F460618

General Info

Members Datasets Scaffolds Average Seq Length
535 390 416 197

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100191306|Ga0070680_1001913062
Length 212
Sequence VYIHWLVYMMAMANSANPTRERIISAASKLFYSEGIRAVSVDAVAEKAGLTKRTLYYHFRSKDDLVAAYLAARDQPNLALFKRWFDEAEGGLPAKVQAIFRQLARNASHPKWKGCGFLRTSAELANLPGHPAIRTGAAHKKKFEAWLCTVFEEAGIGSASRLARQILLLLDGSFAVVQLHRDPSYMETAGEAAFSLVETALKARSKKDRRGR

Samples

Sample ID Description Type Environment
1 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
2 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
7 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
8 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2643221607 Rhizobium sp. Root73 Isolate Unclassified
14 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
15 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
16 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
17 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
18 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
22 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
23 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
24 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
25 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
26 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
27 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
30 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
31 2841760612 Bosea sp. Tri-49 Isolate Nodule
32 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
33 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
34 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
35 2844104063 Bosea sp. Tri-39 Isolate Nodule
36 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
37 2851182111 Bosea sp. Tri-44 Isolate Nodule
38 2851246043 Bosea sp. Tri-54 Isolate Nodule
39 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
40 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
41 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
42 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
43 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
44 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
45 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
46 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
47 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
48 2909042592 Labrys sp. LIt4 Isolate Nodule
49 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
50 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
51 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
52 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
53 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
54 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
55 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
56 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
57 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
58 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
59 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
60 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
61 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
62 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
63 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
64 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
65 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
66 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
67 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
68 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
69 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
70 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
71 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
72 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
73 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
74 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
75 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
76 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
77 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
78 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
79 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
80 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
81 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
82 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
83 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
84 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
85 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
86 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
87 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
88 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
89 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
90 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
91 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
92 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
93 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
94 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
95 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
96 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
97 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
98 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
99 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
100 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
101 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
102 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
103 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
104 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
105 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
106 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
107 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
108 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
109 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
110 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
111 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
112 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
113 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
114 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
115 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
116 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
117 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
120 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
125 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
128 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
129 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
137 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
138 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
139 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
140 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
144 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
147 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
148 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
155 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
159 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
160 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
162 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
163 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
164 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
165 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
166 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
176 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
181 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
182 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
184 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
231 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
