134 Ga0105238_11545175 3300009551 Bacteria 693
135 Ga0105249_10009776 3300009553 Bacteria 8402
136 Ga0105249_10102394 3300009553 Bacteria 2695
137 Ga0105249_10157395 3300009553 Bacteria 2192
138 Ga0105249_10674899 3300009553 Bacteria 1092
139 Ga0105239_10070776 3300010375 Bacteria 3832
140 Ga0105239_10436328 3300010375 Bacteria 1485
141 Ga0105239_10474680 3300010375 Bacteria 1420
142 Ga0157373_10000482 3300013100 Bacteria 31638
143 Ga0157373_10000483 3300013100 Bacteria 31535
144 Ga0157370_10249794 3300013104 Bacteria 1641
145 Ga0157369_10499209 3300013105 Bacteria 1259
146 Ga0157374_10234511 3300013296 Bacteria 1803
147 Ga0163162_10240161 3300013306 Bacteria 1943
148 Ga0163162_10267262 3300013306 Bacteria 1842
149 Ga0157372_10477738 3300013307 Bacteria 1453
150 Ga0157375_10036236 3300013308 Bacteria 4717
151 Ga0163163_10026201 3300014325 Bacteria 5569
152 Ga0163163_10071631 3300014325 Bacteria 3454
153 Ga0163163_10156347 3300014325 Bacteria 2324
154 Ga0163163_10188185 3300014325 Bacteria 2112
155 Ga0163163_10277552 3300014325 Bacteria 1727
156 Ga0163163_10534393 3300014325 Bacteria 1235
157 Ga0157380_10182384 3300014326 Bacteria 1845
158 Ga0157377_10312658 3300014745 Bacteria 1041
159 Ga0157379_10000967 3300014968 Bacteria 23322
160 Ga0157379_10068713 3300014968 Bacteria 3167
161 Ga0157379_10101168 3300014968 Bacteria 2587
162 Ga0213876_10101676 3300021384 Bacteria 1524
163 Ga0213875_10191657 3300021388 Bacteria 961
164 Ga0209026_1032207 3300025250 Bacteria 775
165 Ga0209026_1040267 3300025250 Bacteria 678
166 Ga0209148_1004982 3300025254 Bacteria 3129
167 Ga0209676_1000224 3300025292 Bacteria 124160
168 Ga0209676_1000422 3300025292 Bacteria 74541
169 Ga0209758_1002891 3300025297 Bacteria 16602
170 Ga0209050_1000029 3300025298 Bacteria 465801
171 Ga0209050_1000463 3300025298 Bacteria 72380
172 Ga0209050_1001193 3300025298 Bacteria 30547
173 Ga0209050_1001204 3300025298 Bacteria 30367
174 Ga0209256_1010255 3300025299 Bacteria 3953
175 Ga0209051_1008867 3300025303 Bacteria 5262
176 Ga0209257_1000152 3300025304 Bacteria 189432
177 Ga0209257_1000512 3300025304 Bacteria 67436
178 Ga0209257_1001271 3300025304 Bacteria 30931
179 Ga0209257_1026554 3300025304 Bacteria 1948
180 Ga0207710_10133530 3300025900 Bacteria 1193
181 Ga0207680_10003990 3300025903 Bacteria 6971
182 Ga0207680_10072151 3300025903 Bacteria 2143
183 Ga0207680_10104166 3300025903 Bacteria 1828
184 Ga0207705_10010119 3300025909 Bacteria 6866
185 Ga0207705_10134293 3300025909 Bacteria 1844
186 Ga0207654_10026762 3300025911 Bacteria 3127
187 Ga0207707_10021262 3300025912 Bacteria 5671
188 Ga0207707_10197451 3300025912 Bacteria 1754
189 Ga0207695_10001763 3300025913 Bacteria 34269
190 Ga0207695_10005400 3300025913 Bacteria 16971
191 Ga0207695_10010025 3300025913 Bacteria 11633
192 Ga0207695_10091696 3300025913 Bacteria 3051
193 Ga0207695_10448088 3300025913 Bacteria 1174
194 Ga0207695_10453311 3300025913 Bacteria 1166
195 Ga0207695_11059629 3300025913 Unclassified 690
196 Ga0207660_10065045 3300025917 Bacteria 2634
197 Ga0207660_10077752 3300025917 Bacteria 2430
198 Ga0207657_10010954 3300025919 Bacteria 9018
199 Ga0207657_10048620 3300025919 Bacteria 3702
200 Ga0207657_10584929 3300025919 Bacteria 872
201 Ga0207649_10895664 3300025920 Unclassified 695
202 Ga0207652_10049193 3300025921 Bacteria 3608
203 Ga0207681_10019464 3300025923 Bacteria 4288
204 Ga0207681_10317829 3300025923 Bacteria 1237
205 Ga0207681_10961036 3300025923 Bacteria 716
206 Ga0207694_10013384 3300025924 Bacteria 6179
207 Ga0207694_10037272 3300025924 Bacteria 3734
208 Ga0207694_10131137 3300025924 Bacteria 2009
209 Ga0207694_10173450 3300025924 Bacteria 1747
210 Ga0207694_10196787 3300025924 Bacteria 1639
211 Ga0207694_10781388 3300025924 Bacteria 806
212 Ga0207694_10895722 3300025924 Bacteria 750
213 Ga0207650_10000064 3300025925 Bacteria 142969
214 Ga0207650_10011859 3300025925 Bacteria 6005
215 Ga0207650_10012174 3300025925 Bacteria 5931
216 Ga0207650_10432680 3300025925 Bacteria 1093
217 Ga0207650_10603840 3300025925 Bacteria 923
218 Ga0207687_10109059 3300025927 Bacteria 2050
219 Ga0207644_10001126 3300025931 Bacteria 17127
220 Ga0207644_10044081 3300025931 Bacteria 3168
221 Ga0207644_10047989 3300025931 Bacteria 3050
222 Ga0207644_10904597 3300025931 Bacteria 740
223 Ga0207644_10921842 3300025931 Bacteria 732
224 Ga0207690_10010748 3300025932 Bacteria 5455
225 Ga0207690_10060693 3300025932 Bacteria 2568
226 Ga0207690_10120154 3300025932 Bacteria 1907
227 Ga0207706_10502381 3300025933 Unclassified 1047
228 Ga0207704_10002245 3300025938 Bacteria 8672
229 Ga0207704_11061664 3300025938 Bacteria 687
230 Ga0207711_10001700 3300025941 Bacteria 20250
231 Ga0207711_10002832 3300025941 Bacteria 15237
232 Ga0207711_10004706 3300025941 Bacteria 11596
233 Ga0207711_10035666 3300025941 Bacteria 4218
234 Ga0207711_10047787 3300025941 Bacteria 3660
235 Ga0207711_10548793 3300025941 Bacteria 1078
236 Ga0207679_10001519 3300025945 Bacteria 14513
237 Ga0207679_10526318 3300025945 Bacteria 1058
238 Ga0207667_10021083 3300025949 Bacteria 7227
239 Ga0207667_10024032 3300025949 Bacteria 6701
240 Ga0207667_10024243 3300025949 Bacteria 6665
241 Ga0207667_10048194 3300025949 Bacteria 4506
242 Ga0207667_10112218 3300025949 Bacteria 2811
243 Ga0207667_10265930 3300025949 Bacteria 1753
244 Ga0207667_10789991 3300025949 Bacteria 947
245 Ga0207651_10035437 3300025960 Bacteria 3245
246 Ga0207712_10002582 3300025961 Bacteria 11640
247 Ga0207712_10123258 3300025961 Bacteria 1964
248 Ga0207668_10000154 3300025972 Bacteria 47517
249 Ga0207668_10000379 3300025972 Bacteria 28234
250 Ga0207668_10024993 3300025972 Bacteria 3860
251 Ga0207668_10067921 3300025972 Bacteria 2532
252 Ga0207668_10306512 3300025972 Bacteria 1312
253 Ga0207640_10533573 3300025981 Bacteria 983
254 Ga0207640_10533705 3300025981 Bacteria 983
255 Ga0207658_10001071 3300025986 Bacteria 22181
256 Ga0207658_10002901 3300025986 Bacteria 12291
257 Ga0207658_10009216 3300025986 Bacteria 6692
258 Ga0207658_10559439 3300025986 Bacteria 1024
259 Ga0207703_10000598 3300026035 Bacteria 36651
260 Ga0207703_10008480 3300026035 Bacteria 8122
261 Ga0207703_10022519 3300026035 Bacteria 4943
262 Ga0207703_10040750 3300026035 Bacteria 3719
263 Ga0207703_10363726 3300026035 Bacteria 1335
264 Ga0207639_10007364 3300026041 Bacteria 7503
265 Ga0207639_10107998 3300026041 Bacteria 2262
266 Ga0207639_10535913 3300026041 Bacteria 1073
267 Ga0207639_11029634 3300026041 Unclassified 771
