F460559

General Info

Members Datasets Scaffolds Average Seq Length
534 328 1068 343

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0363721|Ga0451793_0363721_104_1264
Length 386
Sequence MFWTSSGDIPIVRHVDGRGVLDSHAVICIVPAEICSGWQEKGKAMTYRVAVAGASGYAGGEVLRLLLGHPEITIGALTAHSSAGERLGLHQPHLLPLADRLIEPTTPETLAGHDAVFLALPHGQSHELAAQLGADVLVIDCGADHRLTDPVAWEQFYGGTHPGSWPYGMPELPNGRVALQGTKRVAVPGCYPTTASLAMAPALAADLVEPDIVVVAASGTSGAGKSPKVNLLGSEVMGSASAYGVGGVHRHTPEMVQNLTAAAGVPVTVSFTPVLVPMSRGILATVSAPAKPDVDVDDVRDVYQKAYADEPFVHLLPAGQWPTTAATLGANTVLLQVAVDRAAGRVVVIAALDNLTKGTAGAAVQCLNIALGLPETTGLSTVGVAP

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
254 2558860280 Kutzneria sp. 744 Isolate Unclassified
255 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
256 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
257 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
258 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
259 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
260 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
261 2739367653 Kocuria sp. OV113 Isolate Unclassified
262 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
263 2773857933 Frankia sp. BMG5.30 Isolate Nodule
264 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
265 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
266 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
267 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
268 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
269 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
270 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
271 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
272 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
273 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
274 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
275 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
276 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
277 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
278 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
279 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
280 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
281 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
282 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
283 2857727296 Kocuria sp. R-72562 Isolate Unclassified
284 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
285 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
286 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
287 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
288 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
289 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
290 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
291 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
292 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
293 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
294 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
295 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
296 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
297 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
298 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
299 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
300 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
301 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
302 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
303 2920879853 Kocuria salina CV6 Isolate Unclassified
304 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
305 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
306 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
307 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
308 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
309 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
310 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
311 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
312 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
313 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
314 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
315 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
316 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
317 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
318 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
319 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