235 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
236 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
237 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
238 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
239 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
240 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
251 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
252 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
271 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
350 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
351 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
354 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
362 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
373 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
374 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
377 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
378 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
379 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
380 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
381 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
382 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
383 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
384 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
385 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
386 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
387 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
388 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
389 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
390 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.2
Metatranscriptomes 0
Isolates 21.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.45
Nodule 20.56
Rhizoplane 3.36
Rhizosphere 46.73
Stem 0
Stem Tuber 0
Unclassified 12.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004129 3300003215 Bacteria 7898
2 JGI25153J46596_10011358 3300003215 Bacteria 3941
3 rootH1_10078946 3300003316 Bacteria 1343
4 rootH2_10035240 3300003320 Bacteria 2731
5 rootL2_10091605 3300003322 Bacteria 1357
6 rootL2_10129084 3300003322 Bacteria 1116
7 rootH1_10032436 3300003323 Bacteria 2247
8 JGI25160J50197_1000841 3300003354 Bacteria 16326
9 JGI25161J50226_1012202 3300003374 Bacteria 1039
10 Ga0055529_1009441 3300003763 Bacteria 1280
11 Ga0055543_1002215 3300004625 Bacteria 6636
12 Ga0065165_1000234 3300005262 Bacteria 96709
13 Ga0065165_1001468 3300005262 Bacteria 25249
14 Ga0065165_1053897 3300005262 Bacteria 1129
15 Ga0070658_10392712 3300005327 Unclassified 1191
16 Ga0070676_10164853 3300005328 Bacteria 1429
17 Ga0070683_100700677 3300005329 Bacteria 970
18 Ga0070680_100191306 3300005336 Bacteria 1724
19 Ga0068868_100107516 3300005338 Bacteria 2264
20 Ga0070668_100309766 3300005347 Bacteria 1326
21 Ga0070668_100311904 3300005347 Bacteria 1322
22 Ga0070668_100772541 3300005347 Bacteria 852
23 Ga0070671_100571411 3300005355 Bacteria 976
24 Ga0070674_100137259 3300005356 Bacteria 1831
25 Ga0070674_100256180 3300005356 Bacteria 1376
26 Ga0070659_100596128 3300005366 Bacteria 949
27 Ga0070667_100234871 3300005367 Bacteria 1636
28 Ga0070713_100000946 3300005436 Bacteria 18564
29 Ga0070713_100014929 3300005436 Bacteria 5783
30 Ga0070713_100017316 3300005436 Bacteria 5446
31 Ga0070701_10288947 3300005438 Bacteria 1004
32 Ga0070663_100035775 3300005455 Bacteria 3447
33 Ga0070662_100084148 3300005457 Bacteria 2376
34 Ga0070681_10100469 3300005458 Bacteria 2839
35 Ga0070706_100214874 3300005467 Bacteria 1795
36 Ga0070698_100139006 3300005471 Bacteria 2382
37 Ga0070698_100888352 3300005471 Bacteria 837
38 Ga0070679_100153372 3300005530 Bacteria 2280
39 Ga0070679_100645577 3300005530 Bacteria 1001
40 Ga0068853_100309031 3300005539 Bacteria 1463
41 Ga0070665_100042136 3300005548 Bacteria 4589
42 Ga0070665_101026163 3300005548 Bacteria 837
43 Ga0070664_100095964 3300005564 Bacteria 2572
44 Ga0068857_100054335 3300005577 Bacteria 3554
45 Ga0068856_101026569 3300005614 Bacteria 843
46 Ga0068852_100914367 3300005616 Bacteria 895
47 Ga0068859_100069746 3300005617 Bacteria 3550
48 Ga0068859_100569196 3300005617 Bacteria 1227
49 Ga0068864_100253057 3300005618 Bacteria 1636
50 Ga0068861_100054256 3300005719 Bacteria 3053
51 Ga0068863_100367228 3300005841 Bacteria 1404
52 Ga0068863_100975676 3300005841 Bacteria 850
53 Ga0068862_100096713 3300005844 Bacteria 2577
54 Ga0068862_100146982 3300005844 Bacteria 2095
55 Ga0068862_100248696 3300005844 Bacteria 1620
56 Ga0081455_10212690 3300005937 Bacteria 1439
57 Ga0075365_10003387 3300006038 Bacteria 8206
58 Ga0075365_10030187 3300006038 Bacteria 3470
59 Ga0075365_10041473 3300006038 Bacteria 3007
60 Ga0075368_10011931 3300006042 Bacteria 3171
61 Ga0075363_100059585 3300006048 Bacteria 2053
62 Ga0075364_10032371 3300006051 Bacteria 3361
63 Ga0075364_10252895 3300006051 Bacteria 1197
64 Ga0070716_100064653 3300006173 Bacteria 2128
65 Ga0070712_100139226 3300006175 Bacteria 1849
66 Ga0075362_10140618 3300006177 Bacteria 1153
67 Ga0075367_10033587 3300006178 Bacteria 2958
68 Ga0075369_10006485 3300006186 Bacteria 4427
69 Ga0075369_10011809 3300006186 Bacteria 3440
70 Ga0075369_10011818 3300006186 Bacteria 3438
71 Ga0075369_10012267 3300006186 Bacteria 3385
72 Ga0075370_10081447 3300006353 Bacteria 1861
73 Ga0075370_10088541 3300006353 Bacteria 1785
74 Ga0075370_10315566 3300006353 Bacteria 931
75 Ga0075428_100150444 3300006844 Bacteria 2529
76 Ga0068865_100048318 3300006881 Bacteria 2928
77 Ga0097620_100069740 3300006931 Bacteria 3550
78 Ga0097620_100569195 3300006931 Bacteria 1227
79 Ga0079104_1005537 3300006946 Bacteria 5022
80 Ga0105240_10080848 3300009093 Bacteria 3995
81 Ga0105240_11566277 3300009093 Bacteria 690
82 Ga0111539_11272897 3300009094 Bacteria 854
83 Ga0105247_10118408 3300009101 Bacteria 1713
84 Ga0114129_10064031 3300009147 Bacteria 5131
85 Ga0105243_10316209 3300009148 Bacteria 1421
86 Ga0105242_10696200 3300009176 Bacteria 994
87 Ga0105242_11048563 3300009176 Bacteria 826
88 Ga0105248_11540365 3300009177 Bacteria 753
89 Ga0105237_10127027 3300009545 Bacteria 2544
90 Ga0105237_10298472 3300009545 Bacteria 1614
91 Ga0105237_10538688 3300009545 Bacteria 1174
92 Ga0105238_10088883 3300009551 Bacteria 3076
93 Ga0105249_10280794 3300009553 Bacteria 1663
94 Ga0105249_11078336 3300009553 Bacteria 873
95 Ga0105239_10095633 3300010375 Bacteria 3281
96 Ga0105239_10327026 3300010375 Bacteria 1729
97 Ga0105239_10529213 3300010375 Bacteria 1341
98 Ga0105239_11170236 3300010375 Bacteria 886
99 Ga0105246_10541473 3300011119 Bacteria 996
100 Ga0157371_10639942 3300013102 Bacteria 793
101 Ga0157369_10169317 3300013105 Bacteria 2302
102 Ga0157369_10267632 3300013105 Bacteria 1782
103 Ga0157374_10522606 3300013296 Bacteria 1193
104 Ga0163162_10092509 3300013306 Bacteria 3108
105 Ga0163162_10166563 3300013306 Bacteria 2328
106 Ga0163162_10467448 3300013306 Bacteria 1393
107 Ga0157372_10018019 3300013307 Bacteria 7590
108 Ga0157375_10018766 3300013308 Bacteria 6276
109 Ga0163163_10245338 3300014325 Bacteria 1841
110 Ga0163163_11134596 3300014325 Bacteria 845
111 Ga0157380_10042815 3300014326 Bacteria 3541
112 Ga0157380_10151121 3300014326 Bacteria 2008
113 Ga0157380_10537987 3300014326 Bacteria 1143
114 Ga0157379_10127062 3300014968 Bacteria 2294
115 Ga0157376_10556052 3300014969 Bacteria 1136
116 Ga0213876_10179215 3300021384 Bacteria 1127
117 Ga0228711_1000042 3300022739 Bacteria 85993
118 Ga0228710_1000046 3300022740 Bacteria 86044
119 Ga0209148_1000447 3300025254 Bacteria 45273
120 Ga0209129_1014845 3300025258 Bacteria 1636
121 Ga0209233_1002216 3300025261 Bacteria 7288
122 Ga0209233_1006939 3300025261 Bacteria 3620
123 Ga0209233_1031519 3300025261 Bacteria 1237