268 Ga0207678_10414111 3300026067 Bacteria 1168
269 Ga0207702_10438312 3300026078 Bacteria 1266
270 Ga0207702_10656129 3300026078 Bacteria 1032
271 Ga0207641_10000634 3300026088 Bacteria 38355
272 Ga0207641_10000687 3300026088 Bacteria 36473
273 Ga0207641_10013816 3300026088 Bacteria 6622
274 Ga0207641_10031521 3300026088 Bacteria 4397
275 Ga0207641_10089677 3300026088 Bacteria 2688
276 Ga0207641_10411472 3300026088 Bacteria 1300
277 Ga0207676_10000131 3300026095 Bacteria 66092
278 Ga0207676_10001356 3300026095 Bacteria 18203
279 Ga0207676_10016556 3300026095 Bacteria 5339
280 Ga0207676_10317426 3300026095 Bacteria 1429
281 Ga0207675_100250571 3300026118 Bacteria 1714
282 Ga0207683_10519105 3300026121 Bacteria 1101
283 Ga0207698_11315540 3300026142 Bacteria 737
284 Ga0209281_1020179 3300027111 Bacteria 1306
285 Ga0209999_1005526 3300027543 Bacteria 2273
286 Ga0209983_1006282 3300027665 Bacteria 2447
287 Ga0209813_10021188 3300027866 Bacteria 1825
288 Ga0268266_10000003 3300028379 Bacteria 1701703
289 Ga0268266_10000812 3300028379 Bacteria 41107
290 Ga0268266_10010701 3300028379 Bacteria 7993
291 Ga0268266_10021721 3300028379 Bacteria 5470
292 Ga0268265_10005471 3300028380 Bacteria 8675
293 Ga0268265_10007810 3300028380 Bacteria 7219
294 Ga0268265_10010074 3300028380 Bacteria 6380
295 Ga0268265_10019747 3300028380 Bacteria 4691
296 Ga0268264_10000008 3300028381 Bacteria 773387
297 Ga0268264_10000360 3300028381 Bacteria 67798
298 Ga0268264_10009444 3300028381 Bacteria 8078
299 Ga0268264_10027358 3300028381 Bacteria 4658
300 Ga0268264_11115257 3300028381 Bacteria 798
301 Ga0307517_10001670 3300028786 Bacteria 36710
302 Ga0307517_10319785 3300028786 Bacteria 859
303 Ga0307515_10080529 3300028794 Bacteria 4245
304 Ga0307511_10081846 3300030521 Bacteria 2262
305 Ga0265320_10040362 3300031240 Bacteria 2328
306 Ga0265327_10001234 3300031251 Bacteria 34331
307 Ga0265327_10001963 3300031251 Bacteria 23543
308 Ga0307513_10002302 3300031456 Bacteria 26655
309 Ga0307513_10004456 3300031456 Bacteria 18698
310 Ga0307513_10008813 3300031456 Bacteria 12845
311 Ga0307513_10013285 3300031456 Bacteria 10111
312 Ga0307408_100326063 3300031548 Bacteria 1295
313 Ga0307408_100524683 3300031548 Bacteria 1041
314 Ga0307508_10186371 3300031616 Bacteria 1677
315 Ga0307516_10000002 3300031730 Bacteria 467851
316 Ga0307405_11196128 3300031731 Bacteria 657
317 Ga0307412_11129131 3300031911 Bacteria 699
318 Ga0307409_101297984 3300031995 Bacteria 753
319 Ga0307510_10024786 3300033180 Bacteria 6927
320 Ga0307510_10099020 3300033180 Bacteria 2716
321 Ga0307510_10293312 3300033180 Bacteria 1091
322 Ga0373944_0018453 3300035089 Bacteria 1992
323 Ga0373936_0000516 3300035113 Bacteria 13169
324 Ga0373935_0009585 3300035692 Bacteria 5797
325 Ga0373927_0000155 3300035695 Bacteria 53529
326 Ga0373925_0000032 3300037068 Bacteria 145357
327 Ga0395899_0000018 3300037312 Bacteria 423194
328 Ga0395899_0455146 3300037312 Bacteria 837
329 Ga0395900_0297431 3300037418 Bacteria 1601
330 Ga0395898_0167800 3300037466 Bacteria 2098
331 Ga0395898_0181550 3300037466 Bacteria 2011
332 Ga0395905_0039392 3300037471 Bacteria 4434
333 Ga0395905_0114341 3300037471 Bacteria 2536
334 Ga0395905_0191014 3300037471 Bacteria 1921
335 Ga0395905_0511372 3300037471 Bacteria 1101
336 Ga0395905_0534517 3300037471 Bacteria 1073
337 Ga0395905_0947091 3300037471 Bacteria 764
338 Ga0436364_0492243 3300037853 Bacteria 4293
339 Ga0395901_0479689 3300038443 Bacteria 1268
340 Ga0395901_0917891 3300038443 Bacteria 856
341 Ga0436365_1003114 3300039437 Bacteria 3933
342 Ga0436365_1903966 3300039437 Bacteria 1583
343 Ga0436360_0825270 3300039438 Bacteria 1137
344 Ga0451849_1285073 3300041505 Bacteria 709
345 Ga0466969_0098025 3300044656 Bacteria 1382
346 Ga0466965_0186397 3300044683 Bacteria 1096
347 Ga0466966_0048377 3300044684 Bacteria 2709
348 Ga0453684_0284929 3300044712 Bacteria 1883
349 Ga0466967_1004503 3300045976 Bacteria 831
350 Ga0495638_0000387 3300046460 Bacteria 54475
351 Ga0495650_0053984 3300046471 Bacteria 1642
352 Ga0495639_0087693 3300046475 Bacteria 1457
353 Ga0495585_0073113 3300046492 Bacteria 1867
354 Ga0495585_0346020 3300046492 Bacteria 723
355 Ga0495606_0084795 3300046507 Bacteria 1961
356 Ga0495606_0387029 3300046507 Bacteria 732
357 Ga0495610_0008207 3300046512 Bacteria 6803
358 Ga0495628_0567309 3300046516 Bacteria 813
359 Ga0495631_0024702 3300046518 Bacteria 2773
360 Ga0495637_0053805 3300046520 Bacteria 1674
361 Ga0495643_0037753 3300046522 Bacteria 2647
362 Ga0495648_0000130 3300046524 Bacteria 88368
363 Ga0495642_0008312 3300046528 Bacteria 3970
364 Ga0495642_0050744 3300046528 Bacteria 1706
365 Ga0495642_0058164 3300046528 Bacteria 1600
366 Ga0495642_0146935 3300046528 Bacteria 1019
367 Ga0495654_0058620 3300046530 Bacteria 1857
368 Ga0495665_0118504 3300046531 Bacteria 1387
369 Ga0495609_0029574 3300046538 Bacteria 2494
370 Ga0495597_0011104 3300046542 Bacteria 4374
371 Ga0495645_0182157 3300046543 Bacteria 1438
372 Ga0495622_0001260 3300046557 Bacteria 12983
373 Ga0495633_0385759 3300046558 Bacteria 634
374 Ga0495668_0000060 3300046616 Bacteria 193823
375 Ga0495668_0006917 3300046616 Bacteria 7340
376 Ga0495668_0009979 3300046616 Bacteria 5784
377 Ga0495668_0057638 3300046616 Bacteria 2144
378 Ga0495668_0058492 3300046616 Bacteria 2127
379 Ga0495668_0118677 3300046616 Bacteria 1446
380 Ga0495668_0121672 3300046616 Bacteria 1428
381 Ga0495668_0519649 3300046616 Bacteria 656
382 Ga0495611_0052845 3300046648 Bacteria 1833
383 Ga0495625_0115670 3300046660 Bacteria 1830
384 Ga0495625_0277026 3300046660 Bacteria 1080
385 Ga0495625_0284918 3300046660 Bacteria 1062
386 Ga0495669_0000020 3300046684 Bacteria 122868
387 Ga0495669_0000449 3300046684 Bacteria 19393
388 Ga0495669_0365580 3300046684 Bacteria 698
389 Ga0495581_0259614 3300047315 Bacteria 1016
390 Ga0495636_0022590 3300047318 Bacteria 2544
391 Ga0495672_0094555 3300047320 Bacteria 1634
392 Ga0495672_0178016 3300047320 Bacteria 1079
393 Ga0495677_0101930 3300047445 Bacteria 1087
394 Ga0495673_0000397 3300047469 Bacteria 50855
395 Ga0495686_0003413 3300047472 Bacteria 13818
396 Ga0495686_0006846 3300047472 Bacteria 8637
397 Ga0495686_0022922 3300047472 Bacteria 4125
398 Ga0495686_0027185 3300047472 Bacteria 3737
399 Ga0495593_0048021 3300047673 Bacteria 2269
400 Ga0495602_1030366 3300048088 Bacteria 542
401 Ga0496101_0677998 3300048904 Bacteria 814
402 Ga0496101_0755736 3300048904 Bacteria 767
403 Ga0496102_0127445 3300048905 Bacteria 2380
