F460559
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 328 | 1068 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300041452|Ga0451793_0363721|Ga0451793_0363721_104_1264 |
| Length | 386 |
| Sequence | MFWTSSGDIPIVRHVDGRGVLDSHAVICIVPAEICSGWQEKGKAMTYRVAVAGASGYAGGEVLRLLLGHPEITIGALTAHSSAGERLGLHQPHLLPLADRLIEPTTPETLAGHDAVFLALPHGQSHELAAQLGADVLVIDCGADHRLTDPVAWEQFYGGTHPGSWPYGMPELPNGRVALQGTKRVAVPGCYPTTASLAMAPALAADLVEPDIVVVAASGTSGAGKSPKVNLLGSEVMGSASAYGVGGVHRHTPEMVQNLTAAAGVPVTVSFTPVLVPMSRGILATVSAPAKPDVDVDDVRDVYQKAYADEPFVHLLPAGQWPTTAATLGANTVLLQVAVDRAAGRVVVIAALDNLTKGTAGAAVQCLNIALGLPETTGLSTVGVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 60 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 105 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 120 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 121 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 134 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 135 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 136 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 137 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 140 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 141 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 142 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 145 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 146 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 147 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 148 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 149 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 152 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 153 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 254 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 255 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 256 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 257 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 258 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 259 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 260 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 261 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 262 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 263 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 264 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 265 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 266 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 267 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 268 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 269 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 270 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 271 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 272 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 273 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 274 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 275 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 276 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 277 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 278 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 279 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 280 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 281 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 282 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 283 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 284 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 285 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 286 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 287 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 288 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 289 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 290 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 291 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 292 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 293 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 294 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 295 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 296 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 297 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 298 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 299 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 300 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 301 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 302 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 303 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 304 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 305 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 306 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 307 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 308 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 309 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 310 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 311 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 312 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 313 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 314 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 315 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 316 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 317 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 318 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 319 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 320 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 321 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 322 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 323 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 324 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 325 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 326 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 327 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 328 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.77 |
| Metatranscriptomes | 0 |
| Isolates | 14.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.25 |
| Nodule | 0.75 |
| Rhizoplane | 9.93 |
| Rhizosphere | 77.9 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451793_0363721 | 3300041452 | Bacteria | 16343 |
| 2 | LJQas_1000961 | 3300000549 | Bacteria | 4434 |
| 3 | JGI25151J46595_10043310 | 3300003187 | Bacteria | 1612 |
| 4 | JGI25406J46586_10008402 | 3300003203 | Bacteria | 4679 |
| 5 | JGI25406J46586_10014525 | 3300003203 | Bacteria | 3345 |
| 6 | rootL2_10082130 | 3300003322 | Bacteria | 3376 |
| 7 | Ga0065714_10080987 | 3300005288 | Bacteria | 2404 |
| 8 | Ga0070690_100179341 | 3300005330 | Bacteria | 1463 |
| 9 | Ga0068869_100060951 | 3300005334 | Bacteria | 2766 |
| 10 | Ga0070682_100112461 | 3300005337 | Bacteria | 1817 |
| 11 | Ga0070668_100011782 | 3300005347 | Bacteria | 6512 |
| 12 | Ga0070668_100057614 | 3300005347 | Bacteria | 3003 |
| 13 | Ga0070668_100172839 | 3300005347 | Bacteria | 1760 |