124 Ga0209455_1008321 3300025272 Bacteria 2829
125 Ga0209455_1008768 3300025272 Bacteria 2715
126 Ga0209673_1000015 3300025273 Bacteria 530618
127 Ga0209130_1000609 3300025284 Bacteria 34548
128 Ga0209025_1000697 3300025294 Bacteria 57311
129 Ga0209025_1022689 3300025294 Bacteria 3316
130 Ga0209564_1011344 3300025295 Bacteria 4005
131 Ga0209564_1015012 3300025295 Bacteria 3180
132 Ga0209758_1002745 3300025297 Bacteria 17271
133 Ga0209758_1045391 3300025297 Bacteria 1596
134 Ga0209256_1001669 3300025299 Bacteria 21569
135 Ga0209256_1046966 3300025299 Bacteria 1065
136 Ga0207426_1000561 3300025302 Bacteria 50758
137 Ga0207426_1017862 3300025302 Bacteria 2512
138 Ga0209257_1087799 3300025304 Bacteria 783
139 Ga0207692_10479932 3300025898 Bacteria 786
140 Ga0207642_10337382 3300025899 Bacteria 885
141 Ga0207710_10053599 3300025900 Bacteria 1815
142 Ga0207688_10043328 3300025901 Bacteria 2506
143 Ga0207688_10290355 3300025901 Bacteria 998
144 Ga0207680_10241617 3300025903 Bacteria 1244
145 Ga0207699_10093387 3300025906 Bacteria 1894
146 Ga0207699_10152630 3300025906 Bacteria 1530
147 Ga0207705_10047827 3300025909 Bacteria 3077
148 Ga0207684_10134824 3300025910 Bacteria 2120
149 Ga0207707_10070605 3300025912 Bacteria 3043
150 Ga0207695_10488874 3300025913 Bacteria 1113
151 Ga0207671_10362209 3300025914 Bacteria 1151
152 Ga0207671_10582096 3300025914 Bacteria 892
153 Ga0207693_10063682 3300025915 Bacteria 2889
154 Ga0207663_10308070 3300025916 Bacteria 1186
155 Ga0207660_10214311 3300025917 Bacteria 1509
156 Ga0207652_10032340 3300025921 Bacteria 4397
157 Ga0207652_10466506 3300025921 Bacteria 1138
158 Ga0207652_10898844 3300025921 Bacteria 782
159 Ga0207694_10119977 3300025924 Bacteria 2099
160 Ga0207687_10096536 3300025927 Bacteria 2166
161 Ga0207700_10003014 3300025928 Bacteria 9708
162 Ga0207700_10013126 3300025928 Bacteria 5376
163 Ga0207700_10018998 3300025928 Bacteria 4634
164 Ga0207644_10055708 3300025931 Bacteria 2851
165 Ga0207706_10026773 3300025933 Bacteria 5161
166 Ga0207706_10120381 3300025933 Bacteria 2308
167 Ga0207686_10844789 3300025934 Bacteria 736
168 Ga0207709_10577230 3300025935 Bacteria 887
169 Ga0207669_10033268 3300025937 Bacteria 2907
170 Ga0207704_10135956 3300025938 Bacteria 1711
171 Ga0207661_10022674 3300025944 Bacteria 4732
172 Ga0207679_10120336 3300025945 Bacteria 2089
173 Ga0207679_10292764 3300025945 Bacteria 1400
174 Ga0207712_10142290 3300025961 Bacteria 1842
175 Ga0207668_10057972 3300025972 Bacteria 2704
176 Ga0207658_10746902 3300025986 Bacteria 886
177 Ga0207677_10138497 3300026023 Bacteria 1860
178 Ga0207678_10018204 3300026067 Bacteria 6168
179 Ga0207708_10115100 3300026075 Bacteria 2091
180 Ga0207648_10213284 3300026089 Bacteria 1714
181 Ga0207648_10497987 3300026089 Bacteria 1115
182 Ga0207674_10021891 3300026116 Bacteria 6877
183 Ga0207675_100160986 3300026118 Bacteria 2141
184 Ga0207675_100417090 3300026118 Bacteria 1325
185 Ga0207698_10224352 3300026142 Bacteria 1701
186 Ga0209281_1000246 3300027111 Bacteria 107513
187 Ga0209281_1000620 3300027111 Bacteria 39852
188 Ga0209282_1000062 3300027666 Bacteria 95390
189 Ga0268266_10121542 3300028379 Bacteria 2324
190 Ga0268266_10200390 3300028379 Bacteria 1826
191 Ga0268266_10333252 3300028379 Bacteria 1423
192 Ga0268265_10126182 3300028380 Bacteria 2118
193 Ga0265337_1069445 3300028556 Bacteria 969
194 Ga0265319_1008548 3300028563 Bacteria 4470
195 Ga0265334_10001194 3300028573 Bacteria 12715
196 Ga0265318_10018466 3300028577 Bacteria 2845
197 Ga0265323_10000847 3300028653 Bacteria 16290
198 Ga0265322_10010736 3300028654 Bacteria 2660
199 Ga0265336_10000460 3300028666 Bacteria 24606
200 Ga0307517_10028015 3300028786 Bacteria 6740
201 Ga0307515_10000017 3300028794 Bacteria 550465
202 Ga0307515_10316086 3300028794 Bacteria 1232
203 Ga0265338_10000271 3300028800 Bacteria 94819
204 Ga0307513_10001095 3300031456 Bacteria 39184
205 Ga0307408_100061259 3300031548 Bacteria 2747
206 Ga0307516_10201092 3300031730 Bacteria 1712
207 Ga0307413_10381811 3300031824 Bacteria 1098
208 Ga0315914_1000015 3300031967 Bacteria 128727
209 Ga0307510_10004753 3300033180 Bacteria 16070
210 Ga0315913_1000021 3300033430 Bacteria 95385
211 Ga0315911_1000022 3300033442 Bacteria 118114
212 Ga0315915_1000020 3300033464 Bacteria 128727
213 Ga0373933_0169102 3300035724 Bacteria 1391
214 Ga0436364_0984699 3300037853 Bacteria 692
215 Ga0395901_0229576 3300038443 Bacteria 1938
216 Ga0436365_0911138 3300039437 Bacteria 4911
217 Ga0436365_1113255 3300039437 Bacteria 2241
218 Ga0451841_0467070 3300041498 Bacteria 675
219 Ga0451853_3919501 3300041512 Bacteria 859
220 Ga0466961_0071142 3300044693 Bacteria 2208
221 Ga0466970_0095283 3300044765 Bacteria 1618
222 Ga0466960_0024919 3300044901 Bacteria 2703
223 Ga0466960_0025501 3300044901 Bacteria 2676
224 Ga0466959_0337434 3300045049 Bacteria 1028
225 Ga0451576_0064068 3300045051 Bacteria 3830
226 Ga0466967_0813154 3300045976 Bacteria 928
227 Ga0495617_003742 3300046452 Bacteria 5647
228 Ga0495603_0016412 3300046455 Bacteria 4479
229 Ga0495603_0132948 3300046455 Bacteria 1448
230 Ga0495629_0169929 3300046459 Bacteria 1513
231 Ga0495629_0191643 3300046459 Bacteria 1415
232 Ga0495638_0004601 3300046460 Bacteria 10441
233 Ga0495651_0052876 3300046462 Bacteria 3128
234 Ga0495651_0415467 3300046462 Bacteria 876
235 Ga0495650_0122773 3300046471 Bacteria 954
236 Ga0495605_0015306 3300046474 Bacteria 4176
237 Ga0495605_0022631 3300046474 Bacteria 3316
238 Ga0495584_0058383 3300046491 Bacteria 1941
239 Ga0495584_0082269 3300046491 Bacteria 1621
240 Ga0495585_0060713 3300046492 Bacteria 2080
241 Ga0495594_0082986 3300046499 Bacteria 1791
242 Ga0495594_0516431 3300046499 Bacteria 678
243 Ga0495607_0036310 3300046501 Bacteria 2970
244 Ga0495606_0051452 3300046507 Bacteria 2686
245 Ga0495606_0055337 3300046507 Bacteria 2566
246 Ga0495606_0056797 3300046507 Bacteria 2524
247 Ga0495606_0140154 3300046507 Bacteria 1429
248 Ga0495610_0084113 3300046512 Bacteria 1454
249 Ga0495616_0060780 3300046513 Bacteria 1855
250 Ga0495616_0098118 3300046513 Bacteria 1377
251 Ga0495620_0059059 3300046515 Bacteria 1604
252 Ga0495620_0086654 3300046515 Bacteria 1260
253 Ga0495620_0125467 3300046515 Bacteria 1010
254 Ga0495631_0193517 3300046518 Bacteria 870
255 Ga0495631_0201692 3300046518 Bacteria 850
256 Ga0495632_0029325 3300046519 Bacteria 2866
257 Ga0495632_0051624 3300046519 Bacteria 2023
258 Ga0495643_0026560 3300046522 Bacteria 3265
259 Ga0495648_0029398 3300046524 Bacteria 3648
260 Ga0495648_0073536 3300046524 Bacteria 1973
261 Ga0495648_0103912 3300046524 Bacteria 1561
262 Ga0495648_0310263 3300046524 Bacteria 735
263 Ga0495648_0381363 3300046524 Bacteria 635
264 Ga0495666_0069403 3300046526 Bacteria 1677
265 Ga0495609_0042090 3300046538 Bacteria 2051
266 Ga0495609_0058057 3300046538 Bacteria 1712
267 Ga0495621_0099784 3300046539 Bacteria 1104
268 Ga0495597_0083020 3300046542 Bacteria 1368
269 Ga0495622_0077778 3300046557 Bacteria 1528
270 Ga0495656_0036253 3300046615 Bacteria 2031
271 Ga0495656_0077296 3300046615 Bacteria 1493
272 Ga0495668_0014374 3300046616 Bacteria 4642
273 Ga0495668_0086880 3300046616 Bacteria 1715
274 Ga0495668_0319029 3300046616 Bacteria 852
275 Ga0495634_0505114 3300046642 Bacteria 708
276 Ga0495625_0065386 3300046660 Bacteria 2564
277 Ga0495625_0154210 3300046660 Bacteria 1542
278 Ga0495625_0182704 3300046660 Bacteria 1393
279 Ga0495635_0019559 3300046663 Bacteria 4719
280 Ga0495659_0012357 3300046664 Bacteria 2764
281 Ga0495661_0072500 3300046665 Bacteria 2009
282 Ga0495661_0128422 3300046665 Bacteria 1392
283 Ga0495588_0055718 3300046674 Bacteria 2040
284 Ga0495588_0237078 3300046674 Bacteria 962
285 Ga0495623_0066798 3300046679 Bacteria 2246
286 Ga0495624_0159370 3300046690 Bacteria 1379