404 Ga0496102_0736931 3300048905 Bacteria 908
405 Ga0496104_0300365 3300048907 Bacteria 1518
406 Ga0496105_0416605 3300048908 Bacteria 1064
407 Ga0496106_0194821 3300048909 Bacteria 1612
408 Ga0496107_0202677 3300048910 Bacteria 1475
409 Ga0496108_0457796 3300048911 Bacteria 1114
410 Ga0496109_0008454 3300048912 Bacteria 8751
411 Ga0496110_0063516 3300048913 Bacteria 3263
412 Ga0496111_0356062 3300048914 Bacteria 1083
413 Ga0496112_0096047 3300048915 Bacteria 2934
414 Ga0496112_0404157 3300048915 Bacteria 1305
415 Ga0496112_0566275 3300048915 Bacteria 1069
416 Ga0496113_0129757 3300048916 Bacteria 1977
417 Ga0496115_0001272 3300048918 Bacteria 18065
418 Ga0496115_0001892 3300048918 Bacteria 14984
419 Ga0496115_0049114 3300048918 Bacteria 3376
420 Ga0496115_0112706 3300048918 Bacteria 2235
421 Ga0496116_0145196 3300048919 Bacteria 1327
422 Ga0496118_0006963 3300048921 Bacteria 12207
423 Ga0496119_0024095 3300048922 Bacteria 4293
424 Ga0496121_0000059 3300048924 Bacteria 278177
425 Ga0496121_0459648 3300048924 Bacteria 818
426 Ga0496124_0031509 3300048927 Bacteria 4693
427 Ga0496125_0054108 3300048928 Bacteria 3283
428 Ga0496126_0002857 3300048929 Bacteria 22576
429 Ga0495678_010667 3300049459 Bacteria 4448
430 Ga0501032_0123187 3300049569 Bacteria 1713
431 Ga0501034_0111449 3300049571 Bacteria 2727
432 Ga0501038_0669470 3300049574 Bacteria 780
433 Ga0501038_1099885 3300049574 Bacteria 580
434 Ga0501041_0420412 3300049577 Bacteria 848
435 Ga0501043_0649516 3300049579 Bacteria 775
436 Ga0501043_0829225 3300049579 Bacteria 667
437 Ga0501047_0011838 3300049581 Bacteria 8250
438 Ga0501047_0110346 3300049581 Bacteria 2634
439 Ga0501047_1123564 3300049581 Bacteria 599
440 Ga0501073_0417036 3300049589 Bacteria 928
441 Ga0501035_0222185 3300049822 Bacteria 1612
442 Ga0501035_0290560 3300049822 Bacteria 1380
443 Ga0501035_1064125 3300049822 Bacteria 633
444 Ga0501044_0007104 3300049823 Bacteria 12322
445 Ga0501044_0406252 3300049823 Bacteria 1274
446 nmdc:mga00v17_528_c1 3300050491 Bacteria 21420
447 nmdc:mga0k408_153012_c1 3300050493 Bacteria 1374
448 nmdc:mga0k408_172319_c1 3300050493 Bacteria 816
449 nmdc:mga0k408_40701_c1 3300050493 Bacteria 2675
450 nmdc:mga04h51_94948_c1 3300050495 Bacteria 1079
451 nmdc:mga07m45_23460_c1 3300050496 Bacteria 3374
452 nmdc:mga07m45_326376_c1 3300050496 Bacteria 892
453 nmdc:mga07m45_365970_c1 3300050496 Bacteria 838
454 nmdc:mga07m45_7027_c1 3300050496 Bacteria 5728
455 nmdc:mga0sz30_14908_c1 3300050516 Bacteria 3066
456 nmdc:mga0sz30_40080_c1 3300050516 Bacteria 1968
457 Ga0500635_0000231 3300053080 Bacteria 24724
458 Ga0500578_0000377 3300053086 Bacteria 54788
459 Ga0500578_0308811 3300053086 Bacteria 936
460 Ga0500643_001547 3300053087 Bacteria 13032
461 Ga0500643_005330 3300053087 Bacteria 5561
462 Ga0500643_008562 3300053087 Bacteria 4011
463 Ga0500643_041617 3300053087 Bacteria 1348
464 Ga0500644_0000037 3300053088 Bacteria 80217
465 Ga0500647_0102980 3300053091 Bacteria 1362
466 Ga0500566_0012647 3300053094 Bacteria 4966
467 Ga0500641_0005016 3300053096 Bacteria 4694
468 Ga0500641_0033204 3300053096 Bacteria 2047
469 Ga0500556_0001589 3300053104 Bacteria 9084
470 Ga0500556_0018139 3300053104 Bacteria 2216
471 Ga0500556_0076320 3300053104 Bacteria 1260
472 Ga0500562_002621 3300053108 Bacteria 4476
473 Ga0500562_006226 3300053108 Bacteria 3011
474 Ga0500562_007092 3300053108 Bacteria 2827
475 Ga0500562_033260 3300053108 Bacteria 1362
476 Ga0500572_000763 3300053111 Bacteria 10328
477 Ga0500572_069024 3300053111 Bacteria 1089
478 Ga0500594_0000422 3300053118 Bacteria 9406
479 Ga0500595_001465 3300053119 Bacteria 12587
480 Ga0500595_002355 3300053119 Bacteria 9446
481 Ga0500595_017715 3300053119 Bacteria 2622
482 Ga0500595_141140 3300053119 Bacteria 675
483 Ga0500607_108023 3300053121 Bacteria 1369
484 Ga0500608_000007 3300053122 Bacteria 100296
485 Ga0500608_001035 3300053122 Bacteria 9967
486 Ga0500608_043862 3300053122 Bacteria 2147
487 Ga0500614_002506 3300053123 Bacteria 4080
488 Ga0500655_021135 3300053133 Bacteria 1219
489 Ga0500655_033234 3300053133 Bacteria 998
490 Ga0500658_0023138 3300053134 Bacteria 2370
491 Ga0500559_0007905 3300053136 Bacteria 4689
492 Ga0500559_0094655 3300053136 Bacteria 1371
493 Ga0500559_0106168 3300053136 Bacteria 1298
494 Ga0500564_000009 3300053138 Bacteria 60470
495 Ga0500568_0214608 3300053139 Bacteria 703
496 Ga0500590_024734 3300053148 Bacteria 3117
497 Ga0500590_031802 3300053148 Bacteria 2736
498 Ga0500616_0056284 3300053153 Bacteria 2053
499 Ga0500616_0082029 3300053153 Bacteria 1618
500 Ga0500616_0090439 3300053153 Bacteria 1517
501 Ga0500619_045480 3300053154 Bacteria 1404
502 Ga0500620_161169 3300053155 Bacteria 778
503 Ga0500622_0000234 3300053156 Bacteria 57602
504 Ga0500622_0010533 3300053156 Bacteria 5071
505 Ga0500639_229291 3300053163 Bacteria 766
506 Ga0500636_0040609 3300053177 Bacteria 2751
507 Ga0500636_0115677 3300053177 Bacteria 1510
508 Ga0500636_0354114 3300053177 Bacteria 699
509 Ga0500637_0017588 3300053178 Bacteria 3830
510 Ga0500637_0075175 3300053178 Bacteria 1946
511 Ga0500576_099193 3300053725 Bacteria 1192
512 Ga0500611_005677 3300053727 Bacteria 1771
513 Ga0500645_001725 3300053730 Bacteria 10611
514 Ga0500645_002985 3300053730 Bacteria 7167
515 Ga0500645_008934 3300053730 Bacteria 3389
516 Ga0500645_040527 3300053730 Bacteria 1377
517 Ga0500552_017582 3300053733 Bacteria 981
518 Ga0500596_001181 3300053735 Bacteria 5267
519 Ga0501082_0373939 3300060353 Bacteria 1243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0057638 Ga0495668_0057638_1699_2112 126
2 3300047472 Ga0495686_0027185 Ga0495686_0027185_1087_1500 126
3 3300049577 Ga0501041_0420412 Ga0501041_0420412_39_458 128
4 3300049589 Ga0501073_0417036 Ga0501073_0417036_310_798 150
5 3300005466 Ga0070685_10011937 Ga0070685_100119374 156
6 iso_pu_bacteria 2739367756 2739793535 160
7 3300048088 Ga0495602_1030366 Ga0495602_1030366_46_531 161
8 3300005355 Ga0070671_100430173 Ga0070671_1004301732 166
9 3300014325 Ga0163163_10188185 Ga0163163_101881853 166
10 3300047320 Ga0495672_0178016 Ga0495672_0178016_488_988 166
11 3300049574 Ga0501038_1099885 Ga0501038_1099885_70_570 166
12 3300005331 Ga0070670_100019351 Ga0070670_1000193516 168
13 3300005617 Ga0068859_100006364 Ga0068859_1000063647 168
14 3300005841 Ga0068863_100018754 Ga0068863_1000187544 168
15 3300005843 Ga0068860_100005340 Ga0068860_1000053407 168
16 3300005844 Ga0068862_100003825 Ga0068862_1000038257 168