| 14 | Ga0070674_100068793 | 3300005356 | Bacteria | 2496 |
| 15 | Ga0070667_100089853 | 3300005367 | Bacteria | 2639 |
| 16 | Ga0070714_100068185 | 3300005435 | Bacteria | 3069 |
| 17 | Ga0070714_100080447 | 3300005435 | Bacteria | 2836 |
| 18 | Ga0070714_100184422 | 3300005435 | Bacteria | 1901 |
| 19 | Ga0070705_100005182 | 3300005440 | Bacteria | 6332 |
| 20 | Ga0070663_100053562 | 3300005455 | Bacteria | 2881 |
| 21 | Ga0070663_100142448 | 3300005455 | Bacteria | 1831 |
| 22 | Ga0070678_100085102 | 3300005456 | Bacteria | 2409 |
| 23 | Ga0070685_10169932 | 3300005466 | Bacteria | 1396 |
| 24 | Ga0070685_10234234 | 3300005466 | Bacteria | 1209 |
| 25 | Ga0070679_100064586 | 3300005530 | Bacteria | 3648 |
| 26 | Ga0070684_100327406 | 3300005535 | Bacteria | 1408 |
| 27 | Ga0070672_100161027 | 3300005543 | Bacteria | 1862 |
| 28 | Ga0070693_100014380 | 3300005547 | Bacteria | 4055 |
| 29 | Ga0068855_100070326 | 3300005563 | Bacteria | 4072 |
| 30 | Ga0070702_100002818 | 3300005615 | Bacteria | 7622 |
| 31 | Ga0068852_100044706 | 3300005616 | Bacteria | 3764 |
| 32 | Ga0068852_100142357 | 3300005616 | Bacteria | 2221 |
| 33 | Ga0068864_100214815 | 3300005618 | Bacteria | 1772 |
| 34 | Ga0068866_10068924 | 3300005718 | Bacteria | 1862 |
| 35 | Ga0068866_10182740 | 3300005718 | Bacteria | 1240 |
| 36 | Ga0068870_10192716 | 3300005840 | Bacteria | 1231 |
| 37 | Ga0068860_100008451 | 3300005843 | Bacteria | 10253 |
| 38 | Ga0081455_10000943 | 3300005937 | Bacteria | 37170 |
| 39 | Ga0081540_1017386 | 3300005983 | Bacteria | 4454 |
| 40 | Ga0081539_10002043 | 3300005985 | Bacteria | 30343 |
| 41 | Ga0081539_10003164 | 3300005985 | Bacteria | 20878 |
| 42 | Ga0075365_10056016 | 3300006038 | Bacteria | 2620 |
| 43 | Ga0075370_10024829 | 3300006353 | Bacteria | 3314 |
| 44 | Ga0075428_100006492 | 3300006844 | Bacteria | 13000 |
| 45 | Ga0075430_100012516 | 3300006846 | Bacteria | 7221 |
| 46 | Ga0075431_100121330 | 3300006847 | Bacteria | 2697 |
| 47 | Ga0068865_100123521 | 3300006881 | Bacteria | 1929 |
| 48 | Ga0105251_10017292 | 3300009011 | Bacteria | 3869 |
| 49 | Ga0105244_10003957 | 3300009036 | Bacteria | 10388 |
| 50 | Ga0105245_10086107 | 3300009098 | Bacteria | 2881 |
| 51 | Ga0105245_10226409 | 3300009098 | Bacteria | 1807 |
| 52 | Ga0105245_10236676 | 3300009098 | Bacteria | 1768 |
| 53 | Ga0105245_10299965 | 3300009098 | Bacteria | 1576 |
| 54 | Ga0105243_10122329 | 3300009148 | Bacteria | 2196 |
| 55 | Ga0105243_10391386 | 3300009148 | Bacteria | 1288 |
| 56 | Ga0105242_10021655 | 3300009176 | Bacteria | 5049 |
| 57 | Ga0105242_10192202 | 3300009176 | Bacteria | 1808 |
| 58 | Ga0105248_10264530 | 3300009177 | Bacteria | 1936 |
| 59 | Ga0105238_10095134 | 3300009551 | Bacteria | 2966 |
| 60 | Ga0105238_10210592 | 3300009551 | Bacteria | 1920 |
| 61 | Ga0105249_10459046 | 3300009553 | Bacteria | 1314 |
| 62 | Ga0105239_10281665 | 3300010375 | Bacteria | 1872 |
| 63 | Ga0105246_10036154 | 3300011119 | Bacteria | 3307 |
| 64 | Ga0157373_10089850 | 3300013100 | Bacteria | 2163 |
| 65 | Ga0157369_10016615 | 3300013105 | Bacteria | 8273 |
| 66 | Ga0157369_10036994 | 3300013105 | Bacteria | 5347 |
| 67 | Ga0157369_10293198 | 3300013105 | Bacteria | 1693 |
| 68 | Ga0157372_10252177 | 3300013307 | Bacteria | 2049 |
| 69 | Ga0157372_10295448 | 3300013307 | Bacteria | 1884 |
| 70 | Ga0157372_10337989 | 3300013307 | Bacteria | 1754 |
| 71 | Ga0157375_10198025 | 3300013308 | Bacteria | 2164 |
| 72 | Ga0163163_10311474 | 3300014325 | Bacteria | 1627 |
| 73 | Ga0163163_10609751 | 3300014325 | Bacteria | 1155 |
| 74 | Ga0182008_10120024 | 3300014497 | Bacteria | 1306 |
| 75 | Ga0157379_10138891 | 3300014968 | Bacteria | 2190 |
| 76 | Ga0157376_10055886 | 3300014969 | Bacteria | 3295 |
| 77 | Ga0163161_10071298 | 3300017792 | Bacteria | 2542 |
| 78 | Ga0163161_10084380 | 3300017792 | Bacteria | 2342 |
| 79 | Ga0213874_10034046 | 3300021377 | Bacteria | 1489 |
| 80 | Ga0213876_10076070 | 3300021384 | Bacteria | 1773 |
| 81 | Ga0213875_10004261 | 3300021388 | Bacteria | 7881 |
| 82 | Ga0209148_1004226 | 3300025254 | Bacteria | 3596 |
| 83 | Ga0209129_1000079 | 3300025258 | Bacteria | 187308 |
| 84 | Ga0209025_1001940 | 3300025294 | Bacteria | 23871 |
| 85 | Ga0209051_1029172 | 3300025303 | Bacteria | 2164 |
| 86 | Ga0207655_1009982 | 3300025728 | Bacteria | 5822 |
| 87 | Ga0207655_1038486 | 3300025728 | Bacteria | 2090 |
| 88 | Ga0207713_1015442 | 3300025735 | Bacteria | 3919 |
| 89 | Ga0207688_10002706 | 3300025901 | Bacteria | 9604 |
| 90 | Ga0207688_10052744 | 3300025901 | Bacteria | 2279 |
| 91 | Ga0207705_10210999 | 3300025909 | Bacteria | 1473 |
| 92 | Ga0207654_10071385 | 3300025911 | Bacteria | 2064 |
| 93 | Ga0207707_10133607 | 3300025912 | Bacteria | 2170 |
| 94 | Ga0207657_10025823 | 3300025919 | Bacteria | 5409 |
| 95 | Ga0207652_10046769 | 3300025921 | Bacteria | 3694 |
| 96 | Ga0207687_10301986 | 3300025927 | Bacteria | 1290 |
| 97 | Ga0207664_10020667 | 3300025929 | Bacteria | 4885 |
| 98 | Ga0207664_10133715 | 3300025929 | Bacteria | 2090 |
| 99 | Ga0207664_10259302 | 3300025929 | Bacteria | 1520 |
| 100 | Ga0207690_10082894 | 3300025932 | Bacteria | 2243 |
| 101 | Ga0207706_10030042 | 3300025933 | Bacteria | 4850 |
| 102 | Ga0207709_10359338 | 3300025935 | Bacteria | 1102 |
| 103 | Ga0207670_10026648 | 3300025936 | Bacteria | 3645 |
| 104 | Ga0207704_10085703 | 3300025938 | Bacteria | 2052 |
| 105 | Ga0207691_10346339 | 3300025940 | Bacteria | 1271 |
| 106 | Ga0207711_10303274 | 3300025941 | Bacteria | 1473 |
| 107 | Ga0207689_10209050 | 3300025942 | Bacteria | 1612 |
| 108 | Ga0207651_10145012 | 3300025960 | Bacteria | 1840 |
| 109 | Ga0207668_10049588 | 3300025972 | Bacteria | 2887 |
| 110 | Ga0207640_10095488 | 3300025981 | Bacteria | 2070 |
| 111 | Ga0207640_10292305 | 3300025981 | Bacteria | 1285 |
| 112 | Ga0207658_10027588 | 3300025986 | Bacteria | 3991 |
| 113 | Ga0207639_10136613 | 3300026041 | Bacteria | 2037 |
| 114 | Ga0207678_10004886 | 3300026067 | Bacteria | 12042 |
| 115 | Ga0207708_10163533 | 3300026075 | Bacteria | 1759 |
| 116 | Ga0207641_10064810 | 3300026088 | Bacteria | 3124 |
| 117 | Ga0207648_10018968 | 3300026089 | Bacteria | 6211 |
| 118 | Ga0207676_10127953 | 3300026095 | Bacteria | 2154 |
| 119 | Ga0207675_100007775 | 3300026118 | Bacteria | 10113 |
| 120 | Ga0207683_10076097 | 3300026121 | Bacteria | 2972 |
| 121 | Ga0207683_10085389 | 3300026121 | Bacteria | 2806 |
| 122 | Ga0207683_10102233 | 3300026121 | Bacteria | 2559 |
| 123 | Ga0207683_10136041 | 3300026121 | Bacteria | 2212 |
| 124 | Ga0207683_10149331 | 3300026121 | Bacteria | 2108 |
| 125 | Ga0207698_10013409 | 3300026142 | Bacteria | 5407 |
| 126 | Ga0207698_10101364 | 3300026142 | Bacteria | 2387 |
| 127 | Ga0207698_10133906 | 3300026142 | Bacteria | 2123 |
| 128 | Ga0207698_10258672 | 3300026142 | Bacteria | 1598 |
| 129 | Ga0207428_10044099 | 3300027907 | Bacteria | 3599 |
| 130 | Ga0268266_10064805 | 3300028379 | Bacteria | 3157 |
| 131 | Ga0268265_10141030 | 3300028380 | Bacteria | 2018 |
| 132 | Ga0268264_10006538 | 3300028381 | Bacteria | 9816 |