287 Ga0495624_0254258 3300046690 Bacteria 1062
288 Ga0495649_0049845 3300046694 Bacteria 2274
289 Ga0495649_0056070 3300046694 Bacteria 2128
290 Ga0495649_0114310 3300046694 Bacteria 1430
291 Ga0495660_0014721 3300046810 Bacteria 4524
292 Ga0495660_0161431 3300046810 Bacteria 1099
293 Ga0495581_0046435 3300047315 Bacteria 2510
294 Ga0495604_0440488 3300047317 Bacteria 852
295 Ga0495683_0093916 3300047323 Bacteria 1450
296 Ga0495687_015074 3300047443 Bacteria 3944
297 Ga0495673_0061002 3300047469 Bacteria 1616
298 Ga0495681_0101395 3300047470 Bacteria 1258
299 Ga0495686_0042990 3300047472 Bacteria 2869
300 Ga0495686_0223481 3300047472 Bacteria 1070
301 Ga0495686_0297472 3300047472 Bacteria 892
302 Ga0495593_0409861 3300047673 Bacteria 678
303 Ga0495626_0211938 3300048091 Bacteria 790
304 Ga0496100_0143671 3300048903 Bacteria 1694
305 Ga0496101_0174375 3300048904 Bacteria 1653
306 Ga0496102_0100383 3300048905 Bacteria 2688
307 Ga0496103_0150773 3300048906 Bacteria 1489
308 Ga0496105_0035790 3300048908 Bacteria 4088
309 Ga0496106_0004867 3300048909 Bacteria 9942
310 Ga0496106_0512370 3300048909 Bacteria 963
311 Ga0496107_0207950 3300048910 Bacteria 1455
312 Ga0496109_0073465 3300048912 Bacteria 3143
313 Ga0496110_0405788 3300048913 Bacteria 1242
314 Ga0496111_0150233 3300048914 Bacteria 1728
315 Ga0496112_0651679 3300048915 Bacteria 983
316 Ga0496112_0704466 3300048915 Bacteria 937
317 Ga0496113_0521561 3300048916 Bacteria 954
318 Ga0496114_0064049 3300048917 Bacteria 3078
319 Ga0496115_0133894 3300048918 Bacteria 2043
320 Ga0496115_0184101 3300048918 Bacteria 1726
321 Ga0496116_0012201 3300048919 Bacteria 7030
322 Ga0496116_0101164 3300048919 Bacteria 1722
323 Ga0496117_0171848 3300048920 Bacteria 1257
324 Ga0496118_0094706 3300048921 Bacteria 2041
325 Ga0496118_0450188 3300048921 Bacteria 654
326 Ga0496119_0000510 3300048922 Bacteria 52939
327 Ga0496119_0315626 3300048922 Bacteria 766
328 Ga0496120_0190378 3300048923 Bacteria 1001
329 Ga0496121_0069847 3300048924 Bacteria 2832
330 Ga0496121_0071687 3300048924 Bacteria 2785
331 Ga0496121_0074084 3300048924 Bacteria 2725
332 Ga0496121_0075419 3300048924 Bacteria 2694
333 Ga0496121_0080731 3300048924 Bacteria 2577
334 Ga0496121_0099904 3300048924 Bacteria 2241
335 Ga0496121_0104994 3300048924 Bacteria 2169
336 Ga0496121_0110495 3300048924 Bacteria 2097
337 Ga0496121_0136154 3300048924 Bacteria 1830
338 Ga0496121_0648852 3300048924 Bacteria 643
339 Ga0496122_0020299 3300048925 Bacteria 6013
340 Ga0496122_0093436 3300048925 Bacteria 2040
341 Ga0496123_0008119 3300048926 Bacteria 9704
342 Ga0496124_0064531 3300048927 Bacteria 3056
343 Ga0496124_0392590 3300048927 Bacteria 966
344 Ga0496125_0000158 3300048928 Bacteria 151273
345 Ga0496125_0055522 3300048928 Bacteria 3226
346 Ga0496125_0056083 3300048928 Bacteria 3203
347 Ga0496125_0060609 3300048928 Bacteria 3040
348 Ga0496125_0153532 3300048928 Bacteria 1577
349 Ga0496126_0075828 3300048929 Bacteria 2984
350 Ga0496126_0153633 3300048929 Bacteria 1971
351 Ga0496126_0305434 3300048929 Bacteria 1311
352 Ga0496126_0413621 3300048929 Bacteria 1091
353 Ga0496126_0526515 3300048929 Bacteria 941
354 Ga0496126_0685454 3300048929 Bacteria 798
355 Ga0495682_0014138 3300049460 Bacteria 3029
356 Ga0501032_0439881 3300049569 Bacteria 836
357 Ga0501033_0164892 3300049570 Bacteria 1593
358 Ga0501036_0140037 3300049572 Bacteria 2041
359 Ga0501037_0282888 3300049573 Bacteria 1155
360 Ga0501039_0197082 3300049575 Bacteria 1583
361 Ga0501042_0255237 3300049578 Bacteria 1265
362 Ga0501043_0260475 3300049579 Bacteria 1334
363 Ga0501047_0029826 3300049581 Bacteria 5258
364 Ga0501047_0109518 3300049581 Bacteria 2645
365 Ga0501047_0203389 3300049581 Bacteria 1840
366 Ga0501067_0139559 3300049583 Bacteria 1349
367 Ga0501070_0910907 3300049586 Bacteria 685
368 Ga0501080_0220906 3300049742 Bacteria 1734
369 Ga0501080_0804681 3300049742 Bacteria 824
370 Ga0501083_0411837 3300049744 Bacteria 880
371 Ga0501044_0080380 3300049823 Bacteria 3302
372 nmdc:mga03683_55297_c1 3300050489 Bacteria 1666
373 nmdc:mga03n38_11295_c1 3300050490 Bacteria 3321
374 nmdc:mga03n38_329361_c1 3300050490 Bacteria 826
375 nmdc:mga00v17_166006_c1 3300050491 Bacteria 1422
376 nmdc:mga00v17_38390_c1 3300050491 Bacteria 2864
377 nmdc:mga00v17_65482_c1 3300050491 Bacteria 2242
378 nmdc:mga0yw44_221211_c1 3300050492 Bacteria 1255
379 nmdc:mga0yw44_42867_c1 3300050492 Bacteria 2700
380 nmdc:mga0yw44_52775_c1 3300050492 Bacteria 2466
381 nmdc:mga0yw44_804612_c1 3300050492 Bacteria 638
382 nmdc:mga0k408_54717_c1 3300050493 Bacteria 2313
383 nmdc:mga06z11_133583_c1 3300050494 Bacteria 1396
384 nmdc:mga06z11_381932_c1 3300050494 Bacteria 846
385 nmdc:mga06z11_64975_c1 3300050494 Bacteria 1914
386 nmdc:mga07m45_92309_c1 3300050496 Bacteria 1735
387 nmdc:mga0sz30_15584_c1 3300050516 Bacteria 3006
388 nmdc:mga0sz30_20777_c1 3300050516 Bacteria 2651
389 Ga0500635_0005875 3300053080 Bacteria 3250
390 Ga0495655_0008234 3300053083 Bacteria 1972
391 Ga0500651_0122487 3300053093 Bacteria 1578
392 Ga0500651_0234917 3300053093 Bacteria 1071
393 Ga0500566_0001441 3300053094 Bacteria 13937
394 Ga0500641_0008772 3300053096 Bacteria 3618
395 Ga0500556_0000097 3300053104 Bacteria 81329
396 Ga0500562_001317 3300053108 Bacteria 6128
397 Ga0500562_025255 3300053108 Bacteria 1554
398 Ga0500594_0082916 3300053118 Bacteria 962
399 Ga0500595_016237 3300053119 Bacteria 2777
400 Ga0500595_028110 3300053119 Bacteria 1920
401 Ga0500595_083885 3300053119 Bacteria 929
402 Ga0500652_000019 3300053131 Bacteria 120149
403 Ga0500658_0000531 3300053134 Bacteria 16070
404 Ga0500568_0004265 3300053139 Bacteria 7683
405 Ga0500577_0055553 3300053142 Bacteria 1504
406 Ga0500604_0018871 3300053151 Bacteria 1926
407 Ga0500604_0077911 3300053151 Bacteria 1067
408 Ga0500627_0134701 3300053158 Bacteria 1116
409 Ga0500636_0018424 3300053177 Bacteria 4129
410 Ga0500636_0021961 3300053177 Bacteria 3777
411 Ga0500649_154153 3300053722 Bacteria 819
412 Ga0500611_014183 3300053727 Bacteria 1385
413 Ga0500645_012347 3300053730 Bacteria 2762
414 Ga0500645_076327 3300053730 Bacteria 958
415 Ga0500645_101565 3300053730 Bacteria 811
416 Ga0530510_0204593 3300061734 Bacteria 1467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885374607 2885383010 163
2 3300046679 Ga0495623_0066798 Ga0495623_0066798_253_810 168
3 3300053080 Ga0500635_0005875 Ga0500635_0005875_19_543 168
4 3300025898 Ga0207692_10479932 Ga0207692_104799322 171
5 iso_pu_bacteria 2784746768 2785373811 182
6 iso_pu_bacteria 2738541317 2738945731 183
7 iso_pu_bacteria 2913308742 2913310587 183
8 iso_pu_bacteria 2524023205 2524438990 187
9 3300006042 Ga0075368_10011931 Ga0075368_100119311 188
10 3300006178 Ga0075367_10033587 Ga0075367_100335872 188
11 3300035724 Ga0373933_0169102 Ga0373933_0169102_229_795 188
12 3300046462 Ga0495651_0415467 Ga0495651_0415467_218_784 188
13 3300050491 nmdc:mga00v17_38390_c1 nmdc:mga00v17_38390_c1_844_1410 188
14 3300050494 nmdc:mga06z11_64975_c1 nmdc:mga06z11_64975_c1_1079_1645 188
15 3300050516 nmdc:mga0sz30_20777_c1 nmdc:mga0sz30_20777_c1_816_1382 188
16 iso_pu_bacteria 2841760612 2841761114 188
17 iso_pu_bacteria 2844104063 2844104139 188
18 iso_pu_bacteria 2851182111 2851184123 188
19 iso_pu_bacteria 2851246043 2851247127 188
20 iso_pu_bacteria 2896384573 2896392289 188
21 iso_pu_bacteria 2920760137 2920761423 188
22 iso_pu_bacteria 8057529695 8057530689 188
23 3300005327 Ga0070658_10392712 Ga0070658_103927122 189
24 3300005530 Ga0070679_100153372 Ga0070679_1001533722 189
25 3300025909 Ga0207705_10047827 Ga0207705_100478272 189
26 3300025921 Ga0207652_10898844 Ga0207652_108988441 189
27 3300053096 Ga0500641_0008772 Ga0500641_0008772_2007_2588 189
28 3300053119 Ga0500595_016237 Ga0500595_016237_688_1269 189