17 3300006931 Ga0097620_100006364 Ga0097620_1000063647 168
18 3300009553 Ga0105249_10102394 Ga0105249_101023943 168
19 3300025925 Ga0207650_10011859 Ga0207650_100118596 168
20 3300026035 Ga0207703_10040750 Ga0207703_100407504 168
21 3300026088 Ga0207641_10013816 Ga0207641_100138166 168
22 3300028380 Ga0268265_10005471 Ga0268265_100054714 168
23 3300028381 Ga0268264_10027358 Ga0268264_100273585 168
24 3300005366 Ga0070659_100033290 Ga0070659_1000332904 170
25 3300005564 Ga0070664_100034800 Ga0070664_1000348003 170
26 3300013100 Ga0157373_10000482 Ga0157373_1000048232 170
27 3300025919 Ga0207657_10584929 Ga0207657_105849291 170
28 3300025932 Ga0207690_10060693 Ga0207690_100606933 170
29 3300025945 Ga0207679_10001519 Ga0207679_1000151913 170
30 3300026041 Ga0207639_10107998 Ga0207639_101079982 170
31 3300031240 Ga0265320_10040362 Ga0265320_100403623 170
32 iso_pu_bacteria 2643221614 2644088540 171
33 iso_pu_bacteria 2643221661 2644343776 171
34 iso_pu_bacteria 2643221666 2644368746 171
35 iso_pu_bacteria 2582581279 2585146975 172
36 iso_pu_bacteria 2643221598 2644000633 172
37 iso_pu_bacteria 2791355048 2792460209 172
38 iso_pu_bacteria 2843744320 2843746779 172
39 iso_pu_bacteria 2849560528 2849560856 172
40 iso_pu_bacteria 2849573788 2849576712 172
41 iso_pu_bacteria 2851153111 2851154061 172
42 iso_pu_bacteria 2884960567 2884965199 172
43 iso_pu_bacteria 2898329390 2898333327 172
44 3300005347 Ga0070668_100001360 Ga0070668_10000136014 173
45 3300005347 Ga0070668_100022966 Ga0070668_1000229665 173
46 3300005347 Ga0070668_100052603 Ga0070668_1000526035 173
47 3300005353 Ga0070669_100339889 Ga0070669_1003398892 173
48 3300005367 Ga0070667_100008886 Ga0070667_10000888611 173
49 3300005458 Ga0070681_10371719 Ga0070681_103717192 173
50 3300005563 Ga0068855_100035613 Ga0068855_1000356135 173
51 3300005614 Ga0068856_100532527 Ga0068856_1005325272 173
52 3300005617 Ga0068859_100604081 Ga0068859_1006040811 173
53 3300005618 Ga0068864_100078305 Ga0068864_1000783053 173
54 3300005841 Ga0068863_100093271 Ga0068863_1000932713 173
55 3300005843 Ga0068860_100000234 Ga0068860_10000023419 173
56 3300005843 Ga0068860_101566425 Ga0068860_1015664252 173
57 3300005844 Ga0068862_100209629 Ga0068862_1002096292 173
58 3300006931 Ga0097620_100604029 Ga0097620_1006040291 173
59 3300009093 Ga0105240_10022612 Ga0105240_100226128 173
60 3300009545 Ga0105237_10346428 Ga0105237_103464282 173
61 3300009551 Ga0105238_10248466 Ga0105238_102484662 173
62 3300009551 Ga0105238_10290071 Ga0105238_102900712 173
63 3300009551 Ga0105238_11545175 Ga0105238_115451751 173
64 3300025254 Ga0209148_1004982 Ga0209148_10049822 173
65 3300025913 Ga0207695_10448088 Ga0207695_104480883 173
66 3300025923 Ga0207681_10317829 Ga0207681_103178292 173
67 3300025924 Ga0207694_10173450 Ga0207694_101734503 173
68 3300025924 Ga0207694_10895722 Ga0207694_108957222 173
69 3300025931 Ga0207644_10904597 Ga0207644_109045971 173
70 3300025931 Ga0207644_10921842 Ga0207644_109218422 173
71 3300025949 Ga0207667_10048194 Ga0207667_100481946 173
72 3300025949 Ga0207667_10265930 Ga0207667_102659303 173
73 3300025949 Ga0207667_10789991 Ga0207667_107899912 173
74 3300025972 Ga0207668_10024993 Ga0207668_100249934 173
75 3300025972 Ga0207668_10067921 Ga0207668_100679212 173
76 3300025972 Ga0207668_10306512 Ga0207668_103065122 173
77 3300026078 Ga0207702_10438312 Ga0207702_104383123 173
78 3300026088 Ga0207641_10089677 Ga0207641_100896772 173
79 3300028380 Ga0268265_10007810 Ga0268265_100078103 173
80 3300028381 Ga0268264_10000008 Ga0268264_10000008697 173
81 3300028381 Ga0268264_11115257 Ga0268264_111152572 173
82 3300028786 Ga0307517_10001670 Ga0307517_1000167028 173
83 3300031456 Ga0307513_10004456 Ga0307513_1000445614 173
84 3300031730 Ga0307516_10000002 Ga0307516_10000002106 173
85 3300033180 Ga0307510_10024786 Ga0307510_100247867 173
86 3300035692 Ga0373935_0009585 Ga0373935_0009585_1565_2086 173
87 3300037312 Ga0395899_0455146 Ga0395899_0455146_214_735 173
88 3300037418 Ga0395900_0297431 Ga0395900_0297431_433_954 173
89 3300037466 Ga0395898_0167800 Ga0395898_0167800_359_880 173
90 3300037466 Ga0395898_0181550 Ga0395898_0181550_1217_1738 173
91 3300037471 Ga0395905_0039392 Ga0395905_0039392_627_1148 173
92 3300037471 Ga0395905_0114341 Ga0395905_0114341_390_911 173
93 3300037471 Ga0395905_0191014 Ga0395905_0191014_690_1211 173
94 3300038443 Ga0395901_0479689 Ga0395901_0479689_188_709 173
95 3300044683 Ga0466965_0186397 Ga0466965_0186397_68_589 173
96 3300046616 Ga0495668_0118677 Ga0495668_0118677_500_1024 173
97 3300049579 Ga0501043_0829225 Ga0501043_0829225_53_574 173
98 3300049581 Ga0501047_1123564 Ga0501047_1123564_29_550 173
99 3300049822 Ga0501035_0222185 Ga0501035_0222185_731_1252 173
100 3300049823 Ga0501044_0007104 Ga0501044_0007104_3485_4006 173
101 3300049823 Ga0501044_0406252 Ga0501044_0406252_24_548 173
102 3300053087 Ga0500643_001547 Ga0500643_001547_5394_5918 173
103 3300053087 Ga0500643_005330 Ga0500643_005330_1890_2414 173
104 3300053087 Ga0500643_008562 Ga0500643_008562_1518_2045 173
105 3300053087 Ga0500643_041617 Ga0500643_041617_62_586 173
106 3300053096 Ga0500641_0005016 Ga0500641_0005016_1831_2355 173
107 3300053104 Ga0500556_0001589 Ga0500556_0001589_2162_2686 173
108 3300053104 Ga0500556_0018139 Ga0500556_0018139_866_1390 173
109 3300053108 Ga0500562_002621 Ga0500562_002621_1389_1913 173
110 3300053108 Ga0500562_007092 Ga0500562_007092_1265_1792 173
111 3300053108 Ga0500562_033260 Ga0500562_033260_675_1199 173
112 3300053133 Ga0500655_021135 Ga0500655_021135_172_696 173
113 3300053139 Ga0500568_0214608 Ga0500568_0214608_44_568 173
114 3300053153 Ga0500616_0056284 Ga0500616_0056284_151_675 173
115 3300053153 Ga0500616_0082029 Ga0500616_0082029_938_1462 173
116 3300053730 Ga0500645_001725 Ga0500645_001725_3896_4420 173
117 3300053730 Ga0500645_008934 Ga0500645_008934_1266_1790 173
118 3300005339 Ga0070660_100025252 Ga0070660_1000252524 174
119 3300005548 Ga0070665_100000144 Ga0070665_10000014475 174
120 3300005578 Ga0068854_100634187 Ga0068854_1006341872 174
121 3300009551 Ga0105238_10033188 Ga0105238_100331883 174
122 3300010375 Ga0105239_10436328 Ga0105239_104363282 174
123 3300025924 Ga0207694_10037272 Ga0207694_100372722 174
124 3300025981 Ga0207640_10533705 Ga0207640_105337052 174
125 3300028379 Ga0268266_10000003 Ga0268266_10000003367 174
126 3300031456 Ga0307513_10002302 Ga0307513_1000230225 174
127 3300048918 Ga0496115_0001892 Ga0496115_0001892_7064_7588 174