| 133 | Ga0265334_10000839 | 3300028573 | Bacteria | 15353 |
| 134 | Ga0307511_10000178 | 3300030521 | Bacteria | 62672 |
| 135 | Ga0265340_10002163 | 3300031247 | Bacteria | 11270 |
| 136 | Ga0307513_10000483 | 3300031456 | Bacteria | 57234 |
| 137 | Ga0307408_100004120 | 3300031548 | Bacteria | 9908 |
| 138 | Ga0307408_100009061 | 3300031548 | Bacteria | 6570 |
| 139 | Ga0307408_100103084 | 3300031548 | Bacteria | 2177 |
| 140 | Ga0307408_100218572 | 3300031548 | Bacteria | 1553 |
| 141 | Ga0307408_100317258 | 3300031548 | Bacteria | 1311 |
| 142 | Ga0316575_10005231 | 3300031665 | Bacteria | 4617 |
| 143 | Ga0316579_10000068 | 3300031691 | Bacteria | 25943 |
| 144 | Ga0316579_10000911 | 3300031691 | Bacteria | 10252 |
| 145 | Ga0307405_10081338 | 3300031731 | Bacteria | 2117 |
| 146 | Ga0307405_10318759 | 3300031731 | Bacteria | 1186 |
| 147 | Ga0316577_10031879 | 3300031733 | Bacteria | 2944 |
| 148 | Ga0307413_10002160 | 3300031824 | Bacteria | 7904 |
| 149 | Ga0307413_10012392 | 3300031824 | Bacteria | 4243 |
| 150 | Ga0307413_10014808 | 3300031824 | Bacteria | 3976 |
| 151 | Ga0307413_10056178 | 3300031824 | Bacteria | 2400 |
| 152 | Ga0307413_10072938 | 3300031824 | Bacteria | 2168 |
| 153 | Ga0307413_10120305 | 3300031824 | Bacteria | 1777 |
| 154 | Ga0307413_10198050 | 3300031824 | Bacteria | 1448 |
| 155 | Ga0307518_10001157 | 3300031838 | Bacteria | 19806 |
| 156 | Ga0307410_10004329 | 3300031852 | Bacteria | 7321 |
| 157 | Ga0307410_10010835 | 3300031852 | Bacteria | 5188 |
| 158 | Ga0307410_10021295 | 3300031852 | Bacteria | 3984 |
| 159 | Ga0307410_10116522 | 3300031852 | Bacteria | 1941 |
| 160 | Ga0307410_10119439 | 3300031852 | Bacteria | 1920 |
| 161 | Ga0307410_10133432 | 3300031852 | Bacteria | 1827 |
| 162 | Ga0307410_10137557 | 3300031852 | Bacteria | 1802 |
| 163 | Ga0307410_10162813 | 3300031852 | Bacteria | 1673 |
| 164 | Ga0307410_10320844 | 3300031852 | Bacteria | 1229 |
| 165 | Ga0307406_10007859 | 3300031901 | Bacteria | 5935 |
| 166 | Ga0307406_10059366 | 3300031901 | Bacteria | 2462 |
| 167 | Ga0307406_10089983 | 3300031901 | Bacteria | 2064 |
| 168 | Ga0307407_10022446 | 3300031903 | Bacteria | 3275 |
| 169 | Ga0307407_10027376 | 3300031903 | Bacteria | 3033 |
| 170 | Ga0307407_10279617 | 3300031903 | Bacteria | 1155 |
| 171 | Ga0307412_10008579 | 3300031911 | Bacteria | 5841 |
| 172 | Ga0307412_10019428 | 3300031911 | Bacteria | 4115 |
| 173 | Ga0307412_10028666 | 3300031911 | Bacteria | 3486 |
| 174 | Ga0307412_10033621 | 3300031911 | Bacteria | 3261 |
| 175 | Ga0307412_10052894 | 3300031911 | Bacteria | 2690 |
| 176 | Ga0307412_10094413 | 3300031911 | Bacteria | 2100 |
| 177 | Ga0307412_10117631 | 3300031911 | Bacteria | 1908 |
| 178 | Ga0307412_10152405 | 3300031911 | Bacteria | 1707 |
| 179 | Ga0307409_100001452 | 3300031995 | Bacteria | 11648 |
| 180 | Ga0307409_100004567 | 3300031995 | Bacteria | 7804 |
| 181 | Ga0307409_100023925 | 3300031995 | Bacteria | 4245 |
| 182 | Ga0307409_100046356 | 3300031995 | Bacteria | 3290 |
| 183 | Ga0307409_100054798 | 3300031995 | Bacteria | 3074 |
| 184 | Ga0307409_100087962 | 3300031995 | Bacteria | 2534 |
| 185 | Ga0307409_100159717 | 3300031995 | Bacteria | 1969 |
| 186 | Ga0307409_100306005 | 3300031995 | Bacteria | 1481 |
| 187 | Ga0307409_100315416 | 3300031995 | Bacteria | 1461 |
| 188 | Ga0307409_100348113 | 3300031995 | Bacteria | 1397 |
| 189 | Ga0307409_100456889 | 3300031995 | Bacteria | 1234 |
| 190 | Ga0307409_100490476 | 3300031995 | Bacteria | 1194 |
| 191 | Ga0307416_100010637 | 3300032002 | Bacteria | 6091 |
| 192 | Ga0307416_100013612 | 3300032002 | Bacteria | 5538 |
| 193 | Ga0307416_100030566 | 3300032002 | Bacteria | 4043 |
| 194 | Ga0307416_100036540 | 3300032002 | Bacteria | 3768 |
| 195 | Ga0307416_100039112 | 3300032002 | Bacteria | 3668 |
| 196 | Ga0307416_100055478 | 3300032002 | Bacteria | 3191 |
| 197 | Ga0307416_100058874 | 3300032002 | Bacteria | 3118 |
| 198 | Ga0307416_100444458 | 3300032002 | Bacteria | 1347 |
| 199 | Ga0307416_100512021 | 3300032002 | Bacteria | 1267 |
| 200 | Ga0307414_10007772 | 3300032004 | Bacteria | 6044 |
| 201 | Ga0307414_10189648 | 3300032004 | Bacteria | 1662 |
| 202 | Ga0307411_10001113 | 3300032005 | Bacteria | 10472 |
| 203 | Ga0307411_10009349 | 3300032005 | Bacteria | 5148 |
| 204 | Ga0307411_10243465 | 3300032005 | Bacteria | 1409 |
| 205 | Ga0307415_100004735 | 3300032126 | Bacteria | 7119 |
| 206 | Ga0307415_100005607 | 3300032126 | Bacteria | 6683 |
| 207 | Ga0307415_100040979 | 3300032126 | Bacteria | 3072 |
| 208 | Ga0307415_100094349 | 3300032126 | Bacteria | 2175 |
| 209 | Ga0307415_100147616 | 3300032126 | Bacteria | 1805 |
| 210 | Ga0307415_100238818 | 3300032126 | Bacteria | 1468 |
| 211 | Ga0316583_10010282 | 3300032133 | Bacteria | 3373 |
| 212 | Ga0307507_10115927 | 3300033179 | Bacteria | 2165 |
| 213 | Ga0316574_0000761 | 3300035398 | Bacteria | 13886 |
| 214 | Ga0373931_0144883 | 3300035691 | Bacteria | 1380 |
| 215 | Ga0316582_0010627 | 3300036647 | Bacteria | 5050 |
| 216 | Ga0316584_0000632 | 3300036712 | Bacteria | 19078 |
| 217 | Ga0395899_0004671 | 3300037312 | Bacteria | 10692 |
| 218 | Ga0395899_0041144 | 3300037312 | Bacteria | 3453 |
| 219 | Ga0395899_0060271 | 3300037312 | Bacteria | 2796 |
| 220 | Ga0395900_0013355 | 3300037418 | Bacteria | 8393 |
| 221 | Ga0395898_0009849 | 3300037466 | Bacteria | 10016 |
| 222 | Ga0395898_0171337 | 3300037466 | Bacteria | 2075 |
| 223 | Ga0395898_0347520 | 3300037466 | Bacteria | 1414 |
| 224 | Ga0395905_0062495 | 3300037471 | Bacteria | 3484 |
| 225 | Ga0395905_0128513 | 3300037471 | Bacteria | 2383 |
| 226 | Ga0436364_0574476 | 3300037853 | Bacteria | 12936 |
| 227 | Ga0436364_0661415 | 3300037853 | Bacteria | 3328 |
| 228 | Ga0395901_0005856 | 3300038443 | Bacteria | 12433 |
| 229 | Ga0395901_0008568 | 3300038443 | Bacteria | 10335 |
| 230 | Ga0395901_0017936 | 3300038443 | Bacteria | 7225 |
| 231 | Ga0395901_0038595 | 3300038443 | Bacteria | 4940 |
| 232 | Ga0395901_0043071 | 3300038443 | Bacteria | 4682 |
| 233 | Ga0395901_0059690 | 3300038443 | Bacteria | 3968 |
| 234 | Ga0395901_0064607 | 3300038443 | Bacteria | 3810 |
| 235 | Ga0395901_0310286 | 3300038443 | Bacteria | 1634 |
| 236 | Ga0395901_0542409 | 3300038443 | Bacteria | 1179 |
| 237 | Ga0395901_0621801 | 3300038443 | Bacteria | 1087 |
| 238 | Ga0436365_1427323 | 3300039437 | Bacteria | 3080 |
| 239 | Ga0436363_1541032 | 3300039450 | Bacteria | 2785 |
| 240 | Ga0439438_013626 | 3300041405 | Bacteria | 2447 |
| 241 | Ga0439438_029505 | 3300041405 | Bacteria | 1468 |
| 242 | Ga0439439_0032762 | 3300041406 | Bacteria | 1328 |
| 243 | Ga0439466_0002535 | 3300041411 | Bacteria | 7153 |
| 244 | Ga0439465_0001957 | 3300041413 | Bacteria | 6751 |
| 245 | Ga0439465_0047786 | 3300041413 | Bacteria | 1396 |
| 246 | Ga0451791_1212074 | 3300041451 | Bacteria | 4789 |
| 247 | Ga0451797_0188075 | 3300041453 | Bacteria | 4515 |
| 248 | Ga0451853_1003144 | 3300041512 | Bacteria | 2527 |
| 249 | Ga0439433_0000016 | 3300041999 | Bacteria | 22353 |