320 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
321 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
322 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
323 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
324 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
325 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
326 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
327 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
328 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.77
Metatranscriptomes 0
Isolates 14.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.25
Nodule 0.75
Rhizoplane 9.93
Rhizosphere 77.9
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_0363721 3300041452 Bacteria 16343
2 LJQas_1000961 3300000549 Bacteria 4434
3 JGI25151J46595_10043310 3300003187 Bacteria 1612
4 JGI25406J46586_10008402 3300003203 Bacteria 4679
5 JGI25406J46586_10014525 3300003203 Bacteria 3345
6 rootL2_10082130 3300003322 Bacteria 3376
7 Ga0065714_10080987 3300005288 Bacteria 2404
8 Ga0070690_100179341 3300005330 Bacteria 1463
9 Ga0068869_100060951 3300005334 Bacteria 2766
10 Ga0070682_100112461 3300005337 Bacteria 1817
11 Ga0070668_100011782 3300005347 Bacteria 6512
12 Ga0070668_100057614 3300005347 Bacteria 3003
13 Ga0070668_100172839 3300005347 Bacteria 1760
14 Ga0070674_100068793 3300005356 Bacteria 2496
15 Ga0070667_100089853 3300005367 Bacteria 2639
16 Ga0070714_100068185 3300005435 Bacteria 3069
17 Ga0070714_100080447 3300005435 Bacteria 2836
18 Ga0070714_100184422 3300005435 Bacteria 1901
19 Ga0070705_100005182 3300005440 Bacteria 6332
20 Ga0070663_100053562 3300005455 Bacteria 2881
21 Ga0070663_100142448 3300005455 Bacteria 1831
22 Ga0070678_100085102 3300005456 Bacteria 2409
23 Ga0070685_10169932 3300005466 Bacteria 1396
24 Ga0070685_10234234 3300005466 Bacteria 1209
25 Ga0070679_100064586 3300005530 Bacteria 3648
26 Ga0070684_100327406 3300005535 Bacteria 1408
27 Ga0070672_100161027 3300005543 Bacteria 1862
28 Ga0070693_100014380 3300005547 Bacteria 4055
29 Ga0068855_100070326 3300005563 Bacteria 4072
30 Ga0070702_100002818 3300005615 Bacteria 7622
31 Ga0068852_100044706 3300005616 Bacteria 3764
32 Ga0068852_100142357 3300005616 Bacteria 2221
33 Ga0068864_100214815 3300005618 Bacteria 1772
34 Ga0068866_10068924 3300005718 Bacteria 1862
35 Ga0068866_10182740 3300005718 Bacteria 1240
36 Ga0068870_10192716 3300005840 Bacteria 1231
37 Ga0068860_100008451 3300005843 Bacteria 10253
38 Ga0081455_10000943 3300005937 Bacteria 37170
39 Ga0081540_1017386 3300005983 Bacteria 4454
40 Ga0081539_10002043 3300005985 Bacteria 30343
41 Ga0081539_10003164 3300005985 Bacteria 20878
42 Ga0075365_10056016 3300006038 Bacteria 2620
43 Ga0075370_10024829 3300006353 Bacteria 3314
44 Ga0075428_100006492 3300006844 Bacteria 13000
45 Ga0075430_100012516 3300006846 Bacteria 7221
46 Ga0075431_100121330 3300006847 Bacteria 2697
47 Ga0068865_100123521 3300006881 Bacteria 1929
48 Ga0105251_10017292 3300009011 Bacteria 3869
49 Ga0105244_10003957 3300009036 Bacteria 10388
50 Ga0105245_10086107 3300009098 Bacteria 2881
51 Ga0105245_10226409 3300009098 Bacteria 1807
52 Ga0105245_10236676 3300009098 Bacteria 1768
53 Ga0105245_10299965 3300009098 Bacteria 1576
54 Ga0105243_10122329 3300009148 Bacteria 2196
55 Ga0105243_10391386 3300009148 Bacteria 1288
56 Ga0105242_10021655 3300009176 Bacteria 5049
57 Ga0105242_10192202 3300009176 Bacteria 1808
58 Ga0105248_10264530 3300009177 Bacteria 1936
59 Ga0105238_10095134 3300009551 Bacteria 2966
60 Ga0105238_10210592 3300009551 Bacteria 1920
61 Ga0105249_10459046 3300009553 Bacteria 1314
62 Ga0105239_10281665 3300010375 Bacteria 1872
63 Ga0105246_10036154 3300011119 Bacteria 3307
64 Ga0157373_10089850 3300013100 Bacteria 2163
65 Ga0157369_10016615 3300013105 Bacteria 8273
66 Ga0157369_10036994 3300013105 Bacteria 5347
67 Ga0157369_10293198 3300013105 Bacteria 1693
68 Ga0157372_10252177 3300013307 Bacteria 2049
69 Ga0157372_10295448 3300013307 Bacteria 1884
70 Ga0157372_10337989 3300013307 Bacteria 1754
71 Ga0157375_10198025 3300013308 Bacteria 2164
72 Ga0163163_10311474 3300014325 Bacteria 1627
73 Ga0163163_10609751 3300014325 Bacteria 1155
74 Ga0182008_10120024 3300014497 Bacteria 1306
75 Ga0157379_10138891 3300014968 Bacteria 2190
76 Ga0157376_10055886 3300014969 Bacteria 3295
77 Ga0163161_10071298 3300017792 Bacteria 2542
78 Ga0163161_10084380 3300017792 Bacteria 2342
79 Ga0213874_10034046 3300021377 Bacteria 1489
80 Ga0213876_10076070 3300021384 Bacteria 1773