29 3300053119 Ga0500595_083885 Ga0500595_083885_119_700 189
30 3300053131 Ga0500652_000019 Ga0500652_000019_84336_84917 189
31 3300053177 Ga0500636_0018424 Ga0500636_0018424_850_1431 189
32 iso_pu_bacteria 2528768022 2528852751 189
33 iso_pu_bacteria 2643221607 2644050198 189
34 iso_pu_bacteria 2643221636 2644204741 189
35 iso_pu_bacteria 2643221686 2644483118 189
36 iso_pu_bacteria 2791355196 2793060055 189
37 iso_pu_bacteria 2824661429 2824666563 189
38 iso_pu_bacteria 2838686498 2838690752 189
39 iso_pu_bacteria 2838729681 2838735802 189
40 iso_pu_bacteria 2841851746 2841858327 189
41 iso_pu_bacteria 2842304105 2842307619 189
42 iso_pu_bacteria 2844454524 2844460406 189
43 iso_pu_bacteria 2874612657 2874618287 189
44 iso_pu_bacteria 2876761206 2876766626 189
45 iso_pu_bacteria 2929615660 2929616160 189
46 iso_pu_bacteria 2929624759 2929624904 189
47 iso_pu_bacteria 2932784394 2932787173 189
48 iso_pu_bacteria 2932828146 2932835790 189
49 iso_pu_bacteria 2935616580 2935618946 189
50 iso_pu_bacteria 2935638405 2935643237 189
51 iso_pu_bacteria 2935665750 2935669863 189
52 iso_pu_bacteria 2935675223 2935676996 189
53 iso_pu_bacteria 2935694250 2935695472 189
54 iso_pu_bacteria 2935703347 2935709418 189
55 iso_pu_bacteria 2935801545 2935807379 189
56 iso_pu_bacteria 2935810662 2935812520 189
57 iso_pu_bacteria 2935827899 2935832619 189
58 iso_pu_bacteria 2935837841 2935839302 189
59 iso_pu_bacteria 2935855204 2935857311 189
60 iso_pu_bacteria 2935864058 2935864840 189
61 iso_pu_bacteria 2935873716 2935876618 189
62 iso_pu_bacteria 2935992306 2935999029 189
63 iso_pu_bacteria 2936002035 2936008212 189
64 iso_pu_bacteria 2936037263 2936039113 189
65 iso_pu_bacteria 2941538514 2941539992 189
66 iso_pu_bacteria 8016511872 8016515030 189
67 iso_pu_bacteria 8017057580 8017061422 189
68 iso_pu_bacteria 8056967851 8056970044 189
69 3300005548 Ga0070665_101026163 Ga0070665_1010261632 190
70 3300006177 Ga0075362_10140618 Ga0075362_101406182 190
71 3300028379 Ga0268266_10333252 Ga0268266_103332522 190
72 3300048921 Ga0496118_0450188 Ga0496118_0450188_66_638 190
73 3300050489 nmdc:mga03683_55297_c1 nmdc:mga03683_55297_c1_163_735 190
74 3300050490 nmdc:mga03n38_11295_c1 nmdc:mga03n38_11295_c1_141_713 190
75 3300053730 Ga0500645_101565 Ga0500645_101565_67_639 190
76 iso_pu_bacteria 2512875026 2512970575 190
77 iso_pu_bacteria 2513237089 2513601637 190
78 iso_pu_bacteria 2513237096 2513659217 190
79 iso_pu_bacteria 2513237137 2513859061 190
80 iso_pu_bacteria 2513237145 2513921903 190
81 iso_pu_bacteria 2513237156 2513984210 190
82 iso_pu_bacteria 2513237160 2514002920 190
83 iso_pu_bacteria 2517487022 2517570454 190
84 iso_pu_bacteria 2517572143 2517895986 190
85 iso_pu_bacteria 2524023228 2524540206 190
86 iso_pu_bacteria 2667528175 2671122773 190
87 iso_pu_bacteria 2751185821 2753462103 190
88 iso_pu_bacteria 2791355197 2793069587 190
89 iso_pu_bacteria 2802428858 2802716929 190
90 iso_pu_bacteria 2802428859 2802725678 190
91 iso_pu_bacteria 2802428860 2802730233 190
92 iso_pu_bacteria 2802428861 2802737796 190
93 iso_pu_bacteria 2802428862 2802742750 190
94 iso_pu_bacteria 2802428863 2802750238 190
95 iso_pu_bacteria 2841957949 2841959558 190
96 iso_pu_bacteria 2879099564 2879104053 190
97 iso_pu_bacteria 2903748898 2903750293 190
98 iso_pu_bacteria 2904699407 2904711184 190
99 iso_pu_bacteria 2906610324 2906615548 190
100 iso_pu_bacteria 2908739725 2908745632 190
101 iso_pu_bacteria 2915980308 2915983055 190
102 iso_pu_bacteria 2916061851 2916064376 190
103 iso_pu_bacteria 2921250672 2921253902 190
104 iso_pu_bacteria 2922361189 2922367308 190
105 iso_pu_bacteria 2932809354 2932811367 190
106 iso_pu_bacteria 2932818245 2932819760 190
107 iso_pu_bacteria 2935760218 2935761165 190
108 iso_pu_bacteria 2937029754 2937031029 190
109 iso_pu_bacteria 2937036028 2937037101 190
110 iso_pu_bacteria 2937078374 2937081651 190
111 iso_pu_bacteria 2937084907 2937085317 190
112 iso_pu_bacteria 2957375807 2957378452 190
113 iso_pu_bacteria 2957437181 2957439319 190
114 iso_pu_bacteria 2960591022 2960594167 190
115 iso_pu_bacteria 2960631154 2960633708 190
116 iso_pu_bacteria 2960680706 2960680958 190
117 iso_pu_bacteria 2960693952 2960700095 190
118 iso_pu_bacteria 2967686174 2967692941 190
119 iso_pu_bacteria 2967728569 2967730112 190
120 iso_pu_bacteria 2970026789 2970027396 190
121 iso_pu_bacteria 2970122695 2970124832 190
122 iso_pu_bacteria 2970143518 2970145208 190
123 iso_pu_bacteria 2977530762 2977531530 190
124 iso_pu_bacteria 2977544691 2977551216 190
125 iso_pu_bacteria 8003999396 8004001920 190
126 iso_pu_bacteria 8006933436 8006934906 190
127 iso_pu_bacteria 8006973647 8006974874 190
128 3300025916 Ga0207663_10308070 Ga0207663_103080702 191
129 3300041512 Ga0451853_3919501 Ga0451853_3919501_186_761 191
130 iso_pu_bacteria 2906635258 2906641995 191
131 iso_pu_bacteria 2906660503 2906664981 191
132 iso_pu_bacteria 2909042592 2909046668 191
133 iso_pu_bacteria 2922368715 2922375424 191
134 iso_pu_bacteria 2935684952 2935693038 191
135 iso_pu_bacteria 2935713505 2935719646 191
136 iso_pu_bacteria 2935722832 2935729587 191
137 iso_pu_bacteria 2935732158 2935739529 191
138 iso_pu_bacteria 2935741537 2935748567 191
139 iso_pu_bacteria 2935750917 2935756846 191
140 iso_pu_bacteria 2940556831 2940562760 191
141 iso_pu_bacteria 8002285264 8002288271 191
142 iso_pu_bacteria 8019576017 8019580899 191
143 iso_pu_bacteria 8019586578 8019588632 191
144 iso_pu_bacteria 8019597564 8019602703 191
145 3300005548 Ga0070665_100042136 Ga0070665_1000421366 192
146 3300013102 Ga0157371_10639942 Ga0157371_106399421 192
147 3300025273 Ga0209673_1000015 Ga0209673_1000015559 192
148 3300025294 Ga0209025_1022689 Ga0209025_10226892 192
149 3300025299 Ga0209256_1001669 Ga0209256_10016699 192
150 3300028379 Ga0268266_10121542 Ga0268266_101215422 192
151 3300047472 Ga0495686_0297472 Ga0495686_0297472_11_601 192
152 3300048922 Ga0496119_0000510 Ga0496119_0000510_16015_16593 192
153 3300048925 Ga0496122_0020299 Ga0496122_0020299_4605_5183 192
154 3300048926 Ga0496123_0008119 Ga0496123_0008119_7351_7929 192
155 3300048929 Ga0496126_0075828 Ga0496126_0075828_89_697 192
156 3300050494 nmdc:mga06z11_381932_c1 nmdc:mga06z11_381932_c1_170_748 192
157 3300053104 Ga0500556_0000097 Ga0500556_0000097_17676_18254 192
158 3300003215 JGI25153J46596_10011358 JGI25153J46596_100113585 193
159 3300003322 rootL2_10129084 rootL2_101290841 193
160 3300003763 Ga0055529_1009441 Ga0055529_10094412 193
161 3300005338 Ga0068868_100107516 Ga0068868_1001075162 193
162 3300005347 Ga0070668_100309766 Ga0070668_1003097662 193
163 3300005366 Ga0070659_100596128 Ga0070659_1005961281 193
164 3300005436 Ga0070713_100014929 Ga0070713_1000149293 193
165 3300005455 Ga0070663_100035775 Ga0070663_1000357752 193
166 3300005564 Ga0070664_100095964 Ga0070664_1000959643 193
167 3300005617 Ga0068859_100569196 Ga0068859_1005691962 193
168 3300005618 Ga0068864_100253057 Ga0068864_1002530571 193
169 3300005841 Ga0068863_100975676 Ga0068863_1009756761 193
170 3300005844 Ga0068862_100248696 Ga0068862_1002486962 193
171 3300005937 Ga0081455_10212690 Ga0081455_102126902 193
172 3300006353 Ga0075370_10315566 Ga0075370_103155661 193
173 3300006931 Ga0097620_100569195 Ga0097620_1005691951 193
174 3300009093 Ga0105240_11566277 Ga0105240_115662771 193
175 3300009101 Ga0105247_10118408 Ga0105247_101184082 193
176 3300009545 Ga0105237_10127027 Ga0105237_101270273 193
177 3300009545 Ga0105237_10538688 Ga0105237_105386882 193
178 3300010375 Ga0105239_10327026 Ga0105239_103270262 193
179 3300010375 Ga0105239_10529213 Ga0105239_105292132 193
180 3300011119 Ga0105246_10541473 Ga0105246_105414732 193
181 3300013306 Ga0163162_10166563 Ga0163162_101665632 193