| 250 | Ga0439433_0008935 | 3300041999 | Bacteria | 2181 |
| 251 | Ga0439433_0021282 | 3300041999 | Bacteria | 1450 |
| 252 | Ga0439433_0030950 | 3300041999 | Bacteria | 1224 |
| 253 | Ga0439442_000124 | 3300042002 | Bacteria | 19456 |
| 254 | Ga0439442_000483 | 3300042002 | Bacteria | 9062 |
| 255 | Ga0439442_002655 | 3300042002 | Bacteria | 3513 |
| 256 | Ga0439442_003189 | 3300042002 | Bacteria | 3244 |
| 257 | Ga0439442_028579 | 3300042002 | Bacteria | 1162 |
| 258 | Ga0439432_009769 | 3300042006 | Bacteria | 3338 |
| 259 | Ga0439432_051947 | 3300042006 | Bacteria | 1277 |
| 260 | Ga0439449_0000123 | 3300042007 | Bacteria | 25838 |
| 261 | Ga0439449_0003118 | 3300042007 | Bacteria | 6458 |
| 262 | Ga0439452_005222 | 3300042010 | Bacteria | 4216 |
| 263 | Ga0439457_007888 | 3300042014 | Bacteria | 2532 |
| 264 | Ga0439457_034072 | 3300042014 | Bacteria | 1131 |
| 265 | Ga0450920_000050 | 3300042122 | Bacteria | 14912 |
| 266 | Ga0450920_001016 | 3300042122 | Bacteria | 4596 |
| 267 | Ga0450907_006929 | 3300042146 | Bacteria | 1890 |
| 268 | Ga0450907_010839 | 3300042146 | Bacteria | 1514 |
| 269 | Ga0439434_0000220 | 3300042435 | Bacteria | 15927 |
| 270 | Ga0439434_0007491 | 3300042435 | Bacteria | 3197 |
| 271 | Ga0450918_000839 | 3300042531 | Bacteria | 6482 |
| 272 | Ga0466969_0006546 | 3300044656 | Bacteria | 6197 |
| 273 | Ga0466969_0015025 | 3300044656 | Bacteria | 4061 |
| 274 | Ga0466969_0022869 | 3300044656 | Bacteria | 3223 |
| 275 | Ga0466969_0098220 | 3300044656 | Bacteria | 1381 |
| 276 | Ga0466972_0001567 | 3300044658 | Bacteria | 11146 |
| 277 | Ga0466972_0092046 | 3300044658 | Bacteria | 1438 |
| 278 | Ga0466965_0108682 | 3300044683 | Bacteria | 1424 |
| 279 | Ga0466966_0005827 | 3300044684 | Bacteria | 8121 |
| 280 | Ga0466966_0018262 | 3300044684 | Bacteria | 4627 |
| 281 | Ga0466966_0083747 | 3300044684 | Bacteria | 1984 |
| 282 | Ga0466961_0027971 | 3300044693 | Bacteria | 3626 |
| 283 | Ga0466961_0058820 | 3300044693 | Bacteria | 2444 |
| 284 | Ga0466961_0103608 | 3300044693 | Bacteria | 1792 |
| 285 | Ga0466961_0123057 | 3300044693 | Bacteria | 1628 |
| 286 | Ga0466963_0059687 | 3300044694 | Bacteria | 2546 |
| 287 | Ga0466963_0200046 | 3300044694 | Bacteria | 1397 |
| 288 | Ga0466971_0016447 | 3300044719 | Bacteria | 3266 |
| 289 | Ga0466971_0053017 | 3300044719 | Bacteria | 1827 |
| 290 | Ga0466971_0146163 | 3300044719 | Bacteria | 1102 |
| 291 | Ga0466970_0007657 | 3300044765 | Bacteria | 5415 |
| 292 | Ga0466970_0055942 | 3300044765 | Bacteria | 2108 |
| 293 | Ga0466957_0051978 | 3300044842 | Bacteria | 2494 |
| 294 | Ga0466957_0097356 | 3300044842 | Bacteria | 1850 |
| 295 | Ga0466957_0228023 | 3300044842 | Bacteria | 1232 |
| 296 | Ga0466957_0279935 | 3300044842 | Bacteria | 1116 |
| 297 | Ga0466960_0000756 | 3300044901 | Bacteria | 11383 |
| 298 | Ga0466960_0012365 | 3300044901 | Bacteria | 3600 |
| 299 | Ga0466960_0013932 | 3300044901 | Bacteria | 3427 |
| 300 | Ga0466960_0038220 | 3300044901 | Bacteria | 2255 |
| 301 | Ga0466959_0000629 | 3300045049 | Bacteria | 20458 |
| 302 | Ga0466959_0009621 | 3300045049 | Bacteria | 6876 |
| 303 | Ga0466959_0103208 | 3300045049 | Bacteria | 2040 |
| 304 | Ga0466959_0118924 | 3300045049 | Bacteria | 1880 |
| 305 | Ga0466959_0207757 | 3300045049 | Bacteria | 1361 |
| 306 | Ga0466958_0098800 | 3300045836 | Bacteria | 1813 |
| 307 | Ga0466967_0086234 | 3300045976 | Bacteria | 2844 |
| 308 | Ga0466967_0333319 | 3300045976 | Bacteria | 1466 |
| 309 | Ga0495592_0023860 | 3300046454 | Bacteria | 4652 |
| 310 | Ga0495603_0024041 | 3300046455 | Bacteria | 3686 |
| 311 | Ga0495629_0046524 | 3300046459 | Bacteria | 3043 |
| 312 | Ga0495629_0082825 | 3300046459 | Bacteria | 2239 |
| 313 | Ga0495651_0002482 | 3300046462 | Bacteria | 14259 |
| 314 | Ga0495653_0047560 | 3300046463 | Bacteria | 3317 |
| 315 | Ga0495580_0003950 | 3300046472 | Bacteria | 12508 |
| 316 | Ga0495582_0083770 | 3300046473 | Bacteria | 1772 |
| 317 | Ga0495582_0141430 | 3300046473 | Bacteria | 1364 |
| 318 | Ga0495639_0005295 | 3300046475 | Bacteria | 5552 |
| 319 | Ga0495662_0082159 | 3300046476 | Bacteria | 1567 |
| 320 | Ga0495664_0187562 | 3300046477 | Bacteria | 1254 |
| 321 | Ga0495596_0043833 | 3300046500 | Bacteria | 1763 |
| 322 | Ga0495608_0002796 | 3300046511 | Bacteria | 12519 |
| 323 | Ga0495631_0038243 | 3300046518 | Bacteria | 2134 |
| 324 | Ga0495666_0002641 | 3300046526 | Bacteria | 8935 |
| 325 | Ga0495652_0124385 | 3300046529 | Bacteria | 2051 |
| 326 | Ga0495665_0001040 | 3300046531 | Bacteria | 14712 |
| 327 | Ga0495640_0110091 | 3300046533 | Bacteria | 1800 |
| 328 | Ga0495586_0002370 | 3300046535 | Bacteria | 10227 |
| 329 | Ga0495586_0033512 | 3300046535 | Bacteria | 2756 |
| 330 | Ga0495587_0031907 | 3300046536 | Bacteria | 3187 |
| 331 | Ga0495645_0071585 | 3300046543 | Bacteria | 2500 |
| 332 | Ga0495667_0021585 | 3300046559 | Bacteria | 4344 |
| 333 | Ga0495656_0015435 | 3300046615 | Bacteria | 2883 |
| 334 | Ga0495635_0077798 | 3300046663 | Bacteria | 2272 |
| 335 | Ga0495635_0138947 | 3300046663 | Bacteria | 1655 |
| 336 | Ga0495588_0165833 | 3300046674 | Bacteria | 1168 |
| 337 | Ga0495657_0004136 | 3300046675 | Bacteria | 11619 |
| 338 | Ga0495657_0044557 | 3300046675 | Bacteria | 3017 |
| 339 | Ga0495599_0139708 | 3300046678 | Bacteria | 1503 |
| 340 | Ga0495623_0006053 | 3300046679 | Bacteria | 7864 |
| 341 | Ga0495646_0049066 | 3300046680 | Bacteria | 2562 |
| 342 | Ga0495613_0006145 | 3300046689 | Bacteria | 8987 |
| 343 | Ga0495613_0043003 | 3300046689 | Bacteria | 3342 |
| 344 | Ga0495589_0068218 | 3300046794 | Bacteria | 1740 |
| 345 | Ga0495600_0029405 | 3300046809 | Bacteria | 3557 |
| 346 | Ga0495581_0023809 | 3300047315 | Bacteria | 3548 |
| 347 | Ga0495604_0001984 | 3300047317 | Bacteria | 16517 |
| 348 | Ga0495636_0017549 | 3300047318 | Bacteria | 2866 |
| 349 | Ga0495674_0062810 | 3300047319 | Bacteria | 3233 |
| 350 | Ga0495675_0003933 | 3300047444 | Bacteria | 9000 |
| 351 | Ga0495675_0025626 | 3300047444 | Bacteria | 3758 |
| 352 | Ga0495684_0007710 | 3300047471 | Bacteria | 8331 |
| 353 | Ga0495593_0057489 | 3300047673 | Bacteria | 2042 |
| 354 | Ga0495593_0058436 | 3300047673 | Bacteria | 2023 |
| 355 | Ga0495602_0170865 | 3300048088 | Bacteria | 1687 |
| 356 | Ga0496100_0347967 | 3300048903 | Bacteria | 1119 |
| 357 | Ga0496101_0011629 | 3300048904 | Bacteria | 5846 |
| 358 | Ga0496102_0001262 | 3300048905 | Bacteria | 22825 |
| 359 | Ga0496102_0018154 | 3300048905 | Bacteria | 6174 |
| 360 | Ga0496102_0041908 | 3300048905 | Bacteria | 4147 |
| 361 | Ga0496102_0108007 | 3300048905 | Bacteria | 2592 |
| 362 | Ga0496102_0147732 | 3300048905 | Bacteria | 2207 |
| 363 | Ga0496102_0164764 | 3300048905 | Bacteria | 2086 |
| 364 | Ga0496102_0223087 | 3300048905 | Bacteria | 1777 |
| 365 | Ga0496102_0338437 | 3300048905 | Bacteria | 1417 |
| 366 | Ga0496103_0003834 | 3300048906 | Bacteria | 9148 |
| 367 | Ga0496103_0009925 | 3300048906 | Bacteria | 5631 |
| 368 | Ga0496103_0167609 | 3300048906 | Bacteria | 1410 |