128 3300049571 Ga0501034_0111449 Ga0501034_0111449_2022_2546 174
129 3300053730 Ga0500645_040527 Ga0500645_040527_721_1245 174
130 3300005331 Ga0070670_101095779 Ga0070670_1010957791 175
131 3300005335 Ga0070666_10004481 Ga0070666_100044812 175
132 3300005335 Ga0070666_10316287 Ga0070666_103162872 175
133 3300005336 Ga0070680_100090930 Ga0070680_1000909304 175
134 3300005336 Ga0070680_100116049 Ga0070680_1001160492 175
135 3300005339 Ga0070660_100038099 Ga0070660_1000380992 175
136 3300005341 Ga0070691_10148878 Ga0070691_101488782 175
137 3300005347 Ga0070668_100000733 Ga0070668_1000007339 175
138 3300005347 Ga0070668_100003875 Ga0070668_1000038752 175
139 3300005353 Ga0070669_100014242 Ga0070669_1000142424 175
140 3300005353 Ga0070669_101093842 Ga0070669_1010938421 175
141 3300005355 Ga0070671_100001866 Ga0070671_10000186610 175
142 3300005355 Ga0070671_100115923 Ga0070671_1001159232 175
143 3300005355 Ga0070671_100462822 Ga0070671_1004628222 175
144 3300005366 Ga0070659_100000143 Ga0070659_10000014341 175
145 3300005366 Ga0070659_100005171 Ga0070659_1000051717 175
146 3300005367 Ga0070667_100000146 Ga0070667_1000001469 175
147 3300005367 Ga0070667_100007034 Ga0070667_1000070342 175
148 3300005367 Ga0070667_100020951 Ga0070667_1000209511 175
149 3300005455 Ga0070663_100416060 Ga0070663_1004160602 175
150 3300005458 Ga0070681_10019225 Ga0070681_100192253 175
151 3300005458 Ga0070681_10056881 Ga0070681_100568815 175
152 3300005530 Ga0070679_100142727 Ga0070679_1001427272 175
153 3300005530 Ga0070679_100243060 Ga0070679_1002430602 175
154 3300005539 Ga0068853_100010326 Ga0068853_1000103265 175
155 3300005539 Ga0068853_100178453 Ga0068853_1001784532 175
156 3300005548 Ga0070665_100001180 Ga0070665_1000011805 175
157 3300005548 Ga0070665_100002958 Ga0070665_10000295810 175
158 3300005548 Ga0070665_100020082 Ga0070665_1000200826 175
159 3300005563 Ga0068855_100044018 Ga0068855_1000440183 175
160 3300005563 Ga0068855_100094249 Ga0068855_1000942492 175
161 3300005564 Ga0070664_100491603 Ga0070664_1004916031 175
162 3300005564 Ga0070664_100578948 Ga0070664_1005789481 175
163 3300005577 Ga0068857_100719809 Ga0068857_1007198092 175
164 3300005614 Ga0068856_100836017 Ga0068856_1008360171 175
165 3300005614 Ga0068856_100928254 Ga0068856_1009282542 175
166 3300005617 Ga0068859_100000437 Ga0068859_10000043710 175
167 3300005617 Ga0068859_100374165 Ga0068859_1003741652 175
168 3300005618 Ga0068864_100000313 Ga0068864_10000031344 175
169 3300005618 Ga0068864_100000503 Ga0068864_1000005039 175
170 3300005618 Ga0068864_100054401 Ga0068864_1000544013 175
171 3300005618 Ga0068864_100117042 Ga0068864_1001170422 175
172 3300005618 Ga0068864_100824166 Ga0068864_1008241662 175
173 3300005618 Ga0068864_101287707 Ga0068864_1012877071 175
174 3300005719 Ga0068861_100271154 Ga0068861_1002711542 175
175 3300005841 Ga0068863_100000158 Ga0068863_10000015868 175
176 3300005841 Ga0068863_100000253 Ga0068863_10000025356 175
177 3300005841 Ga0068863_100002531 Ga0068863_10000253114 175
178 3300005841 Ga0068863_100023756 Ga0068863_1000237566 175
179 3300005841 Ga0068863_100288099 Ga0068863_1002880992 175
180 3300005842 Ga0068858_100000746 Ga0068858_1000007469 175
181 3300005842 Ga0068858_100003737 Ga0068858_1000037375 175
182 3300005842 Ga0068858_100028444 Ga0068858_1000284442 175
183 3300005842 Ga0068858_100277338 Ga0068858_1002773382 175
184 3300005843 Ga0068860_100000308 Ga0068860_1000003089 175
185 3300005843 Ga0068860_100032620 Ga0068860_1000326203 175
186 3300005844 Ga0068862_100000129 Ga0068862_10000012989 175
187 3300006028 Ga0070717_11186826 Ga0070717_111868261 175
188 3300006038 Ga0075365_10412176 Ga0075365_104121762 175
189 3300006048 Ga0075363_100063502 Ga0075363_1000635022 175
190 3300006051 Ga0075364_10000411 Ga0075364_1000041117 175
191 3300006178 Ga0075367_10037498 Ga0075367_100374983 175
192 3300006186 Ga0075369_10050924 Ga0075369_100509242 175
193 3300006237 Ga0097621_100951954 Ga0097621_1009519541 175
194 3300006353 Ga0075370_10058310 Ga0075370_100583102 175
195 3300006358 Ga0068871_100722356 Ga0068871_1007223562 175
196 3300006881 Ga0068865_100034685 Ga0068865_1000346852 175
197 3300006931 Ga0097620_100000437 Ga0097620_10000043710 175
198 3300006931 Ga0097620_100374163 Ga0097620_1003741632 175
199 3300006946 Ga0079104_1015810 Ga0079104_10158103 175
200 3300009093 Ga0105240_10071568 Ga0105240_100715684 175
201 3300009093 Ga0105240_10102063 Ga0105240_101020632 175
202 3300009101 Ga0105247_10258579 Ga0105247_102585792 175
203 3300009177 Ga0105248_10000489 Ga0105248_1000048921 175
204 3300009177 Ga0105248_10011458 Ga0105248_100114586 175
205 3300009177 Ga0105248_10036925 Ga0105248_100369258 175
206 3300009177 Ga0105248_10046013 Ga0105248_100460136 175
207 3300009177 Ga0105248_10065826 Ga0105248_100658262 175
208 3300009177 Ga0105248_10368099 Ga0105248_103680992 175
209 3300009551 Ga0105238_10039857 Ga0105238_100398573 175
210 3300009551 Ga0105238_10887696 Ga0105238_108876962 175
211 3300009553 Ga0105249_10009776 Ga0105249_100097763 175
212 3300009553 Ga0105249_10157395 Ga0105249_101573952 175
213 3300009553 Ga0105249_10674899 Ga0105249_106748992 175
214 3300010375 Ga0105239_10070776 Ga0105239_100707761 175
215 3300010375 Ga0105239_10474680 Ga0105239_104746802 175
216 3300013104 Ga0157370_10249794 Ga0157370_102497942 175
217 3300013105 Ga0157369_10499209 Ga0157369_104992092 175
218 3300013296 Ga0157374_10234511 Ga0157374_102345112 175
219 3300013306 Ga0163162_10240161 Ga0163162_102401613 175
220 3300013306 Ga0163162_10267262 Ga0163162_102672623 175
221 3300013307 Ga0157372_10477738 Ga0157372_104777382 175
222 3300013308 Ga0157375_10036236 Ga0157375_100362363 175
223 3300014325 Ga0163163_10026201 Ga0163163_100262016 175
224 3300014325 Ga0163163_10071631 Ga0163163_100716312 175
225 3300014325 Ga0163163_10156347 Ga0163163_101563472 175
226 3300014325 Ga0163163_10277552 Ga0163163_102775522 175
227 3300014325 Ga0163163_10534393 Ga0163163_105343931 175
228 3300014326 Ga0157380_10182384 Ga0157380_101823842 175
229 3300014745 Ga0157377_10312658 Ga0157377_103126582 175
230 3300014968 Ga0157379_10000967 Ga0157379_1000096710 175
231 3300014968 Ga0157379_10068713 Ga0157379_100687133 175
232 3300014968 Ga0157379_10101168 Ga0157379_101011681 175
233 3300021384 Ga0213876_10101676 Ga0213876_101016762 175
234 3300021388 Ga0213875_10191657 Ga0213875_101916572 175
235 3300025250 Ga0209026_1040267 Ga0209026_10402671 175
236 3300025900 Ga0207710_10133530 Ga0207710_101335302 175