182 3300013308 Ga0157375_10018766 Ga0157375_100187666 193
183 3300014325 Ga0163163_10245338 Ga0163163_102453382 193
184 3300014968 Ga0157379_10127062 Ga0157379_101270622 193
185 3300014969 Ga0157376_10556052 Ga0157376_105560522 193
186 3300025254 Ga0209148_1000447 Ga0209148_100044741 193
187 3300025258 Ga0209129_1014845 Ga0209129_10148452 193
188 3300025272 Ga0209455_1008768 Ga0209455_10087683 193
189 3300025295 Ga0209564_1015012 Ga0209564_10150122 193
190 3300025900 Ga0207710_10053599 Ga0207710_100535991 193
191 3300025906 Ga0207699_10093387 Ga0207699_100933872 193
192 3300025914 Ga0207671_10362209 Ga0207671_103622092 193
193 3300025928 Ga0207700_10013126 Ga0207700_100131263 193
194 3300025933 Ga0207706_10120381 Ga0207706_101203813 193
195 3300025945 Ga0207679_10292764 Ga0207679_102927642 193
196 3300026023 Ga0207677_10138497 Ga0207677_101384972 193
197 3300026067 Ga0207678_10018204 Ga0207678_100182043 193
198 3300026089 Ga0207648_10497987 Ga0207648_104979871 193
199 3300028794 Ga0307515_10000017 Ga0307515_10000017128 193
200 3300031456 Ga0307513_10001095 Ga0307513_1000109534 193
201 3300044901 Ga0466960_0024919 Ga0466960_0024919_1704_2285 193
202 3300045976 Ga0466967_0813154 Ga0466967_0813154_20_601 193
203 3300046459 Ga0495629_0191643 Ga0495629_0191643_425_1006 193
204 3300046460 Ga0495638_0004601 Ga0495638_0004601_1021_1602 193
205 3300046462 Ga0495651_0052876 Ga0495651_0052876_209_790 193
206 3300046471 Ga0495650_0122773 Ga0495650_0122773_337_921 193
207 3300046474 Ga0495605_0015306 Ga0495605_0015306_1864_2448 193
208 3300046491 Ga0495584_0082269 Ga0495584_0082269_874_1455 193
209 3300046499 Ga0495594_0516431 Ga0495594_0516431_33_614 193
210 3300046501 Ga0495607_0036310 Ga0495607_0036310_2214_2798 193
211 3300046507 Ga0495606_0051452 Ga0495606_0051452_1388_1972 193
212 3300046507 Ga0495606_0055337 Ga0495606_0055337_1430_2011 193
213 3300046507 Ga0495606_0056797 Ga0495606_0056797_379_960 193
214 3300046512 Ga0495610_0084113 Ga0495610_0084113_268_852 193
215 3300046515 Ga0495620_0086654 Ga0495620_0086654_629_1213 193
216 3300046515 Ga0495620_0125467 Ga0495620_0125467_131_712 193
217 3300046519 Ga0495632_0051624 Ga0495632_0051624_205_789 193
218 3300046522 Ga0495643_0026560 Ga0495643_0026560_1722_2306 193
219 3300046524 Ga0495648_0029398 Ga0495648_0029398_1997_2578 193
220 3300046524 Ga0495648_0073536 Ga0495648_0073536_945_1526 193
221 3300046524 Ga0495648_0103912 Ga0495648_0103912_320_904 193
222 3300046524 Ga0495648_0310263 Ga0495648_0310263_106_687 193
223 3300046538 Ga0495609_0058057 Ga0495609_0058057_628_1209 193
224 3300046542 Ga0495597_0083020 Ga0495597_0083020_673_1257 193
225 3300046616 Ga0495668_0086880 Ga0495668_0086880_267_851 193
226 3300046616 Ga0495668_0319029 Ga0495668_0319029_232_813 193
227 3300046642 Ga0495634_0505114 Ga0495634_0505114_62_643 193
228 3300046660 Ga0495625_0154210 Ga0495625_0154210_476_1060 193
229 3300046663 Ga0495635_0019559 Ga0495635_0019559_2383_2964 193
230 3300046665 Ga0495661_0128422 Ga0495661_0128422_738_1322 193
231 3300046674 Ga0495588_0237078 Ga0495588_0237078_10_591 193
232 3300046690 Ga0495624_0254258 Ga0495624_0254258_164_745 193
233 3300046694 Ga0495649_0056070 Ga0495649_0056070_291_872 193
234 3300046810 Ga0495660_0014721 Ga0495660_0014721_1722_2306 193
235 3300047317 Ga0495604_0440488 Ga0495604_0440488_144_725 193
236 3300047443 Ga0495687_015074 Ga0495687_015074_240_824 193
237 3300047470 Ga0495681_0101395 Ga0495681_0101395_584_1168 193
238 3300048091 Ga0495626_0211938 Ga0495626_0211938_111_695 193
239 3300048903 Ga0496100_0143671 Ga0496100_0143671_745_1326 193
240 3300048904 Ga0496101_0174375 Ga0496101_0174375_617_1198 193
241 3300048905 Ga0496102_0100383 Ga0496102_0100383_399_980 193
242 3300048906 Ga0496103_0150773 Ga0496103_0150773_881_1462 193
243 3300048908 Ga0496105_0035790 Ga0496105_0035790_3233_3814 193
244 3300048909 Ga0496106_0004867 Ga0496106_0004867_5375_5956 193
245 3300048909 Ga0496106_0512370 Ga0496106_0512370_233_814 193
246 3300048910 Ga0496107_0207950 Ga0496107_0207950_558_1139 193
247 3300048912 Ga0496109_0073465 Ga0496109_0073465_283_864 193
248 3300048913 Ga0496110_0405788 Ga0496110_0405788_214_795 193
249 3300048914 Ga0496111_0150233 Ga0496111_0150233_1108_1689 193
250 3300048915 Ga0496112_0704466 Ga0496112_0704466_21_602 193
251 3300048916 Ga0496113_0521561 Ga0496113_0521561_272_853 193
252 3300048917 Ga0496114_0064049 Ga0496114_0064049_1193_1774 193
253 3300048918 Ga0496115_0133894 Ga0496115_0133894_155_736 193
254 3300048918 Ga0496115_0184101 Ga0496115_0184101_453_1034 193
255 3300048919 Ga0496116_0012201 Ga0496116_0012201_129_710 193
256 3300048919 Ga0496116_0101164 Ga0496116_0101164_1125_1709 193
257 3300048920 Ga0496117_0171848 Ga0496117_0171848_131_715 193
258 3300048922 Ga0496119_0315626 Ga0496119_0315626_131_712 193
259 3300048923 Ga0496120_0190378 Ga0496120_0190378_41_622 193
260 3300048924 Ga0496121_0110495 Ga0496121_0110495_180_761 193
261 3300048924 Ga0496121_0136154 Ga0496121_0136154_1147_1728 193
262 3300048927 Ga0496124_0392590 Ga0496124_0392590_146_730 193
263 3300048928 Ga0496125_0060609 Ga0496125_0060609_1296_1877 193
264 3300049460 Ga0495682_0014138 Ga0495682_0014138_1431_2012 193
265 3300050490 nmdc:mga03n38_329361_c1 nmdc:mga03n38_329361_c1_84_665 193
266 3300050492 nmdc:mga0yw44_42867_c1 nmdc:mga0yw44_42867_c1_550_1131 193
267 3300053083 Ga0495655_0008234 Ga0495655_0008234_405_986 193
268 3300053093 Ga0500651_0122487 Ga0500651_0122487_466_1047 193
269 3300053108 Ga0500562_001317 Ga0500562_001317_2601_3182 193
270 3300053118 Ga0500594_0082916 Ga0500594_0082916_173_757 193
271 3300053119 Ga0500595_028110 Ga0500595_028110_14_595 193
272 3300053134 Ga0500658_0000531 Ga0500658_0000531_393_977 193
273 3300053139 Ga0500568_0004265 Ga0500568_0004265_4646_5227 193
274 3300053142 Ga0500577_0055553 Ga0500577_0055553_19_603 193
275 3300053151 Ga0500604_0018871 Ga0500604_0018871_1004_1588 193
276 3300053151 Ga0500604_0077911 Ga0500604_0077911_47_628 193
277 3300053722 Ga0500649_154153 Ga0500649_154153_183_764 193
278 3300053727 Ga0500611_014183 Ga0500611_014183_709_1290 193
279 iso_pu_bacteria 8006984368 8006989739 193
280 iso_pu_bacteria 8019608314 8019615857 193
281 iso_pu_bacteria 8055742211 8055747807 193
282 3300005328 Ga0070676_10164853 Ga0070676_101648532 194
283 3300005347 Ga0070668_100311904 Ga0070668_1003119042 194
284 3300005347 Ga0070668_100772541 Ga0070668_1007725411 194
285 3300005355 Ga0070671_100571411 Ga0070671_1005714112 194
286 3300005356 Ga0070674_100137259 Ga0070674_1001372592 194
287 3300005356 Ga0070674_100256180 Ga0070674_1002561802 194
288 3300005367 Ga0070667_100234871 Ga0070667_1002348711 194
289 3300005438 Ga0070701_10288947 Ga0070701_102889471 194
290 3300005457 Ga0070662_100084148 Ga0070662_1000841482 194
291 3300005471 Ga0070698_100888352 Ga0070698_1008883521 194
292 3300005614 Ga0068856_101026569 Ga0068856_1010265692 194
293 3300005616 Ga0068852_100914367 Ga0068852_1009143671 194
294 3300005617 Ga0068859_100069746 Ga0068859_1000697462 194
295 3300005719 Ga0068861_100054256 Ga0068861_1000542565 194
296 3300005841 Ga0068863_100367228 Ga0068863_1003672282 194
297 3300005844 Ga0068862_100096713 Ga0068862_1000967133 194
298 3300005844 Ga0068862_100146982 Ga0068862_1001469824 194
299 3300006038 Ga0075365_10003387 Ga0075365_100033877 194
300 3300006038 Ga0075365_10041473 Ga0075365_100414732 194
301 3300006048 Ga0075363_100059585 Ga0075363_1000595854 194
302 3300006051 Ga0075364_10252895 Ga0075364_102528952 194
303 3300006186 Ga0075369_10011818 Ga0075369_100118184 194
304 3300006353 Ga0075370_10088541 Ga0075370_100885412 194
305 3300006844 Ga0075428_100150444 Ga0075428_1001504441 194
306 3300006881 Ga0068865_100048318 Ga0068865_1000483184 194
307 3300006931 Ga0097620_100069740 Ga0097620_1000697403 194