| 369 | Ga0496104_0180390 | 3300048907 | Bacteria | 2022 |
| 370 | Ga0496105_0027464 | 3300048908 | Bacteria | 4651 |
| 371 | Ga0496105_0040013 | 3300048908 | Bacteria | 3865 |
| 372 | Ga0496105_0212848 | 3300048908 | Bacteria | 1575 |
| 373 | Ga0496106_0357295 | 3300048909 | Bacteria | 1173 |
| 374 | Ga0496108_0002365 | 3300048911 | Bacteria | 15107 |
| 375 | Ga0496108_0023395 | 3300048911 | Bacteria | 5084 |
| 376 | Ga0496108_0041946 | 3300048911 | Bacteria | 3820 |
| 377 | Ga0496108_0056279 | 3300048911 | Bacteria | 3304 |
| 378 | Ga0496108_0078585 | 3300048911 | Bacteria | 2793 |
| 379 | Ga0496108_0107070 | 3300048911 | Bacteria | 2387 |
| 380 | Ga0496108_0353777 | 3300048911 | Bacteria | 1282 |
| 381 | Ga0496109_0007600 | 3300048912 | Bacteria | 9190 |
| 382 | Ga0496109_0091679 | 3300048912 | Bacteria | 2810 |
| 383 | Ga0496109_0169991 | 3300048912 | Bacteria | 2044 |
| 384 | Ga0496109_0374687 | 3300048912 | Bacteria | 1344 |
| 385 | Ga0496109_0382811 | 3300048912 | Bacteria | 1329 |
| 386 | Ga0496110_0014191 | 3300048913 | Bacteria | 6609 |
| 387 | Ga0496110_0034049 | 3300048913 | Bacteria | 4409 |
| 388 | Ga0496110_0059203 | 3300048913 | Bacteria | 3375 |
| 389 | Ga0496110_0175374 | 3300048913 | Bacteria | 1946 |
| 390 | Ga0496111_0015138 | 3300048914 | Bacteria | 5287 |
| 391 | Ga0496111_0028661 | 3300048914 | Bacteria | 3947 |
| 392 | Ga0496111_0130685 | 3300048914 | Bacteria | 1858 |
| 393 | Ga0496112_0002045 | 3300048915 | Bacteria | 15985 |
| 394 | Ga0496112_0036117 | 3300048915 | Bacteria | 4819 |
| 395 | Ga0496112_0229330 | 3300048915 | Bacteria | 1812 |
| 396 | Ga0496113_0032171 | 3300048916 | Bacteria | 3811 |
| 397 | Ga0496113_0317043 | 3300048916 | Bacteria | 1249 |
| 398 | Ga0496114_0001123 | 3300048917 | Bacteria | 20224 |
| 399 | Ga0496114_0001926 | 3300048917 | Bacteria | 15798 |
| 400 | Ga0496114_0018859 | 3300048917 | Bacteria | 5586 |
| 401 | Ga0496114_0043299 | 3300048917 | Bacteria | 3733 |
| 402 | Ga0496114_0130171 | 3300048917 | Bacteria | 2173 |
| 403 | Ga0496114_0155987 | 3300048917 | Bacteria | 1982 |
| 404 | Ga0496114_0177605 | 3300048917 | Bacteria | 1858 |
| 405 | Ga0496115_0263481 | 3300048918 | Bacteria | 1417 |
| 406 | Ga0501031_0040543 | 3300049568 | Bacteria | 3040 |
| 407 | Ga0501032_0001718 | 3300049569 | Bacteria | 17319 |
| 408 | Ga0501032_0001836 | 3300049569 | Bacteria | 16790 |
| 409 | Ga0501032_0027847 | 3300049569 | Bacteria | 3884 |
| 410 | Ga0501032_0055765 | 3300049569 | Bacteria | 2658 |
| 411 | Ga0501033_0057771 | 3300049570 | Bacteria | 2866 |
| 412 | Ga0501034_0000015 | 3300049571 | Bacteria | 296163 |
| 413 | Ga0501036_0031416 | 3300049572 | Bacteria | 4488 |
| 414 | Ga0501036_0066359 | 3300049572 | Bacteria | 3053 |
| 415 | Ga0501037_0002004 | 3300049573 | Bacteria | 14749 |
| 416 | Ga0501037_0023193 | 3300049573 | Bacteria | 4589 |
| 417 | Ga0501037_0080941 | 3300049573 | Bacteria | 2355 |
| 418 | Ga0501037_0227242 | 3300049573 | Bacteria | 1311 |
| 419 | Ga0501038_0021928 | 3300049574 | Bacteria | 5728 |
| 420 | Ga0501039_0042291 | 3300049575 | Bacteria | 3520 |
| 421 | Ga0501041_0038989 | 3300049577 | Bacteria | 2882 |
| 422 | Ga0501042_0038377 | 3300049578 | Bacteria | 3402 |
| 423 | Ga0501042_0050137 | 3300049578 | Bacteria | 2977 |
| 424 | Ga0501043_0009496 | 3300049579 | Bacteria | 7628 |
| 425 | Ga0501043_0009509 | 3300049579 | Bacteria | 7621 |
| 426 | Ga0501043_0033398 | 3300049579 | Bacteria | 4048 |
| 427 | Ga0501047_0000268 | 3300049581 | Bacteria | 60315 |
| 428 | Ga0501047_0017765 | 3300049581 | Bacteria | 6816 |
| 429 | Ga0501048_0098209 | 3300049582 | Bacteria | 2066 |
| 430 | Ga0501070_0011458 | 3300049586 | Bacteria | 7491 |
| 431 | Ga0501071_0055806 | 3300049587 | Bacteria | 2852 |
| 432 | Ga0501072_0385030 | 3300049588 | Bacteria | 1113 |
| 433 | Ga0501074_0023083 | 3300049590 | Bacteria | 4524 |
| 434 | Ga0501076_0060741 | 3300049592 | Bacteria | 3007 |
| 435 | Ga0501077_0048182 | 3300049593 | Bacteria | 2707 |
| 436 | Ga0501080_0346850 | 3300049742 | Bacteria | 1341 |
| 437 | Ga0501035_0052290 | 3300049822 | Bacteria | 3655 |
| 438 | Ga0501035_0115135 | 3300049822 | Bacteria | 2354 |
| 439 | Ga0501044_0104540 | 3300049823 | Bacteria | 2846 |
| 440 | Ga0501044_0335371 | 3300049823 | Bacteria | 1434 |
| 441 | Ga0501045_0071558 | 3300049824 | Bacteria | 2552 |
| 442 | Ga0501045_0077705 | 3300049824 | Bacteria | 2446 |
| 443 | nmdc:mga0yw44_79175_c1 | 3300050492 | Bacteria | 2056 |
| 444 | nmdc:mga06z11_85768_c1 | 3300050494 | Bacteria | 1699 |
| 445 | nmdc:mga07m45_22297_c1 | 3300050496 | Bacteria | 3456 |
| 446 | nmdc:mga05p37_128689_c1 | 3300050507 | Bacteria | 3108 |
| 447 | nmdc:mga05p37_65173_c1 | 3300050507 | Bacteria | 4483 |
| 448 | nmdc:mga09592_181541_c1 | 3300050508 | Bacteria | 1821 |
| 449 | nmdc:mga06r32_268795_c1 | 3300050510 | Bacteria | 1693 |
| 450 | nmdc:mga06r32_270485_c1 | 3300050510 | Bacteria | 1687 |
| 451 | nmdc:mga06r32_40958_c1 | 3300050510 | Bacteria | 4400 |
| 452 | Ga0495601_0004774 | 3300053077 | Bacteria | 7860 |
| 453 | Ga0495619_0175984 | 3300053085 | Bacteria | 1480 |
| 454 | Ga0500559_0007254 | 3300053136 | Bacteria | 4924 |
| 455 | Ga0500585_062864 | 3300053144 | Bacteria | 1337 |
| 456 | Ga0501084_0255599 | 3300054114 | Bacteria | 1479 |
| 457 | Ga0501082_0071920 | 3300060353 | Bacteria | 2979 |
| 458 | Ga0466962_0064494 | 3300061719 | Bacteria | 1749 |
| 459 | 2537897781 | 2537561592 | Bacteria | 4348607 |
| 460 | 2559430553 | 2558860280 | Bacteria | 11429938 |
| 461 | 2585321089 | 2582581314 | Bacteria | 11452267 |
| 462 | 2586060168 | 2585427649 | Bacteria | 9053857 |
| 463 | 2623501113 | 2622736605 | Bacteria | 4992138 |
| 464 | 2645719793 | 2643221961 | Bacteria | 3919167 |
| 465 | 2676491332 | 2675903060 | Bacteria | 10051191 |
| 466 | 2691513493 | 2690315906 | Bacteria | 4517044 |
| 467 | 2739604272 | 2739367653 | Bacteria | 2780952 |
| 468 | 2768645732 | 2767802112 | Bacteria | 6465194 |
| 469 | 2774904267 | 2773857933 | Bacteria | 5818019 |
| 470 | 2775658861 | 2775506735 | Bacteria | 4556596 |
| 471 | 2785343821 | 2784746763 | Bacteria | 9783172 |
| 472 | 2791916396 | 2791354901 | Bacteria | 8322202 |
| 473 | 2795787378 | 2795385470 | Bacteria | 8317180 |
| 474 | 2795797758 | 2795385472 | Bacteria | 6627535 |
| 475 | 2808830745 | 2808606357 | Bacteria | 4466944 |
| 476 | 2808851934 | 2808606360 | Bacteria | 4404006 |
| 477 | 2808879754 | 2808606366 | Bacteria | 4415912 |
| 478 | 2808890678 | 2808606370 | Bacteria | 4942454 |
| 479 | 2808895958 | 2808606371 | Bacteria | 4251511 |
| 480 | 2809590845 | 2808606522 | Bacteria | 9488490 |
| 481 | 2810363506 | 2808606700 | Bacteria | 3482157 |
| 482 | 2812321700 | 2811994871 | Bacteria | 4497550 |
| 483 | 2812351207 | 2811994878 | Bacteria | 5992952 |
| 484 | 2816503587 | 2816332139 | Bacteria | 9138787 |
| 485 | 2817509472 | 2816332305 | Bacteria | 2697803 |
| 486 | 2819739153 | 2818991472 | Bacteria | 10089953 |
| 487 | 2842137800 | 2842134933 | Bacteria | 5847019 |
| 488 | 2844852301 | 2844849076 | Bacteria | 4091819 |