81 Ga0213875_10004261 3300021388 Bacteria 7881
82 Ga0209148_1004226 3300025254 Bacteria 3596
83 Ga0209129_1000079 3300025258 Bacteria 187308
84 Ga0209025_1001940 3300025294 Bacteria 23871
85 Ga0209051_1029172 3300025303 Bacteria 2164
86 Ga0207655_1009982 3300025728 Bacteria 5822
87 Ga0207655_1038486 3300025728 Bacteria 2090
88 Ga0207713_1015442 3300025735 Bacteria 3919
89 Ga0207688_10002706 3300025901 Bacteria 9604
90 Ga0207688_10052744 3300025901 Bacteria 2279
91 Ga0207705_10210999 3300025909 Bacteria 1473
92 Ga0207654_10071385 3300025911 Bacteria 2064
93 Ga0207707_10133607 3300025912 Bacteria 2170
94 Ga0207657_10025823 3300025919 Bacteria 5409
95 Ga0207652_10046769 3300025921 Bacteria 3694
96 Ga0207687_10301986 3300025927 Bacteria 1290
97 Ga0207664_10020667 3300025929 Bacteria 4885
98 Ga0207664_10133715 3300025929 Bacteria 2090
99 Ga0207664_10259302 3300025929 Bacteria 1520
100 Ga0207690_10082894 3300025932 Bacteria 2243
101 Ga0207706_10030042 3300025933 Bacteria 4850
102 Ga0207709_10359338 3300025935 Bacteria 1102
103 Ga0207670_10026648 3300025936 Bacteria 3645
104 Ga0207704_10085703 3300025938 Bacteria 2052
105 Ga0207691_10346339 3300025940 Bacteria 1271
106 Ga0207711_10303274 3300025941 Bacteria 1473
107 Ga0207689_10209050 3300025942 Bacteria 1612
108 Ga0207651_10145012 3300025960 Bacteria 1840
109 Ga0207668_10049588 3300025972 Bacteria 2887
110 Ga0207640_10095488 3300025981 Bacteria 2070
111 Ga0207640_10292305 3300025981 Bacteria 1285
112 Ga0207658_10027588 3300025986 Bacteria 3991
113 Ga0207639_10136613 3300026041 Bacteria 2037
114 Ga0207678_10004886 3300026067 Bacteria 12042
115 Ga0207708_10163533 3300026075 Bacteria 1759
116 Ga0207641_10064810 3300026088 Bacteria 3124
117 Ga0207648_10018968 3300026089 Bacteria 6211
118 Ga0207676_10127953 3300026095 Bacteria 2154
119 Ga0207675_100007775 3300026118 Bacteria 10113
120 Ga0207683_10076097 3300026121 Bacteria 2972
121 Ga0207683_10085389 3300026121 Bacteria 2806
122 Ga0207683_10102233 3300026121 Bacteria 2559
123 Ga0207683_10136041 3300026121 Bacteria 2212
124 Ga0207683_10149331 3300026121 Bacteria 2108
125 Ga0207698_10013409 3300026142 Bacteria 5407
126 Ga0207698_10101364 3300026142 Bacteria 2387
127 Ga0207698_10133906 3300026142 Bacteria 2123
128 Ga0207698_10258672 3300026142 Bacteria 1598
129 Ga0207428_10044099 3300027907 Bacteria 3599
130 Ga0268266_10064805 3300028379 Bacteria 3157
131 Ga0268265_10141030 3300028380 Bacteria 2018
132 Ga0268264_10006538 3300028381 Bacteria 9816
133 Ga0265334_10000839 3300028573 Bacteria 15353
134 Ga0307511_10000178 3300030521 Bacteria 62672
135 Ga0265340_10002163 3300031247 Bacteria 11270
136 Ga0307513_10000483 3300031456 Bacteria 57234
137 Ga0307408_100004120 3300031548 Bacteria 9908
138 Ga0307408_100009061 3300031548 Bacteria 6570
139 Ga0307408_100103084 3300031548 Bacteria 2177
140 Ga0307408_100218572 3300031548 Bacteria 1553
141 Ga0307408_100317258 3300031548 Bacteria 1311
142 Ga0316575_10005231 3300031665 Bacteria 4617
143 Ga0316579_10000068 3300031691 Bacteria 25943
144 Ga0316579_10000911 3300031691 Bacteria 10252
145 Ga0307405_10081338 3300031731 Bacteria 2117
146 Ga0307405_10318759 3300031731 Bacteria 1186
147 Ga0316577_10031879 3300031733 Bacteria 2944
148 Ga0307413_10002160 3300031824 Bacteria 7904
149 Ga0307413_10012392 3300031824 Bacteria 4243
150 Ga0307413_10014808 3300031824 Bacteria 3976
151 Ga0307413_10056178 3300031824 Bacteria 2400
152 Ga0307413_10072938 3300031824 Bacteria 2168
153 Ga0307413_10120305 3300031824 Bacteria 1777
154 Ga0307413_10198050 3300031824 Bacteria 1448
155 Ga0307518_10001157 3300031838 Bacteria 19806
156 Ga0307410_10004329 3300031852 Bacteria 7321
157 Ga0307410_10010835 3300031852 Bacteria 5188
158 Ga0307410_10021295 3300031852 Bacteria 3984
159 Ga0307410_10116522 3300031852 Bacteria 1941
160 Ga0307410_10119439 3300031852 Bacteria 1920
161 Ga0307410_10133432 3300031852 Bacteria 1827
162 Ga0307410_10137557 3300031852 Bacteria 1802
163 Ga0307410_10162813 3300031852 Bacteria 1673
164 Ga0307410_10320844 3300031852 Bacteria 1229
165 Ga0307406_10007859 3300031901 Bacteria 5935
166 Ga0307406_10059366 3300031901 Bacteria 2462
167 Ga0307406_10089983 3300031901 Bacteria 2064
168 Ga0307407_10022446 3300031903 Bacteria 3275
169 Ga0307407_10027376 3300031903 Bacteria 3033
170 Ga0307407_10279617 3300031903 Bacteria 1155
171 Ga0307412_10008579 3300031911 Bacteria 5841
172 Ga0307412_10019428 3300031911 Bacteria 4115
173 Ga0307412_10028666 3300031911 Bacteria 3486