237 3300025903 Ga0207680_10003990 Ga0207680_100039902 175
238 3300025903 Ga0207680_10072151 Ga0207680_100721512 175
239 3300025903 Ga0207680_10104166 Ga0207680_101041663 175
240 3300025909 Ga0207705_10010119 Ga0207705_100101199 175
241 3300025909 Ga0207705_10134293 Ga0207705_101342932 175
242 3300025911 Ga0207654_10026762 Ga0207654_100267623 175
243 3300025912 Ga0207707_10021262 Ga0207707_100212623 175
244 3300025912 Ga0207707_10197451 Ga0207707_101974512 175
245 3300025913 Ga0207695_10001763 Ga0207695_100017638 175
246 3300025913 Ga0207695_10005400 Ga0207695_1000540013 175
247 3300025913 Ga0207695_10010025 Ga0207695_1001002511 175
248 3300025913 Ga0207695_10091696 Ga0207695_100916964 175
249 3300025913 Ga0207695_10453311 Ga0207695_104533112 175
250 3300025917 Ga0207660_10065045 Ga0207660_100650453 175
251 3300025917 Ga0207660_10077752 Ga0207660_100777522 175
252 3300025919 Ga0207657_10010954 Ga0207657_100109542 175
253 3300025919 Ga0207657_10048620 Ga0207657_100486205 175
254 3300025920 Ga0207649_10895664 Ga0207649_108956642 175
255 3300025921 Ga0207652_10049193 Ga0207652_100491934 175
256 3300025923 Ga0207681_10019464 Ga0207681_100194642 175
257 3300025923 Ga0207681_10961036 Ga0207681_109610361 175
258 3300025924 Ga0207694_10013384 Ga0207694_100133845 175
259 3300025924 Ga0207694_10131137 Ga0207694_101311373 175
260 3300025924 Ga0207694_10196787 Ga0207694_101967872 175
261 3300025924 Ga0207694_10781388 Ga0207694_107813881 175
262 3300025925 Ga0207650_10000064 Ga0207650_10000064133 175
263 3300025925 Ga0207650_10012174 Ga0207650_100121745 175
264 3300025925 Ga0207650_10432680 Ga0207650_104326802 175
265 3300025925 Ga0207650_10603840 Ga0207650_106038402 175
266 3300025927 Ga0207687_10109059 Ga0207687_101090593 175
267 3300025931 Ga0207644_10001126 Ga0207644_1000112610 175
268 3300025931 Ga0207644_10044081 Ga0207644_100440814 175
269 3300025931 Ga0207644_10047989 Ga0207644_100479895 175
270 3300025932 Ga0207690_10010748 Ga0207690_100107487 175
271 3300025932 Ga0207690_10120154 Ga0207690_101201542 175
272 3300025933 Ga0207706_10502381 Ga0207706_105023811 175
273 3300025938 Ga0207704_10002245 Ga0207704_100022452 175
274 3300025938 Ga0207704_11061664 Ga0207704_110616641 175
275 3300025941 Ga0207711_10001700 Ga0207711_1000170022 175
276 3300025941 Ga0207711_10002832 Ga0207711_1000283221 175
277 3300025941 Ga0207711_10004706 Ga0207711_100047068 175
278 3300025941 Ga0207711_10035666 Ga0207711_100356662 175
279 3300025941 Ga0207711_10047787 Ga0207711_100477871 175
280 3300025941 Ga0207711_10548793 Ga0207711_105487932 175
281 3300025945 Ga0207679_10526318 Ga0207679_105263182 175
282 3300025949 Ga0207667_10021083 Ga0207667_100210833 175
283 3300025949 Ga0207667_10024032 Ga0207667_100240328 175
284 3300025949 Ga0207667_10024243 Ga0207667_100242432 175
285 3300025960 Ga0207651_10035437 Ga0207651_100354375 175
286 3300025961 Ga0207712_10002582 Ga0207712_100025823 175
287 3300025961 Ga0207712_10123258 Ga0207712_101232583 175
288 3300025972 Ga0207668_10000154 Ga0207668_100001548 175
289 3300025972 Ga0207668_10000379 Ga0207668_1000037928 175
290 3300025981 Ga0207640_10533573 Ga0207640_105335731 175
291 3300025986 Ga0207658_10001071 Ga0207658_1000107117 175
292 3300025986 Ga0207658_10002901 Ga0207658_1000290110 175
293 3300025986 Ga0207658_10009216 Ga0207658_100092162 175
294 3300025986 Ga0207658_10559439 Ga0207658_105594392 175
295 3300026035 Ga0207703_10000598 Ga0207703_100005989 175
296 3300026035 Ga0207703_10008480 Ga0207703_1000848012 175
297 3300026035 Ga0207703_10022519 Ga0207703_100225193 175
298 3300026035 Ga0207703_10363726 Ga0207703_103637262 175
299 3300026041 Ga0207639_10007364 Ga0207639_100073645 175
300 3300026041 Ga0207639_10535913 Ga0207639_105359132 175
301 3300026041 Ga0207639_11029634 Ga0207639_110296341 175
302 3300026067 Ga0207678_10414111 Ga0207678_104141111 175
303 3300026078 Ga0207702_10656129 Ga0207702_106561292 175
304 3300026088 Ga0207641_10000634 Ga0207641_100006348 175
305 3300026088 Ga0207641_10000687 Ga0207641_100006879 175
306 3300026088 Ga0207641_10031521 Ga0207641_100315212 175
307 3300026088 Ga0207641_10411472 Ga0207641_104114722 175
308 3300026095 Ga0207676_10000131 Ga0207676_1000013164 175
309 3300026095 Ga0207676_10001356 Ga0207676_100013563 175
310 3300026095 Ga0207676_10016556 Ga0207676_100165567 175
311 3300026095 Ga0207676_10317426 Ga0207676_103174262 175
312 3300026118 Ga0207675_100250571 Ga0207675_1002505712 175
313 3300026121 Ga0207683_10519105 Ga0207683_105191052 175
314 3300026142 Ga0207698_11315540 Ga0207698_113155402 175
315 3300027111 Ga0209281_1020179 Ga0209281_10201792 175
316 3300027543 Ga0209999_1005526 Ga0209999_10055261 175
317 3300027665 Ga0209983_1006282 Ga0209983_10062821 175
318 3300027866 Ga0209813_10021188 Ga0209813_100211883 175
319 3300028379 Ga0268266_10000812 Ga0268266_1000081216 175
320 3300028379 Ga0268266_10010701 Ga0268266_100107017 175
321 3300028379 Ga0268266_10021721 Ga0268266_100217215 175
322 3300028380 Ga0268265_10010074 Ga0268265_100100746 175
323 3300028380 Ga0268265_10019747 Ga0268265_100197476 175
324 3300028381 Ga0268264_10000360 Ga0268264_100003609 175
325 3300028381 Ga0268264_10009444 Ga0268264_100094442 175
326 3300028786 Ga0307517_10319785 Ga0307517_103197851 175
327 3300030521 Ga0307511_10081846 Ga0307511_100818462 175
328 3300031251 Ga0265327_10001234 Ga0265327_1000123423 175
329 3300031251 Ga0265327_10001963 Ga0265327_1000196321 175
330 3300031456 Ga0307513_10008813 Ga0307513_1000881313 175
331 3300031456 Ga0307513_10013285 Ga0307513_100132858 175
332 3300031548 Ga0307408_100326063 Ga0307408_1003260632 175
333 3300031548 Ga0307408_100524683 Ga0307408_1005246832 175
334 3300031616 Ga0307508_10186371 Ga0307508_101863712 175
335 3300031731 Ga0307405_11196128 Ga0307405_111961282 175
336 3300031911 Ga0307412_11129131 Ga0307412_111291312 175
337 3300033180 Ga0307510_10099020 Ga0307510_100990203 175
338 3300033180 Ga0307510_10293312 Ga0307510_102933121 175
339 3300035089 Ga0373944_0018453 Ga0373944_0018453_627_1154 175
340 3300035113 Ga0373936_0000516 Ga0373936_0000516_2548_3087 175
341 3300035695 Ga0373927_0000155 Ga0373927_0000155_43271_43798 175
342 3300037068 Ga0373925_0000032 Ga0373925_0000032_478_1005 175
343 3300037471 Ga0395905_0511372 Ga0395905_0511372_239_766 175
344 3300037471 Ga0395905_0534517 Ga0395905_0534517_122_649 175
345 3300037471 Ga0395905_0947091 Ga0395905_0947091_12_539 175
346 3300037853 Ga0436364_0492243 Ga0436364_0492243_3562_4089 175