| 489 | 2857728853 | 2857727296 | Bacteria | 2745552 |
| 490 | 2857743798 | 2857740372 | Bacteria | 4782044 |
| 491 | 2862383789 | 2862382967 | Bacteria | 10317375 |
| 492 | 2867346907 | 2867346516 | Bacteria | 7608576 |
| 493 | 2884700651 | 2884693830 | Bacteria | 11273186 |
| 494 | 2891403611 | 2891395885 | Bacteria | 9251614 |
| 495 | 2895429228 | 2895427314 | Bacteria | 13147766 |
| 496 | 2895452630 | 2895442618 | Bacteria | 11027144 |
| 497 | 2899375428 | 2899370129 | Bacteria | 6781179 |
| 498 | 2902795781 | 2902792274 | Bacteria | 7270173 |
| 499 | 2904499697 | 2904497146 | Bacteria | 4731781 |
| 500 | 2904780354 | 2904776348 | Bacteria | 4658726 |
| 501 | 2905930275 | 2905926851 | Bacteria | 4423176 |
| 502 | 2910814854 | 2910809715 | Bacteria | 4982797 |
| 503 | 2915771865 | 2915768154 | Bacteria | 8424322 |
| 504 | 2919036150 | 2919034639 | Bacteria | 4763403 |
| 505 | 2919060865 | 2919059106 | Bacteria | 4991624 |
| 506 | 2919392430 | 2919391150 | Bacteria | 4884741 |
| 507 | 2919450770 | 2919446982 | Bacteria | 3994487 |
| 508 | 2919538632 | 2919538618 | Bacteria | 4677069 |
| 509 | 2920883729 | 2920879853 | Bacteria | 4216831 |
| 510 | 2932431097 | 2932426870 | Bacteria | 4547726 |
| 511 | 2933419207 | 2933418574 | Bacteria | 4476724 |
| 512 | 2939600061 | 2939598168 | Bacteria | 4687164 |
| 513 | 2939647874 | 2939647034 | Bacteria | 4681660 |
| 514 | 2939679064 | 2939674588 | Bacteria | 4844420 |
| 515 | 2945919570 | 2945916053 | Bacteria | 4555517 |
| 516 | 2945924519 | 2945920336 | Bacteria | 4501603 |
| 517 | 2945943745 | 2945941187 | Bacteria | 4682474 |
| 518 | 2945958066 | 2945956166 | Bacteria | 5110334 |
| 519 | 2946004064 | 2946003308 | Bacteria | 3857229 |
| 520 | 2946025291 | 2946024296 | Bacteria | 3508095 |
| 521 | 2946039714 | 2946037020 | Bacteria | 4900426 |
| 522 | 2946063292 | 2946059875 | Bacteria | 4386623 |
| 523 | 2954000938 | 2953998280 | Bacteria | 4812144 |
| 524 | 2966604310 | 2966598605 | Bacteria | 7676064 |
| 525 | 2974303214 | 2974302888 | Bacteria | 4369871 |
| 526 | 2990092540 | 2990088156 | Bacteria | 6657676 |
| 527 | 2995469279 | 2995463766 | Bacteria | 8577691 |
| 528 | 3001891666 | 3001889506 | Bacteria | 2975194 |
| 529 | 3003002245 | 3002998708 | Bacteria | 11715108 |
| 530 | 8003320675 | 8003314358 | Bacteria | 10575343 |
| 531 | 8008559963 | 8008558824 | Bacteria | 10610750 |
| 532 | 8053947884 | 8053945823 | Bacteria | 8962862 |
| 533 | 8054109997 | 8054107350 | Bacteria | 5022511 |
| 534 | 8054478331 | 8054472261 | Bacteria | 7464355 |
| 535 | Ga0451793_0363721 | |||
| 536 | LJQas_1000961 | |||
| 537 | JGI25151J46595_10043310 | |||
| 538 | JGI25406J46586_10008402 | |||
| 539 | JGI25406J46586_10014525 | |||
| 540 | rootL2_10082130 | |||
| 541 | Ga0065714_10080987 | |||
| 542 | Ga0070690_100179341 | |||
| 543 | Ga0068869_100060951 | |||
| 544 | Ga0070682_100112461 | |||
| 545 | Ga0070668_100011782 | |||
| 546 | Ga0070668_100057614 | |||
| 547 | Ga0070668_100172839 | |||
| 548 | Ga0070674_100068793 | |||
| 549 | Ga0070667_100089853 | |||
| 550 | Ga0070714_100068185 | |||
| 551 | Ga0070714_100080447 | |||
| 552 | Ga0070714_100184422 | |||
| 553 | Ga0070705_100005182 | |||
| 554 | Ga0070663_100053562 | |||
| 555 | Ga0070663_100142448 | |||
| 556 | Ga0070678_100085102 | |||
| 557 | Ga0070685_10169932 | |||
| 558 | Ga0070685_10234234 | |||
| 559 | Ga0070679_100064586 | |||
| 560 | Ga0070684_100327406 | |||
| 561 | Ga0070672_100161027 | |||
| 562 | Ga0070693_100014380 | |||
| 563 | Ga0068855_100070326 | |||
| 564 | Ga0070702_100002818 | |||
| 565 | Ga0068852_100044706 | |||
| 566 | Ga0068852_100142357 | |||
| 567 | Ga0068864_100214815 | |||
| 568 | Ga0068866_10068924 | |||
| 569 | Ga0068866_10182740 | |||
| 570 | Ga0068870_10192716 | |||
| 571 | Ga0068860_100008451 | |||
| 572 | Ga0081455_10000943 | |||
| 573 | Ga0081540_1017386 | |||
| 574 | Ga0081539_10002043 | |||
| 575 | Ga0081539_10003164 | |||
| 576 | Ga0075365_10056016 | |||
| 577 | Ga0075370_10024829 | |||
| 578 | Ga0075428_100006492 | |||
| 579 | Ga0075430_100012516 | |||
| 580 | Ga0075431_100121330 | |||
| 581 | Ga0068865_100123521 | |||
| 582 | Ga0105251_10017292 | |||
| 583 | Ga0105244_10003957 | |||
| 584 | Ga0105245_10086107 | |||
| 585 | Ga0105245_10226409 | |||
| 586 | Ga0105245_10236676 | |||
| 587 | Ga0105245_10299965 | |||
| 588 | Ga0105243_10122329 | |||
| 589 | Ga0105243_10391386 | |||
| 590 | Ga0105242_10021655 | |||
| 591 | Ga0105242_10192202 | |||
| 592 | Ga0105248_10264530 | |||
| 593 | Ga0105238_10095134 | |||
| 594 | Ga0105238_10210592 | |||
| 595 | Ga0105249_10459046 | |||
| 596 | Ga0105239_10281665 | |||
| 597 | Ga0105246_10036154 | |||
| 598 | Ga0157373_10089850 | |||
| 599 | Ga0157369_10016615 | |||
| 600 | Ga0157369_10036994 | |||
| 601 | Ga0157369_10293198 | |||
| 602 | Ga0157372_10252177 | |||
| 603 | Ga0157372_10295448 | |||
| 604 | Ga0157372_10337989 | |||
| 605 | Ga0157375_10198025 | |||
| 606 | Ga0163163_10311474 | |||
| 607 | Ga0163163_10609751 | |||
| 608 | Ga0182008_10120024 | |||
| 609 | Ga0157379_10138891 | |||
| 610 | Ga0157376_10055886 | |||
| 611 | Ga0163161_10071298 | |||
| 612 | Ga0163161_10084380 | |||
| 613 | Ga0213874_10034046 | |||
| 614 | Ga0213876_10076070 | |||
| 615 | Ga0213875_10004261 | |||
| 616 | Ga0209148_1004226 | |||
| 617 | Ga0209129_1000079 | |||
| 618 | Ga0209025_1001940 | |||
| 619 | Ga0209051_1029172 | |||
| 620 | Ga0207655_1009982 | |||
| 621 | Ga0207655_1038486 | |||
| 622 | Ga0207713_1015442 | |||
| 623 | Ga0207688_10002706 | |||
| 624 | Ga0207688_10052744 | |||
| 625 | Ga0207705_10210999 | |||
| 626 | Ga0207654_10071385 | |||
| 627 | Ga0207707_10133607 | |||
| 628 | Ga0207657_10025823 | |||
| 629 | Ga0207652_10046769 | |||
| 630 | Ga0207687_10301986 | |||
| 631 | Ga0207664_10020667 | |||
| 632 | Ga0207664_10133715 | |||
| 633 | Ga0207664_10259302 | |||
| 634 | Ga0207690_10082894 | |||
| 635 | Ga0207706_10030042 | |||
| 636 | Ga0207709_10359338 | |||
| 637 | Ga0207670_10026648 | |||
| 638 | Ga0207704_10085703 | |||
| 639 | Ga0207691_10346339 | |||
| 640 | Ga0207711_10303274 | |||
| 641 | Ga0207689_10209050 | |||
| 642 | Ga0207651_10145012 | |||
| 643 | Ga0207668_10049588 | |||
| 644 | Ga0207640_10095488 | |||
| 645 | Ga0207640_10292305 | |||
| 646 | Ga0207658_10027588 | |||
| 647 | Ga0207639_10136613 | |||
| 648 | Ga0207678_10004886 | |||
| 649 | Ga0207708_10163533 | |||
| 650 | Ga0207641_10064810 | |||
| 651 | Ga0207648_10018968 | |||
| 652 | Ga0207676_10127953 | |||
| 653 | Ga0207675_100007775 | |||
| 654 | Ga0207683_10076097 | |||
| 655 | Ga0207683_10085389 | |||
| 656 | Ga0207683_10102233 | |||
| 657 | Ga0207683_10136041 | |||
| 658 | Ga0207683_10149331 | |||
| 659 | Ga0207698_10013409 | |||
| 660 | Ga0207698_10101364 | |||
| 661 | Ga0207698_10133906 | |||
| 662 | Ga0207698_10258672 | |||
| 663 | Ga0207428_10044099 | |||
| 664 | Ga0268266_10064805 | |||
| 665 | Ga0268265_10141030 | |||
| 666 | Ga0268264_10006538 | |||
| 667 | Ga0265334_10000839 | |||
| 668 | Ga0307511_10000178 | |||
| 669 | Ga0265340_10002163 | |||
| 670 | Ga0307513_10000483 | |||