174 Ga0307412_10033621 3300031911 Bacteria 3261
175 Ga0307412_10052894 3300031911 Bacteria 2690
176 Ga0307412_10094413 3300031911 Bacteria 2100
177 Ga0307412_10117631 3300031911 Bacteria 1908
178 Ga0307412_10152405 3300031911 Bacteria 1707
179 Ga0307409_100001452 3300031995 Bacteria 11648
180 Ga0307409_100004567 3300031995 Bacteria 7804
181 Ga0307409_100023925 3300031995 Bacteria 4245
182 Ga0307409_100046356 3300031995 Bacteria 3290
183 Ga0307409_100054798 3300031995 Bacteria 3074
184 Ga0307409_100087962 3300031995 Bacteria 2534
185 Ga0307409_100159717 3300031995 Bacteria 1969
186 Ga0307409_100306005 3300031995 Bacteria 1481
187 Ga0307409_100315416 3300031995 Bacteria 1461
188 Ga0307409_100348113 3300031995 Bacteria 1397
189 Ga0307409_100456889 3300031995 Bacteria 1234
190 Ga0307409_100490476 3300031995 Bacteria 1194
191 Ga0307416_100010637 3300032002 Bacteria 6091
192 Ga0307416_100013612 3300032002 Bacteria 5538
193 Ga0307416_100030566 3300032002 Bacteria 4043
194 Ga0307416_100036540 3300032002 Bacteria 3768
195 Ga0307416_100039112 3300032002 Bacteria 3668
196 Ga0307416_100055478 3300032002 Bacteria 3191
197 Ga0307416_100058874 3300032002 Bacteria 3118
198 Ga0307416_100444458 3300032002 Bacteria 1347
199 Ga0307416_100512021 3300032002 Bacteria 1267
200 Ga0307414_10007772 3300032004 Bacteria 6044
201 Ga0307414_10189648 3300032004 Bacteria 1662
202 Ga0307411_10001113 3300032005 Bacteria 10472
203 Ga0307411_10009349 3300032005 Bacteria 5148
204 Ga0307411_10243465 3300032005 Bacteria 1409
205 Ga0307415_100004735 3300032126 Bacteria 7119
206 Ga0307415_100005607 3300032126 Bacteria 6683
207 Ga0307415_100040979 3300032126 Bacteria 3072
208 Ga0307415_100094349 3300032126 Bacteria 2175
209 Ga0307415_100147616 3300032126 Bacteria 1805
210 Ga0307415_100238818 3300032126 Bacteria 1468
211 Ga0316583_10010282 3300032133 Bacteria 3373
212 Ga0307507_10115927 3300033179 Bacteria 2165
213 Ga0316574_0000761 3300035398 Bacteria 13886
214 Ga0373931_0144883 3300035691 Bacteria 1380
215 Ga0316582_0010627 3300036647 Bacteria 5050
216 Ga0316584_0000632 3300036712 Bacteria 19078
217 Ga0395899_0004671 3300037312 Bacteria 10692
218 Ga0395899_0041144 3300037312 Bacteria 3453
219 Ga0395899_0060271 3300037312 Bacteria 2796
220 Ga0395900_0013355 3300037418 Bacteria 8393
221 Ga0395898_0009849 3300037466 Bacteria 10016
222 Ga0395898_0171337 3300037466 Bacteria 2075
223 Ga0395898_0347520 3300037466 Bacteria 1414
224 Ga0395905_0062495 3300037471 Bacteria 3484
225 Ga0395905_0128513 3300037471 Bacteria 2383
226 Ga0436364_0574476 3300037853 Bacteria 12936
227 Ga0436364_0661415 3300037853 Bacteria 3328
228 Ga0395901_0005856 3300038443 Bacteria 12433
229 Ga0395901_0008568 3300038443 Bacteria 10335
230 Ga0395901_0017936 3300038443 Bacteria 7225
231 Ga0395901_0038595 3300038443 Bacteria 4940
232 Ga0395901_0043071 3300038443 Bacteria 4682
233 Ga0395901_0059690 3300038443 Bacteria 3968
234 Ga0395901_0064607 3300038443 Bacteria 3810
235 Ga0395901_0310286 3300038443 Bacteria 1634
236 Ga0395901_0542409 3300038443 Bacteria 1179
237 Ga0395901_0621801 3300038443 Bacteria 1087
238 Ga0436365_1427323 3300039437 Bacteria 3080
239 Ga0436363_1541032 3300039450 Bacteria 2785
240 Ga0439438_013626 3300041405 Bacteria 2447
241 Ga0439438_029505 3300041405 Bacteria 1468
242 Ga0439439_0032762 3300041406 Bacteria 1328
243 Ga0439466_0002535 3300041411 Bacteria 7153
244 Ga0439465_0001957 3300041413 Bacteria 6751
245 Ga0439465_0047786 3300041413 Bacteria 1396
246 Ga0451791_1212074 3300041451 Bacteria 4789
247 Ga0451797_0188075 3300041453 Bacteria 4515
248 Ga0451853_1003144 3300041512 Bacteria 2527
249 Ga0439433_0000016 3300041999 Bacteria 22353
250 Ga0439433_0008935 3300041999 Bacteria 2181
251 Ga0439433_0021282 3300041999 Bacteria 1450
252 Ga0439433_0030950 3300041999 Bacteria 1224
253 Ga0439442_000124 3300042002 Bacteria 19456
254 Ga0439442_000483 3300042002 Bacteria 9062
255 Ga0439442_002655 3300042002 Bacteria 3513
256 Ga0439442_003189 3300042002 Bacteria 3244
257 Ga0439442_028579 3300042002 Bacteria 1162
258 Ga0439432_009769 3300042006 Bacteria 3338
259 Ga0439432_051947 3300042006 Bacteria 1277
260 Ga0439449_0000123 3300042007 Bacteria 25838
261 Ga0439449_0003118 3300042007 Bacteria 6458
262 Ga0439452_005222 3300042010 Bacteria 4216
263 Ga0439457_007888 3300042014 Bacteria 2532
264 Ga0439457_034072 3300042014 Bacteria 1131
265 Ga0450920_000050 3300042122 Bacteria 14912
266 Ga0450920_001016 3300042122 Bacteria 4596
267 Ga0450907_006929 3300042146 Bacteria 1890