347 3300038443 Ga0395901_0917891 Ga0395901_0917891_225_752 175
348 3300039437 Ga0436365_1003114 Ga0436365_1003114_3344_3871 175
349 3300039437 Ga0436365_1903966 Ga0436365_1903966_420_947 175
350 3300039438 Ga0436360_0825270 Ga0436360_0825270_125_652 175
351 3300045976 Ga0466967_1004503 Ga0466967_1004503_60_587 175
352 3300046475 Ga0495639_0087693 Ga0495639_0087693_49_576 175
353 3300046492 Ga0495585_0073113 Ga0495585_0073113_305_832 175
354 3300046492 Ga0495585_0346020 Ga0495585_0346020_28_555 175
355 3300046507 Ga0495606_0387029 Ga0495606_0387029_10_537 175
356 3300046516 Ga0495628_0567309 Ga0495628_0567309_233_760 175
357 3300046520 Ga0495637_0053805 Ga0495637_0053805_1048_1575 175
358 3300046522 Ga0495643_0037753 Ga0495643_0037753_134_661 175
359 3300046528 Ga0495642_0008312 Ga0495642_0008312_1517_2059 175
360 3300046528 Ga0495642_0050744 Ga0495642_0050744_764_1306 175
361 3300046528 Ga0495642_0058164 Ga0495642_0058164_479_1006 175
362 3300046528 Ga0495642_0146935 Ga0495642_0146935_47_574 175
363 3300046530 Ga0495654_0058620 Ga0495654_0058620_1165_1692 175
364 3300046531 Ga0495665_0118504 Ga0495665_0118504_60_587 175
365 3300046538 Ga0495609_0029574 Ga0495609_0029574_1062_1589 175
366 3300046542 Ga0495597_0011104 Ga0495597_0011104_1787_2314 175
367 3300046543 Ga0495645_0182157 Ga0495645_0182157_210_737 175
368 3300046557 Ga0495622_0001260 Ga0495622_0001260_6915_7442 175
369 3300046616 Ga0495668_0058492 Ga0495668_0058492_258_785 175
370 3300046616 Ga0495668_0519649 Ga0495668_0519649_54_581 175
371 3300046648 Ga0495611_0052845 Ga0495611_0052845_445_972 175
372 3300046660 Ga0495625_0277026 Ga0495625_0277026_296_823 175
373 3300046660 Ga0495625_0284918 Ga0495625_0284918_357_884 175
374 3300046684 Ga0495669_0000020 Ga0495669_0000020_20914_21441 175
375 3300046684 Ga0495669_0000449 Ga0495669_0000449_8814_9341 175
376 3300046684 Ga0495669_0365580 Ga0495669_0365580_73_615 175
377 3300047315 Ga0495581_0259614 Ga0495581_0259614_204_731 175
378 3300047318 Ga0495636_0022590 Ga0495636_0022590_590_1132 175
379 3300047320 Ga0495672_0094555 Ga0495672_0094555_81_608 175
380 3300047445 Ga0495677_0101930 Ga0495677_0101930_282_809 175
381 3300047673 Ga0495593_0048021 Ga0495593_0048021_1718_2245 175
382 3300048904 Ga0496101_0677998 Ga0496101_0677998_170_697 175
383 3300048904 Ga0496101_0755736 Ga0496101_0755736_41_583 175
384 3300048905 Ga0496102_0127445 Ga0496102_0127445_1535_2077 175
385 3300048905 Ga0496102_0736931 Ga0496102_0736931_87_614 175
386 3300048907 Ga0496104_0300365 Ga0496104_0300365_608_1150 175
387 3300048908 Ga0496105_0416605 Ga0496105_0416605_121_648 175
388 3300048909 Ga0496106_0194821 Ga0496106_0194821_701_1243 175
389 3300048910 Ga0496107_0202677 Ga0496107_0202677_829_1356 175
390 3300048911 Ga0496108_0457796 Ga0496108_0457796_216_758 175
391 3300048912 Ga0496109_0008454 Ga0496109_0008454_7048_7590 175
392 3300048913 Ga0496110_0063516 Ga0496110_0063516_1097_1639 175
393 3300048914 Ga0496111_0356062 Ga0496111_0356062_387_929 175
394 3300048915 Ga0496112_0096047 Ga0496112_0096047_489_1031 175
395 3300048915 Ga0496112_0404157 Ga0496112_0404157_127_669 175
396 3300048916 Ga0496113_0129757 Ga0496113_0129757_1059_1601 175
397 3300048918 Ga0496115_0001272 Ga0496115_0001272_2402_2938 175
398 3300048918 Ga0496115_0049114 Ga0496115_0049114_879_1406 175
399 3300048919 Ga0496116_0145196 Ga0496116_0145196_556_1083 175
400 3300048921 Ga0496118_0006963 Ga0496118_0006963_6093_6620 175
401 3300048922 Ga0496119_0024095 Ga0496119_0024095_549_1076 175
402 3300048924 Ga0496121_0000059 Ga0496121_0000059_271244_271771 175
403 3300049569 Ga0501032_0123187 Ga0501032_0123187_932_1459 175
404 3300049574 Ga0501038_0669470 Ga0501038_0669470_219_746 175
405 3300049579 Ga0501043_0649516 Ga0501043_0649516_50_577 175
406 3300049581 Ga0501047_0011838 Ga0501047_0011838_3079_3606 175
407 3300049581 Ga0501047_0110346 Ga0501047_0110346_1380_1907 175
408 3300049822 Ga0501035_0290560 Ga0501035_0290560_470_997 175
409 3300049822 Ga0501035_1064125 Ga0501035_1064125_65_592 175
410 3300050491 nmdc:mga00v17_528_c1 nmdc:mga00v17_528_c1_9467_9994 175
411 3300050493 nmdc:mga0k408_153012_c1 nmdc:mga0k408_153012_c1_568_1095 175
412 3300050493 nmdc:mga0k408_172319_c1 nmdc:mga0k408_172319_c1_85_612 175
413 3300050495 nmdc:mga04h51_94948_c1 nmdc:mga04h51_94948_c1_224_751 175
414 3300050496 nmdc:mga07m45_23460_c1 nmdc:mga07m45_23460_c1_490_1017 175
415 3300050496 nmdc:mga07m45_7027_c1 nmdc:mga07m45_7027_c1_505_1032 175
416 3300050516 nmdc:mga0sz30_40080_c1 nmdc:mga0sz30_40080_c1_544_1071 175
417 3300053080 Ga0500635_0000231 Ga0500635_0000231_17709_18236 175
418 3300053086 Ga0500578_0308811 Ga0500578_0308811_131_658 175
419 3300053091 Ga0500647_0102980 Ga0500647_0102980_44_571 175
420 3300053094 Ga0500566_0012647 Ga0500566_0012647_855_1382 175
421 3300053111 Ga0500572_069024 Ga0500572_069024_294_821 175
422 3300053119 Ga0500595_001465 Ga0500595_001465_911_1438 175
423 3300053119 Ga0500595_017715 Ga0500595_017715_1555_2082 175
424 3300053119 Ga0500595_141140 Ga0500595_141140_68_595 175
425 3300053121 Ga0500607_108023 Ga0500607_108023_549_1076 175
426 3300053122 Ga0500608_001035 Ga0500608_001035_6975_7502 175
427 3300053122 Ga0500608_043862 Ga0500608_043862_569_1126 175
428 3300053123 Ga0500614_002506 Ga0500614_002506_3376_3903 175
429 3300053134 Ga0500658_0023138 Ga0500658_0023138_1689_2216 175
430 3300053136 Ga0500559_0094655 Ga0500559_0094655_589_1128 175
431 3300053148 Ga0500590_031802 Ga0500590_031802_630_1157 175
432 3300053153 Ga0500616_0090439 Ga0500616_0090439_40_567 175
433 3300053154 Ga0500619_045480 Ga0500619_045480_243_770 175
434 3300053155 Ga0500620_161169 Ga0500620_161169_100_627 175
435 3300053163 Ga0500639_229291 Ga0500639_229291_62_589 175
436 3300053177 Ga0500636_0115677 Ga0500636_0115677_781_1308 175
437 3300053177 Ga0500636_0354114 Ga0500636_0354114_146_673 175
438 3300053178 Ga0500637_0017588 Ga0500637_0017588_267_794 175
439 3300053178 Ga0500637_0075175 Ga0500637_0075175_478_1005 175
440 3300053725 Ga0500576_099193 Ga0500576_099193_561_1088 175
441 3300053735 Ga0500596_001181 Ga0500596_001181_710_1237 175
442 3300060353 Ga0501082_0373939 Ga0501082_0373939_432_959 175
443 3300003215 JGI25153J46596_10082870 JGI25153J46596_100828702 176
444 3300003316 rootH1_10010331 rootH1_100103313 176
445 3300003322 rootL2_10104603 rootL2_101046032 176
446 3300003781 Ga0055536_1000271 Ga0055536_100027137 176
447 3300003781 Ga0055536_1000307 Ga0055536_100030733 176