| 671 | Ga0307408_100004120 | |||
| 672 | Ga0307408_100009061 | |||
| 673 | Ga0307408_100103084 | |||
| 674 | Ga0307408_100218572 | |||
| 675 | Ga0307408_100317258 | |||
| 676 | Ga0316575_10005231 | |||
| 677 | Ga0316579_10000068 | |||
| 678 | Ga0316579_10000911 | |||
| 679 | Ga0307405_10081338 | |||
| 680 | Ga0307405_10318759 | |||
| 681 | Ga0316577_10031879 | |||
| 682 | Ga0307413_10002160 | |||
| 683 | Ga0307413_10012392 | |||
| 684 | Ga0307413_10014808 | |||
| 685 | Ga0307413_10056178 | |||
| 686 | Ga0307413_10072938 | |||
| 687 | Ga0307413_10120305 | |||
| 688 | Ga0307413_10198050 | |||
| 689 | Ga0307518_10001157 | |||
| 690 | Ga0307410_10004329 | |||
| 691 | Ga0307410_10010835 | |||
| 692 | Ga0307410_10021295 | |||
| 693 | Ga0307410_10116522 | |||
| 694 | Ga0307410_10119439 | |||
| 695 | Ga0307410_10133432 | |||
| 696 | Ga0307410_10137557 | |||
| 697 | Ga0307410_10162813 | |||
| 698 | Ga0307410_10320844 | |||
| 699 | Ga0307406_10007859 | |||
| 700 | Ga0307406_10059366 | |||
| 701 | Ga0307406_10089983 | |||
| 702 | Ga0307407_10022446 | |||
| 703 | Ga0307407_10027376 | |||
| 704 | Ga0307407_10279617 | |||
| 705 | Ga0307412_10008579 | |||
| 706 | Ga0307412_10019428 | |||
| 707 | Ga0307412_10028666 | |||
| 708 | Ga0307412_10033621 | |||
| 709 | Ga0307412_10052894 | |||
| 710 | Ga0307412_10094413 | |||
| 711 | Ga0307412_10117631 | |||
| 712 | Ga0307412_10152405 | |||
| 713 | Ga0307409_100001452 | |||
| 714 | Ga0307409_100004567 | |||
| 715 | Ga0307409_100023925 | |||
| 716 | Ga0307409_100046356 | |||
| 717 | Ga0307409_100054798 | |||
| 718 | Ga0307409_100087962 | |||
| 719 | Ga0307409_100159717 | |||
| 720 | Ga0307409_100306005 | |||
| 721 | Ga0307409_100315416 | |||
| 722 | Ga0307409_100348113 | |||
| 723 | Ga0307409_100456889 | |||
| 724 | Ga0307409_100490476 | |||
| 725 | Ga0307416_100010637 | |||
| 726 | Ga0307416_100013612 | |||
| 727 | Ga0307416_100030566 | |||
| 728 | Ga0307416_100036540 | |||
| 729 | Ga0307416_100039112 | |||
| 730 | Ga0307416_100055478 | |||
| 731 | Ga0307416_100058874 | |||
| 732 | Ga0307416_100444458 | |||
| 733 | Ga0307416_100512021 | |||
| 734 | Ga0307414_10007772 | |||
| 735 | Ga0307414_10189648 | |||
| 736 | Ga0307411_10001113 | |||
| 737 | Ga0307411_10009349 | |||
| 738 | Ga0307411_10243465 | |||
| 739 | Ga0307415_100004735 | |||
| 740 | Ga0307415_100005607 | |||
| 741 | Ga0307415_100040979 | |||
| 742 | Ga0307415_100094349 | |||
| 743 | Ga0307415_100147616 | |||
| 744 | Ga0307415_100238818 | |||
| 745 | Ga0316583_10010282 | |||
| 746 | Ga0307507_10115927 | |||
| 747 | Ga0316574_0000761 | |||
| 748 | Ga0373931_0144883 | |||
| 749 | Ga0316582_0010627 | |||
| 750 | Ga0316584_0000632 | |||
| 751 | Ga0395899_0004671 | |||
| 752 | Ga0395899_0041144 | |||
| 753 | Ga0395899_0060271 | |||
| 754 | Ga0395900_0013355 | |||
| 755 | Ga0395898_0009849 | |||
| 756 | Ga0395898_0171337 | |||
| 757 | Ga0395898_0347520 | |||
| 758 | Ga0395905_0062495 | |||
| 759 | Ga0395905_0128513 | |||
| 760 | Ga0436364_0574476 | |||
| 761 | Ga0436364_0661415 | |||
| 762 | Ga0395901_0005856 | |||
| 763 | Ga0395901_0008568 | |||
| 764 | Ga0395901_0017936 | |||
| 765 | Ga0395901_0038595 | |||
| 766 | Ga0395901_0043071 | |||
| 767 | Ga0395901_0059690 | |||
| 768 | Ga0395901_0064607 | |||
| 769 | Ga0395901_0310286 | |||
| 770 | Ga0395901_0542409 | |||
| 771 | Ga0395901_0621801 | |||
| 772 | Ga0436365_1427323 | |||
| 773 | Ga0436363_1541032 | |||
| 774 | Ga0439438_013626 | |||
| 775 | Ga0439438_029505 | |||
| 776 | Ga0439439_0032762 | |||
| 777 | Ga0439466_0002535 | |||
| 778 | Ga0439465_0001957 | |||
| 779 | Ga0439465_0047786 | |||
| 780 | Ga0451791_1212074 | |||
| 781 | Ga0451797_0188075 | |||
| 782 | Ga0451853_1003144 | |||
| 783 | Ga0439433_0000016 | |||
| 784 | Ga0439433_0008935 | |||
| 785 | Ga0439433_0021282 | |||
| 786 | Ga0439433_0030950 | |||
| 787 | Ga0439442_000124 | |||
| 788 | Ga0439442_000483 | |||
| 789 | Ga0439442_002655 | |||
| 790 | Ga0439442_003189 | |||
| 791 | Ga0439442_028579 | |||
| 792 | Ga0439432_009769 | |||
| 793 | Ga0439432_051947 | |||
| 794 | Ga0439449_0000123 | |||
| 795 | Ga0439449_0003118 | |||
| 796 | Ga0439452_005222 | |||
| 797 | Ga0439457_007888 | |||
| 798 | Ga0439457_034072 | |||
| 799 | Ga0450920_000050 | |||
| 800 | Ga0450920_001016 | |||
| 801 | Ga0450907_006929 | |||
| 802 | Ga0450907_010839 | |||
| 803 | Ga0439434_0000220 | |||
| 804 | Ga0439434_0007491 | |||
| 805 | Ga0450918_000839 | |||
| 806 | Ga0466969_0006546 | |||
| 807 | Ga0466969_0015025 | |||
| 808 | Ga0466969_0022869 | |||
| 809 | Ga0466969_0098220 | |||
| 810 | Ga0466972_0001567 | |||
| 811 | Ga0466972_0092046 | |||
| 812 | Ga0466965_0108682 | |||
| 813 | Ga0466966_0005827 | |||
| 814 | Ga0466966_0018262 | |||
| 815 | Ga0466966_0083747 | |||
| 816 | Ga0466961_0027971 | |||
| 817 | Ga0466961_0058820 | |||
| 818 | Ga0466961_0103608 | |||
| 819 | Ga0466961_0123057 | |||
| 820 | Ga0466963_0059687 | |||
| 821 | Ga0466963_0200046 | |||
| 822 | Ga0466971_0016447 | |||
| 823 | Ga0466971_0053017 | |||
| 824 | Ga0466971_0146163 | |||
| 825 | Ga0466970_0007657 | |||
| 826 | Ga0466970_0055942 | |||
| 827 | Ga0466957_0051978 | |||
| 828 | Ga0466957_0097356 | |||
| 829 | Ga0466957_0228023 | |||
| 830 | Ga0466957_0279935 | |||
| 831 | Ga0466960_0000756 | |||
| 832 | Ga0466960_0012365 | |||
| 833 | Ga0466960_0013932 | |||
| 834 | Ga0466960_0038220 | |||
| 835 | Ga0466959_0000629 | |||
| 836 | Ga0466959_0009621 | |||
| 837 | Ga0466959_0103208 | |||
| 838 | Ga0466959_0118924 | |||
| 839 | Ga0466959_0207757 | |||
| 840 | Ga0466958_0098800 | |||
| 841 | Ga0466967_0086234 | |||
| 842 | Ga0466967_0333319 | |||
| 843 | Ga0495592_0023860 | |||
| 844 | Ga0495603_0024041 | |||
| 845 | Ga0495629_0046524 | |||
| 846 | Ga0495629_0082825 | |||
| 847 | Ga0495651_0002482 | |||
| 848 | Ga0495653_0047560 | |||
| 849 | Ga0495580_0003950 | |||
| 850 | Ga0495582_0083770 | |||
| 851 | Ga0495582_0141430 | |||
| 852 | Ga0495639_0005295 | |||
| 853 | Ga0495662_0082159 | |||
| 854 | Ga0495664_0187562 | |||
| 855 | Ga0495596_0043833 | |||
| 856 | Ga0495608_0002796 | |||
| 857 | Ga0495631_0038243 | |||
| 858 | Ga0495666_0002641 | |||
| 859 | Ga0495652_0124385 | |||
| 860 | Ga0495665_0001040 | |||
| 861 | Ga0495640_0110091 | |||
| 862 | Ga0495586_0002370 | |||
| 863 | Ga0495586_0033512 | |||
| 864 | Ga0495587_0031907 | |||
| 865 | Ga0495645_0071585 | |||
| 866 | Ga0495667_0021585 | |||
| 867 | Ga0495656_0015435 | |||
| 868 | Ga0495635_0077798 | |||
| 869 | Ga0495635_0138947 | |||
| 870 | Ga0495588_0165833 | |||
| 871 | Ga0495657_0004136 | |||
| 872 | Ga0495657_0044557 | |||
| 873 | Ga0495599_0139708 | |||
| 874 | Ga0495623_0006053 | |||
| 875 | Ga0495646_0049066 | |||
| 876 | Ga0495613_0006145 | |||
| 877 | Ga0495613_0043003 | |||
| 878 | Ga0495589_0068218 | |||
| 879 | Ga0495600_0029405 | |||
| 880 | Ga0495581_0023809 | |||
| 881 | Ga0495604_0001984 | |||
| 882 | Ga0495636_0017549 | |||
| 883 | Ga0495674_0062810 | |||
| 884 | Ga0495675_0003933 | |||
| 885 | Ga0495675_0025626 | |||
| 886 | Ga0495684_0007710 | |||
| 887 | Ga0495593_0057489 | |||