268 Ga0450907_010839 3300042146 Bacteria 1514
269 Ga0439434_0000220 3300042435 Bacteria 15927
270 Ga0439434_0007491 3300042435 Bacteria 3197
271 Ga0450918_000839 3300042531 Bacteria 6482
272 Ga0466969_0006546 3300044656 Bacteria 6197
273 Ga0466969_0015025 3300044656 Bacteria 4061
274 Ga0466969_0022869 3300044656 Bacteria 3223
275 Ga0466969_0098220 3300044656 Bacteria 1381
276 Ga0466972_0001567 3300044658 Bacteria 11146
277 Ga0466972_0092046 3300044658 Bacteria 1438
278 Ga0466965_0108682 3300044683 Bacteria 1424
279 Ga0466966_0005827 3300044684 Bacteria 8121
280 Ga0466966_0018262 3300044684 Bacteria 4627
281 Ga0466966_0083747 3300044684 Bacteria 1984
282 Ga0466961_0027971 3300044693 Bacteria 3626
283 Ga0466961_0058820 3300044693 Bacteria 2444
284 Ga0466961_0103608 3300044693 Bacteria 1792
285 Ga0466961_0123057 3300044693 Bacteria 1628
286 Ga0466963_0059687 3300044694 Bacteria 2546
287 Ga0466963_0200046 3300044694 Bacteria 1397
288 Ga0466971_0016447 3300044719 Bacteria 3266
289 Ga0466971_0053017 3300044719 Bacteria 1827
290 Ga0466971_0146163 3300044719 Bacteria 1102
291 Ga0466970_0007657 3300044765 Bacteria 5415
292 Ga0466970_0055942 3300044765 Bacteria 2108
293 Ga0466957_0051978 3300044842 Bacteria 2494
294 Ga0466957_0097356 3300044842 Bacteria 1850
295 Ga0466957_0228023 3300044842 Bacteria 1232
296 Ga0466957_0279935 3300044842 Bacteria 1116
297 Ga0466960_0000756 3300044901 Bacteria 11383
298 Ga0466960_0012365 3300044901 Bacteria 3600
299 Ga0466960_0013932 3300044901 Bacteria 3427
300 Ga0466960_0038220 3300044901 Bacteria 2255
301 Ga0466959_0000629 3300045049 Bacteria 20458
302 Ga0466959_0009621 3300045049 Bacteria 6876
303 Ga0466959_0103208 3300045049 Bacteria 2040
304 Ga0466959_0118924 3300045049 Bacteria 1880
305 Ga0466959_0207757 3300045049 Bacteria 1361
306 Ga0466958_0098800 3300045836 Bacteria 1813
307 Ga0466967_0086234 3300045976 Bacteria 2844
308 Ga0466967_0333319 3300045976 Bacteria 1466
309 Ga0495592_0023860 3300046454 Bacteria 4652
310 Ga0495603_0024041 3300046455 Bacteria 3686
311 Ga0495629_0046524 3300046459 Bacteria 3043
312 Ga0495629_0082825 3300046459 Bacteria 2239
313 Ga0495651_0002482 3300046462 Bacteria 14259
314 Ga0495653_0047560 3300046463 Bacteria 3317
315 Ga0495580_0003950 3300046472 Bacteria 12508
316 Ga0495582_0083770 3300046473 Bacteria 1772
317 Ga0495582_0141430 3300046473 Bacteria 1364
318 Ga0495639_0005295 3300046475 Bacteria 5552
319 Ga0495662_0082159 3300046476 Bacteria 1567
320 Ga0495664_0187562 3300046477 Bacteria 1254
321 Ga0495596_0043833 3300046500 Bacteria 1763
322 Ga0495608_0002796 3300046511 Bacteria 12519
323 Ga0495631_0038243 3300046518 Bacteria 2134
324 Ga0495666_0002641 3300046526 Bacteria 8935
325 Ga0495652_0124385 3300046529 Bacteria 2051
326 Ga0495665_0001040 3300046531 Bacteria 14712
327 Ga0495640_0110091 3300046533 Bacteria 1800
328 Ga0495586_0002370 3300046535 Bacteria 10227
329 Ga0495586_0033512 3300046535 Bacteria 2756
330 Ga0495587_0031907 3300046536 Bacteria 3187
331 Ga0495645_0071585 3300046543 Bacteria 2500
332 Ga0495667_0021585 3300046559 Bacteria 4344
333 Ga0495656_0015435 3300046615 Bacteria 2883
334 Ga0495635_0077798 3300046663 Bacteria 2272
335 Ga0495635_0138947 3300046663 Bacteria 1655
336 Ga0495588_0165833 3300046674 Bacteria 1168
337 Ga0495657_0004136 3300046675 Bacteria 11619
338 Ga0495657_0044557 3300046675 Bacteria 3017
339 Ga0495599_0139708 3300046678 Bacteria 1503
340 Ga0495623_0006053 3300046679 Bacteria 7864
341 Ga0495646_0049066 3300046680 Bacteria 2562
342 Ga0495613_0006145 3300046689 Bacteria 8987
343 Ga0495613_0043003 3300046689 Bacteria 3342
344 Ga0495589_0068218 3300046794 Bacteria 1740
345 Ga0495600_0029405 3300046809 Bacteria 3557
346 Ga0495581_0023809 3300047315 Bacteria 3548
347 Ga0495604_0001984 3300047317 Bacteria 16517
348 Ga0495636_0017549 3300047318 Bacteria 2866
349 Ga0495674_0062810 3300047319 Bacteria 3233
350 Ga0495675_0003933 3300047444 Bacteria 9000
351 Ga0495675_0025626 3300047444 Bacteria 3758
352 Ga0495684_0007710 3300047471 Bacteria 8331
353 Ga0495593_0057489 3300047673 Bacteria 2042
354 Ga0495593_0058436 3300047673 Bacteria 2023
355 Ga0495602_0170865 3300048088 Bacteria 1687
356 Ga0496100_0347967 3300048903 Bacteria 1119
357 Ga0496101_0011629 3300048904 Bacteria 5846
358 Ga0496102_0001262 3300048905 Bacteria 22825
359 Ga0496102_0018154 3300048905 Bacteria 6174
360 Ga0496102_0041908 3300048905 Bacteria 4147
361 Ga0496102_0108007 3300048905 Bacteria 2592
362 Ga0496102_0147732 3300048905 Bacteria 2207