448 3300003791 Ga0055530_10000026 Ga0055530_1000002623 176
449 3300003791 Ga0055530_10016026 Ga0055530_100160262 176
450 3300003792 Ga0055540_1034941 Ga0055540_10349412 176
451 3300003794 Ga0055531_10000899 Ga0055531_1000089921 176
452 3300003794 Ga0055531_10001385 Ga0055531_1000138511 176
453 3300003794 Ga0055531_10002897 Ga0055531_100028974 176
454 3300003794 Ga0055531_10036234 Ga0055531_100362342 176
455 3300003794 Ga0055531_10045156 Ga0055531_100451562 176
456 3300005262 Ga0065165_1001058 Ga0065165_100105815 176
457 3300005616 Ga0068852_101047648 Ga0068852_1010476482 176
458 3300006186 Ga0075369_10013650 Ga0075369_100136504 176
459 3300006195 Ga0075366_10146406 Ga0075366_101464061 176
460 3300006353 Ga0075370_10397428 Ga0075370_103974281 176
461 3300009093 Ga0105240_11564385 Ga0105240_115643852 176
462 3300013100 Ga0157373_10000483 Ga0157373_100004833 176
463 3300025250 Ga0209026_1032207 Ga0209026_10322071 176
464 3300025292 Ga0209676_1000224 Ga0209676_1000224101 176
465 3300025292 Ga0209676_1000422 Ga0209676_100042212 176
466 3300025297 Ga0209758_1002891 Ga0209758_10028917 176
467 3300025298 Ga0209050_1000029 Ga0209050_1000029274 176
468 3300025298 Ga0209050_1000463 Ga0209050_100046372 176
469 3300025298 Ga0209050_1001193 Ga0209050_100119335 176
470 3300025298 Ga0209050_1001204 Ga0209050_100120410 176
471 3300025299 Ga0209256_1010255 Ga0209256_10102553 176
472 3300025303 Ga0209051_1008867 Ga0209051_10088674 176
473 3300025304 Ga0209257_1000152 Ga0209257_100015242 176
474 3300025304 Ga0209257_1000512 Ga0209257_100051244 176
475 3300025304 Ga0209257_1001271 Ga0209257_100127129 176
476 3300025304 Ga0209257_1026554 Ga0209257_10265542 176
477 3300025913 Ga0207695_11059629 Ga0207695_110596292 176
478 3300025949 Ga0207667_10112218 Ga0207667_101122183 176
479 3300028794 Ga0307515_10080529 Ga0307515_100805292 176
480 3300031995 Ga0307409_101297984 Ga0307409_1012979842 176
481 3300037312 Ga0395899_0000018 Ga0395899_0000018_81801_82340 176
482 3300041505 Ga0451849_1285073 Ga0451849_1285073_68_598 176
483 3300044656 Ga0466969_0098025 Ga0466969_0098025_247_786 176
484 3300044684 Ga0466966_0048377 Ga0466966_0048377_134_673 176
485 3300044712 Ga0453684_0284929 Ga0453684_0284929_1022_1552 176
486 3300046460 Ga0495638_0000387 Ga0495638_0000387_5932_6462 176
487 3300046471 Ga0495650_0053984 Ga0495650_0053984_139_669 176
488 3300046507 Ga0495606_0084795 Ga0495606_0084795_803_1333 176
489 3300046512 Ga0495610_0008207 Ga0495610_0008207_4223_4753 176
490 3300046518 Ga0495631_0024702 Ga0495631_0024702_2128_2658 176
491 3300046524 Ga0495648_0000130 Ga0495648_0000130_62137_62667 176
492 3300046558 Ga0495633_0385759 Ga0495633_0385759_91_621 176
493 3300046616 Ga0495668_0000060 Ga0495668_0000060_76191_76721 176
494 3300046616 Ga0495668_0006917 Ga0495668_0006917_3071_3601 176
495 3300046616 Ga0495668_0009979 Ga0495668_0009979_2015_2545 176
496 3300046616 Ga0495668_0121672 Ga0495668_0121672_846_1376 176
497 3300046660 Ga0495625_0115670 Ga0495625_0115670_1109_1639 176
498 3300047469 Ga0495673_0000397 Ga0495673_0000397_3910_4440 176
499 3300047472 Ga0495686_0003413 Ga0495686_0003413_11943_12473 176
500 3300047472 Ga0495686_0006846 Ga0495686_0006846_4838_5368 176
501 3300047472 Ga0495686_0022922 Ga0495686_0022922_2735_3265 176
502 3300048915 Ga0496112_0566275 Ga0496112_0566275_442_972 176
503 3300048918 Ga0496115_0112706 Ga0496115_0112706_26_556 176
504 3300048924 Ga0496121_0459648 Ga0496121_0459648_174_704 176
505 3300048927 Ga0496124_0031509 Ga0496124_0031509_3496_4026 176
506 3300048928 Ga0496125_0054108 Ga0496125_0054108_224_754 176
507 3300048929 Ga0496126_0002857 Ga0496126_0002857_11643_12173 176
508 3300049459 Ga0495678_010667 Ga0495678_010667_2702_3232 176
509 3300050493 nmdc:mga0k408_40701_c1 nmdc:mga0k408_40701_c1_2087_2617 176
510 3300050496 nmdc:mga07m45_326376_c1 nmdc:mga07m45_326376_c1_123_653 176
511 3300050496 nmdc:mga07m45_365970_c1 nmdc:mga07m45_365970_c1_115_645 176
512 3300050516 nmdc:mga0sz30_14908_c1 nmdc:mga0sz30_14908_c1_2399_2929 176
513 3300053086 Ga0500578_0000377 Ga0500578_0000377_4209_4739 176
514 3300053088 Ga0500644_0000037 Ga0500644_0000037_46560_47090 176
515 3300053096 Ga0500641_0033204 Ga0500641_0033204_791_1321 176
516 3300053104 Ga0500556_0076320 Ga0500556_0076320_285_815 176
517 3300053108 Ga0500562_006226 Ga0500562_006226_2410_2940 176
518 3300053111 Ga0500572_000763 Ga0500572_000763_8413_8949 176
519 3300053118 Ga0500594_0000422 Ga0500594_0000422_4690_5220 176
520 3300053119 Ga0500595_002355 Ga0500595_002355_2954_3490 176
521 3300053122 Ga0500608_000007 Ga0500608_000007_91433_91963 176
522 3300053133 Ga0500655_033234 Ga0500655_033234_130_660 176
523 3300053136 Ga0500559_0007905 Ga0500559_0007905_4017_4547 176
524 3300053136 Ga0500559_0106168 Ga0500559_0106168_364_900 176
525 3300053138 Ga0500564_000009 Ga0500564_000009_45520_46050 176
526 3300053148 Ga0500590_024734 Ga0500590_024734_383_919 176
527 3300053156 Ga0500622_0000234 Ga0500622_0000234_22796_23326 176
528 3300053156 Ga0500622_0010533 Ga0500622_0010533_4499_5029 176
529 3300053177 Ga0500636_0040609 Ga0500636_0040609_1950_2486 176
530 3300053727 Ga0500611_005677 Ga0500611_005677_1104_1634 176
531 3300053730 Ga0500645_002985 Ga0500645_002985_6578_7108 176
532 3300053733 Ga0500552_017582 Ga0500552_017582_156_692 176
533 iso_pu_bacteria 2585428106 2587919362 176
534 iso_pu_bacteria 2643221640 2644225191 176
535 iso_pu_bacteria 2643221642 2644232499 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

28

184

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qri-assembly1.cif.gz_A 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.9436 6 174
4qri-assembly1.cif.gz_B 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.9407 6 174
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9391 6 174
4rht-assembly3.cif.gz_D crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9373 8 176
4rqa-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) 0.9357 9 176
ID Description Score Start End Superfamily
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9407 6 174 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9373 8 176 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9098 8 176 3.40.50.2020
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9094 86 132 3.40.50.2020
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8997 6 174 3.40.50.2020

Feature Viewer

pLDDT pTM Quality
91.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map