308 3300006946 Ga0079104_1005537 Ga0079104_10055373 194
309 3300009094 Ga0111539_11272897 Ga0111539_112728972 194
310 3300009147 Ga0114129_10064031 Ga0114129_100640313 194
311 3300009148 Ga0105243_10316209 Ga0105243_103162091 194
312 3300009176 Ga0105242_10696200 Ga0105242_106962002 194
313 3300009176 Ga0105242_11048563 Ga0105242_110485632 194
314 3300009177 Ga0105248_11540365 Ga0105248_115403651 194
315 3300009553 Ga0105249_10280794 Ga0105249_102807942 194
316 3300009553 Ga0105249_11078336 Ga0105249_110783361 194
317 3300010375 Ga0105239_11170236 Ga0105239_111702362 194
318 3300013296 Ga0157374_10522606 Ga0157374_105226061 194
319 3300013306 Ga0163162_10092509 Ga0163162_100925096 194
320 3300013306 Ga0163162_10467448 Ga0163162_104674482 194
321 3300014325 Ga0163163_11134596 Ga0163163_111345962 194
322 3300014326 Ga0157380_10042815 Ga0157380_100428152 194
323 3300014326 Ga0157380_10151121 Ga0157380_101511213 194
324 3300014326 Ga0157380_10537987 Ga0157380_105379871 194
325 3300022739 Ga0228711_1000042 Ga0228711_100004212 194
326 3300022740 Ga0228710_1000046 Ga0228710_100004665 194
327 3300025261 Ga0209233_1002216 Ga0209233_10022161 194
328 3300025899 Ga0207642_10337382 Ga0207642_103373821 194
329 3300025901 Ga0207688_10043328 Ga0207688_100433284 194
330 3300025901 Ga0207688_10290355 Ga0207688_102903551 194
331 3300025903 Ga0207680_10241617 Ga0207680_102416171 194
332 3300025927 Ga0207687_10096536 Ga0207687_100965361 194
333 3300025931 Ga0207644_10055708 Ga0207644_100557082 194
334 3300025933 Ga0207706_10026773 Ga0207706_100267733 194
335 3300025934 Ga0207686_10844789 Ga0207686_108447891 194
336 3300025935 Ga0207709_10577230 Ga0207709_105772301 194
337 3300025937 Ga0207669_10033268 Ga0207669_100332683 194
338 3300025938 Ga0207704_10135956 Ga0207704_101359561 194
339 3300025945 Ga0207679_10120336 Ga0207679_101203362 194
340 3300025961 Ga0207712_10142290 Ga0207712_101422903 194
341 3300025972 Ga0207668_10057972 Ga0207668_100579722 194
342 3300025986 Ga0207658_10746902 Ga0207658_107469021 194
343 3300026075 Ga0207708_10115100 Ga0207708_101151001 194
344 3300026089 Ga0207648_10213284 Ga0207648_102132842 194
345 3300026118 Ga0207675_100160986 Ga0207675_1001609863 194
346 3300026118 Ga0207675_100417090 Ga0207675_1004170902 194
347 3300027111 Ga0209281_1000246 Ga0209281_100024612 194
348 3300027111 Ga0209281_1000620 Ga0209281_100062019 194
349 3300027666 Ga0209282_1000062 Ga0209282_100006212 194
350 3300028379 Ga0268266_10200390 Ga0268266_102003903 194
351 3300028380 Ga0268265_10126182 Ga0268265_101261823 194
352 3300028786 Ga0307517_10028015 Ga0307517_100280157 194
353 3300028794 Ga0307515_10316086 Ga0307515_103160862 194
354 3300031548 Ga0307408_100061259 Ga0307408_1000612593 194
355 3300031730 Ga0307516_10201092 Ga0307516_102010922 194
356 3300031824 Ga0307413_10381811 Ga0307413_103818111 194
357 3300031967 Ga0315914_1000015 Ga0315914_100001538 194
358 3300033180 Ga0307510_10004753 Ga0307510_1000475314 194
359 3300033430 Ga0315913_1000021 Ga0315913_100002173 194
360 3300033464 Ga0315915_1000020 Ga0315915_100002038 194
361 3300041498 Ga0451841_0467070 Ga0451841_0467070_47_664 194
362 3300045051 Ga0451576_0064068 Ga0451576_0064068_215_799 194
363 3300046452 Ga0495617_003742 Ga0495617_003742_422_1021 194
364 3300046455 Ga0495603_0016412 Ga0495603_0016412_1231_1830 194
365 3300046455 Ga0495603_0132948 Ga0495603_0132948_687_1286 194
366 3300046459 Ga0495629_0169929 Ga0495629_0169929_462_1088 194
367 3300046474 Ga0495605_0022631 Ga0495605_0022631_1618_2217 194
368 3300046491 Ga0495584_0058383 Ga0495584_0058383_1295_1903 194
369 3300046492 Ga0495585_0060713 Ga0495585_0060713_560_1159 194
370 3300046499 Ga0495594_0082986 Ga0495594_0082986_361_960 194
371 3300046507 Ga0495606_0140154 Ga0495606_0140154_728_1327 194
372 3300046513 Ga0495616_0060780 Ga0495616_0060780_744_1370 194
373 3300046513 Ga0495616_0098118 Ga0495616_0098118_717_1316 194
374 3300046515 Ga0495620_0059059 Ga0495620_0059059_593_1201 194
375 3300046518 Ga0495631_0193517 Ga0495631_0193517_144_761 194
376 3300046518 Ga0495631_0201692 Ga0495631_0201692_160_759 194
377 3300046519 Ga0495632_0029325 Ga0495632_0029325_2013_2612 194
378 3300046524 Ga0495648_0381363 Ga0495648_0381363_15_614 194
379 3300046526 Ga0495666_0069403 Ga0495666_0069403_823_1422 194
380 3300046538 Ga0495609_0042090 Ga0495609_0042090_169_768 194
381 3300046539 Ga0495621_0099784 Ga0495621_0099784_118_726 194
382 3300046557 Ga0495622_0077778 Ga0495622_0077778_135_734 194
383 3300046615 Ga0495656_0036253 Ga0495656_0036253_642_1241 194
384 3300046615 Ga0495656_0077296 Ga0495656_0077296_214_840 194
385 3300046616 Ga0495668_0014374 Ga0495668_0014374_3113_3712 194
386 3300046660 Ga0495625_0065386 Ga0495625_0065386_118_717 194
387 3300046660 Ga0495625_0182704 Ga0495625_0182704_447_1046 194
388 3300046664 Ga0495659_0012357 Ga0495659_0012357_921_1520 194
389 3300046665 Ga0495661_0072500 Ga0495661_0072500_532_1131 194
390 3300046674 Ga0495588_0055718 Ga0495588_0055718_107_706 194
391 3300046690 Ga0495624_0159370 Ga0495624_0159370_457_1056 194
392 3300046694 Ga0495649_0049845 Ga0495649_0049845_1192_1791 194
393 3300046694 Ga0495649_0114310 Ga0495649_0114310_636_1262 194
394 3300046810 Ga0495660_0161431 Ga0495660_0161431_43_642 194
395 3300047315 Ga0495581_0046435 Ga0495581_0046435_1558_2190 194
396 3300047323 Ga0495683_0093916 Ga0495683_0093916_636_1244 194
397 3300047469 Ga0495673_0061002 Ga0495673_0061002_754_1353 194
398 3300047472 Ga0495686_0042990 Ga0495686_0042990_1705_2331 194
399 3300047472 Ga0495686_0223481 Ga0495686_0223481_126_737 194
400 3300047673 Ga0495593_0409861 Ga0495593_0409861_23_640 194
401 3300048915 Ga0496112_0651679 Ga0496112_0651679_279_875 194
402 3300048924 Ga0496121_0074084 Ga0496121_0074084_592_1191 194
403 3300048924 Ga0496121_0099904 Ga0496121_0099904_1340_1933 194
404 3300048924 Ga0496121_0648852 Ga0496121_0648852_17_613 194
405 3300048928 Ga0496125_0153532 Ga0496125_0153532_348_941 194
406 3300048929 Ga0496126_0305434 Ga0496126_0305434_687_1283 194
407 3300049569 Ga0501032_0439881 Ga0501032_0439881_131_715 194
408 3300049570 Ga0501033_0164892 Ga0501033_0164892_245_859 194
409 3300049572 Ga0501036_0140037 Ga0501036_0140037_158_772 194
410 3300049573 Ga0501037_0282888 Ga0501037_0282888_189_803 194
411 3300049575 Ga0501039_0197082 Ga0501039_0197082_667_1281 194
412 3300049578 Ga0501042_0255237 Ga0501042_0255237_617_1210 194
413 3300049579 Ga0501043_0260475 Ga0501043_0260475_456_1070 194
414 3300049581 Ga0501047_0109518 Ga0501047_0109518_737_1321 194
415 3300049581 Ga0501047_0203389 Ga0501047_0203389_1068_1682 194
416 3300049583 Ga0501067_0139559 Ga0501067_0139559_169_753 194
417 3300049586 Ga0501070_0910907 Ga0501070_0910907_61_675 194
418 3300049742 Ga0501080_0804681 Ga0501080_0804681_24_638 194
419 3300049744 Ga0501083_0411837 Ga0501083_0411837_85_669 194
420 3300049823 Ga0501044_0080380 Ga0501044_0080380_2411_3025 194
421 3300050491 nmdc:mga00v17_65482_c1 nmdc:mga00v17_65482_c1_311_913 194
422 3300050492 nmdc:mga0yw44_52775_c1 nmdc:mga0yw44_52775_c1_1440_2042 194
423 3300050492 nmdc:mga0yw44_804612_c1 nmdc:mga0yw44_804612_c1_30_614 194
424 3300050493 nmdc:mga0k408_54717_c1 nmdc:mga0k408_54717_c1_784_1386 194
425 3300050494 nmdc:mga06z11_133583_c1 nmdc:mga06z11_133583_c1_290_892 194
426 3300050496 nmdc:mga07m45_92309_c1 nmdc:mga07m45_92309_c1_587_1189 194
427 3300050516 nmdc:mga0sz30_15584_c1 nmdc:mga0sz30_15584_c1_184_786 194
428 3300053108 Ga0500562_025255 Ga0500562_025255_55_654 194
429 3300053158 Ga0500627_0134701 Ga0500627_0134701_377_982 194
430 3300053730 Ga0500645_012347 Ga0500645_012347_1837_2430 194
431 3300053730 Ga0500645_076327 Ga0500645_076327_35_634 194
432 3300061734 Ga0530510_0204593 Ga0530510_0204593_787_1395 194