363 Ga0496102_0164764 3300048905 Bacteria 2086
364 Ga0496102_0223087 3300048905 Bacteria 1777
365 Ga0496102_0338437 3300048905 Bacteria 1417
366 Ga0496103_0003834 3300048906 Bacteria 9148
367 Ga0496103_0009925 3300048906 Bacteria 5631
368 Ga0496103_0167609 3300048906 Bacteria 1410
369 Ga0496104_0180390 3300048907 Bacteria 2022
370 Ga0496105_0027464 3300048908 Bacteria 4651
371 Ga0496105_0040013 3300048908 Bacteria 3865
372 Ga0496105_0212848 3300048908 Bacteria 1575
373 Ga0496106_0357295 3300048909 Bacteria 1173
374 Ga0496108_0002365 3300048911 Bacteria 15107
375 Ga0496108_0023395 3300048911 Bacteria 5084
376 Ga0496108_0041946 3300048911 Bacteria 3820
377 Ga0496108_0056279 3300048911 Bacteria 3304
378 Ga0496108_0078585 3300048911 Bacteria 2793
379 Ga0496108_0107070 3300048911 Bacteria 2387
380 Ga0496108_0353777 3300048911 Bacteria 1282
381 Ga0496109_0007600 3300048912 Bacteria 9190
382 Ga0496109_0091679 3300048912 Bacteria 2810
383 Ga0496109_0169991 3300048912 Bacteria 2044
384 Ga0496109_0374687 3300048912 Bacteria 1344
385 Ga0496109_0382811 3300048912 Bacteria 1329
386 Ga0496110_0014191 3300048913 Bacteria 6609
387 Ga0496110_0034049 3300048913 Bacteria 4409
388 Ga0496110_0059203 3300048913 Bacteria 3375
389 Ga0496110_0175374 3300048913 Bacteria 1946
390 Ga0496111_0015138 3300048914 Bacteria 5287
391 Ga0496111_0028661 3300048914 Bacteria 3947
392 Ga0496111_0130685 3300048914 Bacteria 1858
393 Ga0496112_0002045 3300048915 Bacteria 15985
394 Ga0496112_0036117 3300048915 Bacteria 4819
395 Ga0496112_0229330 3300048915 Bacteria 1812
396 Ga0496113_0032171 3300048916 Bacteria 3811
397 Ga0496113_0317043 3300048916 Bacteria 1249
398 Ga0496114_0001123 3300048917 Bacteria 20224
399 Ga0496114_0001926 3300048917 Bacteria 15798
400 Ga0496114_0018859 3300048917 Bacteria 5586
401 Ga0496114_0043299 3300048917 Bacteria 3733
402 Ga0496114_0130171 3300048917 Bacteria 2173
403 Ga0496114_0155987 3300048917 Bacteria 1982
404 Ga0496114_0177605 3300048917 Bacteria 1858
405 Ga0496115_0263481 3300048918 Bacteria 1417
406 Ga0501031_0040543 3300049568 Bacteria 3040
407 Ga0501032_0001718 3300049569 Bacteria 17319
408 Ga0501032_0001836 3300049569 Bacteria 16790
409 Ga0501032_0027847 3300049569 Bacteria 3884
410 Ga0501032_0055765 3300049569 Bacteria 2658
411 Ga0501033_0057771 3300049570 Bacteria 2866
412 Ga0501034_0000015 3300049571 Bacteria 296163
413 Ga0501036_0031416 3300049572 Bacteria 4488
414 Ga0501036_0066359 3300049572 Bacteria 3053
415 Ga0501037_0002004 3300049573 Bacteria 14749
416 Ga0501037_0023193 3300049573 Bacteria 4589
417 Ga0501037_0080941 3300049573 Bacteria 2355
418 Ga0501037_0227242 3300049573 Bacteria 1311
419 Ga0501038_0021928 3300049574 Bacteria 5728
420 Ga0501039_0042291 3300049575 Bacteria 3520
421 Ga0501041_0038989 3300049577 Bacteria 2882
422 Ga0501042_0038377 3300049578 Bacteria 3402
423 Ga0501042_0050137 3300049578 Bacteria 2977
424 Ga0501043_0009496 3300049579 Bacteria 7628
425 Ga0501043_0009509 3300049579 Bacteria 7621
426 Ga0501043_0033398 3300049579 Bacteria 4048
427 Ga0501047_0000268 3300049581 Bacteria 60315
428 Ga0501047_0017765 3300049581 Bacteria 6816
429 Ga0501048_0098209 3300049582 Bacteria 2066
430 Ga0501070_0011458 3300049586 Bacteria 7491
431 Ga0501071_0055806 3300049587 Bacteria 2852
432 Ga0501072_0385030 3300049588 Bacteria 1113
433 Ga0501074_0023083 3300049590 Bacteria 4524
434 Ga0501076_0060741 3300049592 Bacteria 3007
435 Ga0501077_0048182 3300049593 Bacteria 2707
436 Ga0501080_0346850 3300049742 Bacteria 1341
437 Ga0501035_0052290 3300049822 Bacteria 3655
438 Ga0501035_0115135 3300049822 Bacteria 2354
439 Ga0501044_0104540 3300049823 Bacteria 2846
440 Ga0501044_0335371 3300049823 Bacteria 1434
441 Ga0501045_0071558 3300049824 Bacteria 2552
442 Ga0501045_0077705 3300049824 Bacteria 2446
443 nmdc:mga0yw44_79175_c1 3300050492 Bacteria 2056
444 nmdc:mga06z11_85768_c1 3300050494 Bacteria 1699
445 nmdc:mga07m45_22297_c1 3300050496 Bacteria 3456
446 nmdc:mga05p37_128689_c1 3300050507 Bacteria 3108
447 nmdc:mga05p37_65173_c1 3300050507 Bacteria 4483
448 nmdc:mga09592_181541_c1 3300050508 Bacteria 1821
449 nmdc:mga06r32_268795_c1 3300050510 Bacteria 1693
450 nmdc:mga06r32_270485_c1 3300050510 Bacteria 1687
451 nmdc:mga06r32_40958_c1 3300050510 Bacteria 4400
452 Ga0495601_0004774 3300053077 Bacteria 7860
453 Ga0495619_0175984 3300053085 Bacteria 1480
454 Ga0500559_0007254 3300053136 Bacteria 4924
455 Ga0500585_062864 3300053144 Bacteria 1337