| 888 | Ga0495593_0058436 | |||
| 889 | Ga0495602_0170865 | |||
| 890 | Ga0496100_0347967 | |||
| 891 | Ga0496101_0011629 | |||
| 892 | Ga0496102_0001262 | |||
| 893 | Ga0496102_0018154 | |||
| 894 | Ga0496102_0041908 | |||
| 895 | Ga0496102_0108007 | |||
| 896 | Ga0496102_0147732 | |||
| 897 | Ga0496102_0164764 | |||
| 898 | Ga0496102_0223087 | |||
| 899 | Ga0496102_0338437 | |||
| 900 | Ga0496103_0003834 | |||
| 901 | Ga0496103_0009925 | |||
| 902 | Ga0496103_0167609 | |||
| 903 | Ga0496104_0180390 | |||
| 904 | Ga0496105_0027464 | |||
| 905 | Ga0496105_0040013 | |||
| 906 | Ga0496105_0212848 | |||
| 907 | Ga0496106_0357295 | |||
| 908 | Ga0496108_0002365 | |||
| 909 | Ga0496108_0023395 | |||
| 910 | Ga0496108_0041946 | |||
| 911 | Ga0496108_0056279 | |||
| 912 | Ga0496108_0078585 | |||
| 913 | Ga0496108_0107070 | |||
| 914 | Ga0496108_0353777 | |||
| 915 | Ga0496109_0007600 | |||
| 916 | Ga0496109_0091679 | |||
| 917 | Ga0496109_0169991 | |||
| 918 | Ga0496109_0374687 | |||
| 919 | Ga0496109_0382811 | |||
| 920 | Ga0496110_0014191 | |||
| 921 | Ga0496110_0034049 | |||
| 922 | Ga0496110_0059203 | |||
| 923 | Ga0496110_0175374 | |||
| 924 | Ga0496111_0015138 | |||
| 925 | Ga0496111_0028661 | |||
| 926 | Ga0496111_0130685 | |||
| 927 | Ga0496112_0002045 | |||
| 928 | Ga0496112_0036117 | |||
| 929 | Ga0496112_0229330 | |||
| 930 | Ga0496113_0032171 | |||
| 931 | Ga0496113_0317043 | |||
| 932 | Ga0496114_0001123 | |||
| 933 | Ga0496114_0001926 | |||
| 934 | Ga0496114_0018859 | |||
| 935 | Ga0496114_0043299 | |||
| 936 | Ga0496114_0130171 | |||
| 937 | Ga0496114_0155987 | |||
| 938 | Ga0496114_0177605 | |||
| 939 | Ga0496115_0263481 | |||
| 940 | Ga0501031_0040543 | |||
| 941 | Ga0501032_0001718 | |||
| 942 | Ga0501032_0001836 | |||
| 943 | Ga0501032_0027847 | |||
| 944 | Ga0501032_0055765 | |||
| 945 | Ga0501033_0057771 | |||
| 946 | Ga0501034_0000015 | |||
| 947 | Ga0501036_0031416 | |||
| 948 | Ga0501036_0066359 | |||
| 949 | Ga0501037_0002004 | |||
| 950 | Ga0501037_0023193 | |||
| 951 | Ga0501037_0080941 | |||
| 952 | Ga0501037_0227242 | |||
| 953 | Ga0501038_0021928 | |||
| 954 | Ga0501039_0042291 | |||
| 955 | Ga0501041_0038989 | |||
| 956 | Ga0501042_0038377 | |||
| 957 | Ga0501042_0050137 | |||
| 958 | Ga0501043_0009496 | |||
| 959 | Ga0501043_0009509 | |||
| 960 | Ga0501043_0033398 | |||
| 961 | Ga0501047_0000268 | |||
| 962 | Ga0501047_0017765 | |||
| 963 | Ga0501048_0098209 | |||
| 964 | Ga0501070_0011458 | |||
| 965 | Ga0501071_0055806 | |||
| 966 | Ga0501072_0385030 | |||
| 967 | Ga0501074_0023083 | |||
| 968 | Ga0501076_0060741 | |||
| 969 | Ga0501077_0048182 | |||
| 970 | Ga0501080_0346850 | |||
| 971 | Ga0501035_0052290 | |||
| 972 | Ga0501035_0115135 | |||
| 973 | Ga0501044_0104540 | |||
| 974 | Ga0501044_0335371 | |||
| 975 | Ga0501045_0071558 | |||
| 976 | Ga0501045_0077705 | |||
| 977 | nmdc:mga0yw44_79175_c1 | |||
| 978 | nmdc:mga06z11_85768_c1 | |||
| 979 | nmdc:mga07m45_22297_c1 | |||
| 980 | nmdc:mga05p37_128689_c1 | |||
| 981 | nmdc:mga05p37_65173_c1 | |||
| 982 | nmdc:mga09592_181541_c1 | |||
| 983 | nmdc:mga06r32_268795_c1 | |||
| 984 | nmdc:mga06r32_270485_c1 | |||
| 985 | nmdc:mga06r32_40958_c1 | |||
| 986 | Ga0495601_0004774 | |||
| 987 | Ga0495619_0175984 | |||
| 988 | Ga0500559_0007254 | |||
| 989 | Ga0500585_062864 | |||
| 990 | Ga0501084_0255599 | |||
| 991 | Ga0501082_0071920 | |||
| 992 | Ga0466962_0064494 | |||
| 993 | 2537897781 | |||
| 994 | 2559430553 | |||
| 995 | 2585321089 | |||
| 996 | 2586060168 | |||
| 997 | 2623501113 | |||
| 998 | 2645719793 | |||
| 999 | 2676491332 | |||
| 1000 | 2691513493 | |||
| 1001 | 2739604272 | |||
| 1002 | 2768645732 | |||
| 1003 | 2774904267 | |||
| 1004 | 2775658861 | |||
| 1005 | 2785343821 | |||
| 1006 | 2791916396 | |||
| 1007 | 2795787378 | |||
| 1008 | 2795797758 | |||
| 1009 | 2808830745 | |||
| 1010 | 2808851934 | |||
| 1011 | 2808879754 | |||
| 1012 | 2808890678 | |||
| 1013 | 2808895958 | |||
| 1014 | 2809590845 | |||
| 1015 | 2810363506 | |||
| 1016 | 2812321700 | |||
| 1017 | 2812351207 | |||
| 1018 | 2816503587 | |||
| 1019 | 2817509472 | |||
| 1020 | 2819739153 | |||
| 1021 | 2842137800 | |||
| 1022 | 2844852301 | |||
| 1023 | 2857728853 | |||
| 1024 | 2857743798 | |||
| 1025 | 2862383789 | |||
| 1026 | 2867346907 | |||
| 1027 | 2884700651 | |||
| 1028 | 2891403611 | |||
| 1029 | 2895429228 | |||
| 1030 | 2895452630 | |||
| 1031 | 2899375428 | |||
| 1032 | 2902795781 | |||
| 1033 | 2904499697 | |||
| 1034 | 2904780354 | |||
| 1035 | 2905930275 | |||
| 1036 | 2910814854 | |||
| 1037 | 2915771865 | |||
| 1038 | 2919036150 | |||
| 1039 | 2919060865 | |||
| 1040 | 2919392430 | |||
| 1041 | 2919450770 | |||
| 1042 | 2919538632 | |||
| 1043 | 2920883729 | |||
| 1044 | 2932431097 | |||
| 1045 | 2933419207 | |||
| 1046 | 2939600061 | |||
| 1047 | 2939647874 | |||
| 1048 | 2939679064 | |||
| 1049 | 2945919570 | |||
| 1050 | 2945924519 | |||
| 1051 | 2945943745 | |||
| 1052 | 2945958066 | |||
| 1053 | 2946004064 | |||
| 1054 | 2946025291 | |||
| 1055 | 2946039714 | |||
| 1056 | 2946063292 | |||
| 1057 | 2954000938 | |||
| 1058 | 2966604310 | |||
| 1059 | 2974303214 | |||
| 1060 | 2990092540 | |||
| 1061 | 2995469279 | |||
| 1062 | 3001891666 | |||
| 1063 | 3003002245 | |||
| 1064 | 8003320675 | |||
| 1065 | 8008559963 | |||
| 1066 | 8053947884 | |||
| 1067 | 8054109997 | |||
| 1068 | 8054478331 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7npj-assembly2.cif.gz_F | crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine | 0.9671 | 2 | 343 |
| 7npj-assembly2.cif.gz_F | crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine | 0.9616 | 2 | 343 |
| 1vkn-assembly1.cif.gz_B | crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution | 0.9454 | 1 | 343 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9435 | 1 | 343 |
| 2cvo-assembly1.cif.gz_C | crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) | 0.9434 | 2 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPZ9_6_155_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9849 | 2 | 143 | 3.40.50.720 |
| 2nqtA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.97 | 2 | 143 | 3.40.50.720 |
| af_P9WPZ9_10_289_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9669 | 4 | 280 | 3.50.50.60 |
| 2i3gB02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9657 | 144 | 310 | 3.30.360.10 |
| af_I1KL32_193_359_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.956 | 144 | 310 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N5VZW7-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9986 | 1 | 148 |
GO:0006526
GO:0016620 GO:0051287 |
| AF-A0A3B0AYM5-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9972 | 1 | 165 |
GO:0003942
GO:0006526 GO:0051287 |
| AF-A0A359FCN8-F1-model_v4 | deleted | 0.9936 | 1 | 122 |
|
| AF-A0A1P8YGV8-F1-model_v4 | Semialdehyde dehydrogenase, NAD binding domain protein | 0.9925 | 2 | 157 |
GO:0003942
GO:0006526 GO:0051287 |
| AF-A0A5N5VZW7-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9919 | 1 | 148 |
GO:0006526
GO:0016620 GO:0051287 |