433 3300003215 JGI25153J46596_10004129 JGI25153J46596_100041295 195
434 3300003316 rootH1_10078946 rootH1_100789462 195
435 3300003320 rootH2_10035240 rootH2_100352402 195
436 3300003322 rootL2_10091605 rootL2_100916052 195
437 3300003323 rootH1_10032436 rootH1_100324362 195
438 3300003354 JGI25160J50197_1000841 JGI25160J50197_100084110 195
439 3300003374 JGI25161J50226_1012202 JGI25161J50226_10122022 195
440 3300004625 Ga0055543_1002215 Ga0055543_10022155 195
441 3300005262 Ga0065165_1000234 Ga0065165_100023419 195
442 3300005262 Ga0065165_1001468 Ga0065165_100146810 195
443 3300005262 Ga0065165_1053897 Ga0065165_10538972 195
444 3300005329 Ga0070683_100700677 Ga0070683_1007006772 195
445 3300005336 Ga0070680_100191306 Ga0070680_1001913062 195
446 3300005436 Ga0070713_100000946 Ga0070713_10000094616 195
447 3300005436 Ga0070713_100017316 Ga0070713_1000173166 195
448 3300005458 Ga0070681_10100469 Ga0070681_101004692 195
449 3300005467 Ga0070706_100214874 Ga0070706_1002148741 195
450 3300005471 Ga0070698_100139006 Ga0070698_1001390062 195
451 3300005530 Ga0070679_100645577 Ga0070679_1006455771 195
452 3300005539 Ga0068853_100309031 Ga0068853_1003090313 195
453 3300005577 Ga0068857_100054335 Ga0068857_1000543355 195
454 3300006038 Ga0075365_10030187 Ga0075365_100301873 195
455 3300006051 Ga0075364_10032371 Ga0075364_100323712 195
456 3300006173 Ga0070716_100064653 Ga0070716_1000646532 195
457 3300006175 Ga0070712_100139226 Ga0070712_1001392262 195
458 3300006186 Ga0075369_10006485 Ga0075369_100064855 195
459 3300006186 Ga0075369_10011809 Ga0075369_100118093 195
460 3300006186 Ga0075369_10012267 Ga0075369_100122673 195
461 3300006353 Ga0075370_10081447 Ga0075370_100814472 195
462 3300009093 Ga0105240_10080848 Ga0105240_100808486 195
463 3300009545 Ga0105237_10298472 Ga0105237_102984722 195
464 3300009551 Ga0105238_10088883 Ga0105238_100888833 195
465 3300010375 Ga0105239_10095633 Ga0105239_100956332 195
466 3300013105 Ga0157369_10169317 Ga0157369_101693172 195
467 3300013105 Ga0157369_10267632 Ga0157369_102676322 195
468 3300013307 Ga0157372_10018019 Ga0157372_100180197 195
469 3300021384 Ga0213876_10179215 Ga0213876_101792152 195
470 3300025261 Ga0209233_1006939 Ga0209233_10069393 195
471 3300025261 Ga0209233_1031519 Ga0209233_10315192 195
472 3300025272 Ga0209455_1008321 Ga0209455_10083214 195
473 3300025284 Ga0209130_1000609 Ga0209130_100060920 195
474 3300025294 Ga0209025_1000697 Ga0209025_10006975 195
475 3300025295 Ga0209564_1011344 Ga0209564_10113444 195
476 3300025297 Ga0209758_1002745 Ga0209758_10027453 195
477 3300025297 Ga0209758_1045391 Ga0209758_10453912 195
478 3300025299 Ga0209256_1046966 Ga0209256_10469662 195
479 3300025302 Ga0207426_1000561 Ga0207426_100056114 195
480 3300025302 Ga0207426_1017862 Ga0207426_10178624 195
481 3300025304 Ga0209257_1087799 Ga0209257_10877991 195
482 3300025906 Ga0207699_10152630 Ga0207699_101526302 195
483 3300025910 Ga0207684_10134824 Ga0207684_101348243 195
484 3300025912 Ga0207707_10070605 Ga0207707_100706052 195
485 3300025913 Ga0207695_10488874 Ga0207695_104888741 195
486 3300025914 Ga0207671_10582096 Ga0207671_105820961 195
487 3300025915 Ga0207693_10063682 Ga0207693_100636823 195
488 3300025917 Ga0207660_10214311 Ga0207660_102143112 195
489 3300025921 Ga0207652_10032340 Ga0207652_100323406 195
490 3300025921 Ga0207652_10466506 Ga0207652_104665062 195
491 3300025924 Ga0207694_10119977 Ga0207694_101199771 195
492 3300025928 Ga0207700_10003014 Ga0207700_1000301412 195
493 3300025928 Ga0207700_10018998 Ga0207700_100189982 195
494 3300025944 Ga0207661_10022674 Ga0207661_100226741 195
495 3300026116 Ga0207674_10021891 Ga0207674_100218918 195
496 3300026142 Ga0207698_10224352 Ga0207698_102243523 195
497 3300028556 Ga0265337_1069445 Ga0265337_10694452 195
498 3300028563 Ga0265319_1008548 Ga0265319_10085483 195
499 3300028573 Ga0265334_10001194 Ga0265334_100011947 195
500 3300028577 Ga0265318_10018466 Ga0265318_100184663 195
501 3300028653 Ga0265323_10000847 Ga0265323_1000084717 195
502 3300028654 Ga0265322_10010736 Ga0265322_100107361 195
503 3300028666 Ga0265336_10000460 Ga0265336_1000046023 195
504 3300028800 Ga0265338_10000271 Ga0265338_1000027111 195
505 3300033442 Ga0315911_1000022 Ga0315911_100002217 195
506 3300037853 Ga0436364_0984699 Ga0436364_0984699_22_633 195
507 3300038443 Ga0395901_0229576 Ga0395901_0229576_35_631 195
508 3300039437 Ga0436365_0911138 Ga0436365_0911138_3298_3921 195
509 3300039437 Ga0436365_1113255 Ga0436365_1113255_957_1562 195
510 3300044693 Ga0466961_0071142 Ga0466961_0071142_1062_1667 195
511 3300044765 Ga0466970_0095283 Ga0466970_0095283_34_639 195
512 3300044901 Ga0466960_0025501 Ga0466960_0025501_1774_2361 195
513 3300045049 Ga0466959_0337434 Ga0466959_0337434_127_744 195
514 3300048921 Ga0496118_0094706 Ga0496118_0094706_1185_1790 195
515 3300048924 Ga0496121_0069847 Ga0496121_0069847_2015_2614 195
516 3300048924 Ga0496121_0071687 Ga0496121_0071687_1983_2588 195
517 3300048924 Ga0496121_0075419 Ga0496121_0075419_1101_1703 195
518 3300048924 Ga0496121_0080731 Ga0496121_0080731_29_634 195
519 3300048924 Ga0496121_0104994 Ga0496121_0104994_647_1252 195
520 3300048925 Ga0496122_0093436 Ga0496122_0093436_1101_1703 195
521 3300048927 Ga0496124_0064531 Ga0496124_0064531_1292_1921 195
522 3300048928 Ga0496125_0000158 Ga0496125_0000158_78136_78738 195
523 3300048928 Ga0496125_0055522 Ga0496125_0055522_1609_2196 195
524 3300048928 Ga0496125_0056083 Ga0496125_0056083_1281_1910 195
525 3300048929 Ga0496126_0153633 Ga0496126_0153633_1011_1598 195
526 3300048929 Ga0496126_0413621 Ga0496126_0413621_455_1054 195
527 3300048929 Ga0496126_0526515 Ga0496126_0526515_108_713 195
528 3300048929 Ga0496126_0685454 Ga0496126_0685454_26_643 195
529 3300049581 Ga0501047_0029826 Ga0501047_0029826_297_899 195
530 3300049742 Ga0501080_0220906 Ga0501080_0220906_583_1188 195
531 3300050491 nmdc:mga00v17_166006_c1 nmdc:mga00v17_166006_c1_263_895 195
532 3300050492 nmdc:mga0yw44_221211_c1 nmdc:mga0yw44_221211_c1_16_648 195
533 3300053093 Ga0500651_0234917 Ga0500651_0234917_282_890 195
534 3300053094 Ga0500566_0001441 Ga0500566_0001441_10300_10887 195
535 3300053177 Ga0500636_0021961 Ga0500636_0021961_1808_2413 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

23

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.8991 7 182
1sgm-assembly1.cif.gz_B crystal structure of hypothetical protein yxaf 0.8762 7 186
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8728 8 90
1sgm-assembly1.cif.gz_B crystal structure of hypothetical protein yxaf 0.8545 7 186
3jsj-assembly2.cif.gz_C crystal structure of a putative tetr-transcriptional regulator (sav143) from streptomyces avermitilis ma-4680 at 2.10 a resolution 0.8535 8 190
ID Description Score Start End Superfamily
3mvpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 1.004 7 48 1.10.10.60
3mvpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9962 7 48 1.10.10.60
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9898 8 54 1.10.10.60
2raeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9875 8 48 1.10.10.60
3whcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9867 8 50 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1V5EXA4-F1-model_v4 TetR family transcriptional regulator 0.9971 1 191 GO:0000976
GO:0003700
AF-A0A848K1G1-F1-model_v4 AcrR family transcriptional regulator 0.9895 4 188 GO:0000976
GO:0003700
AF-A0A1I6X9F8-F1-model_v4 Transcriptional regulator, TetR family 0.9882 14 189 GO:0000976
GO:0003700
AF-A0A3S2EBS5-F1-model_v4 TetR family transcriptional regulator 0.9861 73 189
AF-A0A3S1ENA2-F1-model_v4 TetR family transcriptional regulator 0.9842 45 192

Feature Viewer

pLDDT pTM Quality
94.28 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map