456 Ga0501084_0255599 3300054114 Bacteria 1479
457 Ga0501082_0071920 3300060353 Bacteria 2979
458 Ga0466962_0064494 3300061719 Bacteria 1749
459 2537897781 2537561592 Bacteria 4348607
460 2559430553 2558860280 Bacteria 11429938
461 2585321089 2582581314 Bacteria 11452267
462 2586060168 2585427649 Bacteria 9053857
463 2623501113 2622736605 Bacteria 4992138
464 2645719793 2643221961 Bacteria 3919167
465 2676491332 2675903060 Bacteria 10051191
466 2691513493 2690315906 Bacteria 4517044
467 2739604272 2739367653 Bacteria 2780952
468 2768645732 2767802112 Bacteria 6465194
469 2774904267 2773857933 Bacteria 5818019
470 2775658861 2775506735 Bacteria 4556596
471 2785343821 2784746763 Bacteria 9783172
472 2791916396 2791354901 Bacteria 8322202
473 2795787378 2795385470 Bacteria 8317180
474 2795797758 2795385472 Bacteria 6627535
475 2808830745 2808606357 Bacteria 4466944
476 2808851934 2808606360 Bacteria 4404006
477 2808879754 2808606366 Bacteria 4415912
478 2808890678 2808606370 Bacteria 4942454
479 2808895958 2808606371 Bacteria 4251511
480 2809590845 2808606522 Bacteria 9488490
481 2810363506 2808606700 Bacteria 3482157
482 2812321700 2811994871 Bacteria 4497550
483 2812351207 2811994878 Bacteria 5992952
484 2816503587 2816332139 Bacteria 9138787
485 2817509472 2816332305 Bacteria 2697803
486 2819739153 2818991472 Bacteria 10089953
487 2842137800 2842134933 Bacteria 5847019
488 2844852301 2844849076 Bacteria 4091819
489 2857728853 2857727296 Bacteria 2745552
490 2857743798 2857740372 Bacteria 4782044
491 2862383789 2862382967 Bacteria 10317375
492 2867346907 2867346516 Bacteria 7608576
493 2884700651 2884693830 Bacteria 11273186
494 2891403611 2891395885 Bacteria 9251614
495 2895429228 2895427314 Bacteria 13147766
496 2895452630 2895442618 Bacteria 11027144
497 2899375428 2899370129 Bacteria 6781179
498 2902795781 2902792274 Bacteria 7270173
499 2904499697 2904497146 Bacteria 4731781
500 2904780354 2904776348 Bacteria 4658726
501 2905930275 2905926851 Bacteria 4423176
502 2910814854 2910809715 Bacteria 4982797
503 2915771865 2915768154 Bacteria 8424322
504 2919036150 2919034639 Bacteria 4763403
505 2919060865 2919059106 Bacteria 4991624
506 2919392430 2919391150 Bacteria 4884741
507 2919450770 2919446982 Bacteria 3994487
508 2919538632 2919538618 Bacteria 4677069
509 2920883729 2920879853 Bacteria 4216831
510 2932431097 2932426870 Bacteria 4547726
511 2933419207 2933418574 Bacteria 4476724
512 2939600061 2939598168 Bacteria 4687164
513 2939647874 2939647034 Bacteria 4681660
514 2939679064 2939674588 Bacteria 4844420
515 2945919570 2945916053 Bacteria 4555517
516 2945924519 2945920336 Bacteria 4501603
517 2945943745 2945941187 Bacteria 4682474
518 2945958066 2945956166 Bacteria 5110334
519 2946004064 2946003308 Bacteria 3857229
520 2946025291 2946024296 Bacteria 3508095
521 2946039714 2946037020 Bacteria 4900426
522 2946063292 2946059875 Bacteria 4386623
523 2954000938 2953998280 Bacteria 4812144
524 2966604310 2966598605 Bacteria 7676064
525 2974303214 2974302888 Bacteria 4369871
526 2990092540 2990088156 Bacteria 6657676
527 2995469279 2995463766 Bacteria 8577691
528 3001891666 3001889506 Bacteria 2975194
529 3003002245 3002998708 Bacteria 11715108
530 8003320675 8003314358 Bacteria 10575343
531 8008559963 8008558824 Bacteria 10610750
532 8053947884 8053945823 Bacteria 8962862
533 8054109997 8054107350 Bacteria 5022511
534 8054478331 8054472261 Bacteria 7464355
535 Ga0451793_0363721
536 LJQas_1000961
537 JGI25151J46595_10043310
538 JGI25406J46586_10008402
539 JGI25406J46586_10014525
540 rootL2_10082130
541 Ga0065714_10080987
542 Ga0070690_100179341
543 Ga0068869_100060951
544 Ga0070682_100112461
545 Ga0070668_100011782
546 Ga0070668_100057614
547 Ga0070668_100172839
548 Ga0070674_100068793
549 Ga0070667_100089853
550 Ga0070714_100068185
551 Ga0070714_100080447
552 Ga0070714_100184422
553 Ga0070705_100005182
554 Ga0070663_100053562
555 Ga0070663_100142448
556 Ga0070678_100085102
557 Ga0070685_10169932
558 Ga0070685_10234234
559 Ga0070679_100064586
560 Ga0070684_100327406
561 Ga0070672_100161027
562 Ga0070693_100014380
563 Ga0068855_100070326
564 Ga0070702_100002818
565 Ga0068852_100044706
566 Ga0068852_100142357
567 Ga0068864_100214815
568 Ga0068866_10068924
569 Ga0068866_10182740
570 Ga0068870_10192716
571 Ga0068860_100008451
572 Ga0081455_10000943
573 Ga0081540_1017386
574 Ga0081539_10002043
575 Ga0081539_10003164
576 Ga0075365_10056016
577 Ga0075370_10024829
578 Ga0075428_100006492
579 Ga0075430_100012516
580 Ga0075431_100121330
581 Ga0068865_100123521
582 Ga0105251_10017292
583 Ga0105244_10003957
584 Ga0105245_10086107
585 Ga0105245_10226409
586 Ga0105245_10236676
587 Ga0105245_10299965
588 Ga0105243_10122329
589 Ga0105243_10391386
590 Ga0105242_10021655
591 Ga0105242_10192202
592 Ga0105248_10264530
593 Ga0105238_10095134
594 Ga0105238_10210592
595 Ga0105249_10459046
596 Ga0105239_10281665
597 Ga0105246_10036154
598 Ga0157373_10089850
599 Ga0157369_10016615
600 Ga0157369_10036994
601 Ga0157369_10293198
602 Ga0157372_10252177
603 Ga0157372_10295448
604 Ga0157372_10337989
605 Ga0157375_10198025
606 Ga0163163_10311474
607 Ga0163163_10609751
608 Ga0182008_10120024
609 Ga0157379_10138891
610 Ga0157376_10055886
611 Ga0163161_10071298
612 Ga0163161_10084380
613 Ga0213874_10034046
614 Ga0213876_10076070
615 Ga0213875_10004261
616 Ga0209148_1004226
617 Ga0209129_1000079
618 Ga0209025_1001940
619 Ga0209051_1029172
620 Ga0207655_1009982
621 Ga0207655_1038486
622 Ga0207713_1015442
623 Ga0207688_10002706
624 Ga0207688_10052744
625 Ga0207705_10210999
626 Ga0207654_10071385
627 Ga0207707_10133607
628 Ga0207657_10025823
629 Ga0207652_10046769
630 Ga0207687_10301986
631 Ga0207664_10020667
632 Ga0207664_10133715
633 Ga0207664_10259302
634 Ga0207690_10082894
635 Ga0207706_10030042
636 Ga0207709_10359338
637 Ga0207670_10026648
638 Ga0207704_10085703
639 Ga0207691_10346339
640 Ga0207711_10303274
641 Ga0207689_10209050
642 Ga0207651_10145012
643 Ga0207668_10049588
644 Ga0207640_10095488
645 Ga0207640_10292305
646 Ga0207658_10027588
647 Ga0207639_10136613
648 Ga0207678_10004886
649 Ga0207708_10163533
650 Ga0207641_10064810
651 Ga0207648_10018968
652 Ga0207676_10127953
653 Ga0207675_100007775
654 Ga0207683_10076097
655 Ga0207683_10085389
656 Ga0207683_10102233
657 Ga0207683_10136041
658 Ga0207683_10149331
659 Ga0207698_10013409
660 Ga0207698_10101364
661 Ga0207698_10133906
662 Ga0207698_10258672
663 Ga0207428_10044099
664 Ga0268266_10064805
665 Ga0268265_10141030
666 Ga0268264_10006538
667 Ga0265334_10000839
668 Ga0307511_10000178
669 Ga0265340_10002163
670 Ga0307513_10000483
671 Ga0307408_100004120
672 Ga0307408_100009061
673 Ga0307408_100103084
674 Ga0307408_100218572
675 Ga0307408_100317258
676 Ga0316575_10005231
677 Ga0316579_10000068
678 Ga0316579_10000911
679 Ga0307405_10081338
680 Ga0307405_10318759
681 Ga0316577_10031879
682 Ga0307413_10002160
683 Ga0307413_10012392
684 Ga0307413_10014808
685 Ga0307413_10056178
686 Ga0307413_10072938
687 Ga0307413_10120305
688 Ga0307413_10198050
689 Ga0307518_10001157
690 Ga0307410_10004329
691 Ga0307410_10010835
692 Ga0307410_10021295
693 Ga0307410_10116522
694 Ga0307410_10119439
695 Ga0307410_10133432
696 Ga0307410_10137557
697 Ga0307410_10162813
698 Ga0307410_10320844
699 Ga0307406_10007859
700 Ga0307406_10059366
701 Ga0307406_10089983
702 Ga0307407_10022446
703 Ga0307407_10027376
704 Ga0307407_10279617
705 Ga0307412_10008579
706 Ga0307412_10019428
707 Ga0307412_10028666
708 Ga0307412_10033621
709 Ga0307412_10052894
710 Ga0307412_10094413
711 Ga0307412_10117631
712 Ga0307412_10152405
713 Ga0307409_100001452
714 Ga0307409_100004567
715 Ga0307409_100023925
716 Ga0307409_100046356
717 Ga0307409_100054798
718 Ga0307409_100087962
719 Ga0307409_100159717
720 Ga0307409_100306005
721 Ga0307409_100315416
722 Ga0307409_100348113
723 Ga0307409_100456889
724 Ga0307409_100490476
725 Ga0307416_100010637
726 Ga0307416_100013612
727 Ga0307416_100030566
728 Ga0307416_100036540
729 Ga0307416_100039112
730 Ga0307416_100055478
731 Ga0307416_100058874
732 Ga0307416_100444458
733 Ga0307416_100512021
734 Ga0307414_10007772
735 Ga0307414_10189648
736 Ga0307411_10001113
737 Ga0307411_10009349
738 Ga0307411_10243465
739 Ga0307415_100004735
740 Ga0307415_100005607
741 Ga0307415_100040979
742 Ga0307415_100094349
743 Ga0307415_100147616
744 Ga0307415_100238818
745 Ga0316583_10010282
746 Ga0307507_10115927
747 Ga0316574_0000761
748 Ga0373931_0144883
749 Ga0316582_0010627
750 Ga0316584_0000632
751 Ga0395899_0004671
752 Ga0395899_0041144
753 Ga0395899_0060271
754 Ga0395900_0013355
755 Ga0395898_0009849
756 Ga0395898_0171337
757 Ga0395898_0347520
758 Ga0395905_0062495
759 Ga0395905_0128513
760 Ga0436364_0574476
761 Ga0436364_0661415
762 Ga0395901_0005856
763 Ga0395901_0008568
764 Ga0395901_0017936
765 Ga0395901_0038595
766 Ga0395901_0043071
767 Ga0395901_0059690
768 Ga0395901_0064607
769 Ga0395901_0310286
770 Ga0395901_0542409
771 Ga0395901_0621801
772 Ga0436365_1427323
773 Ga0436363_1541032
774 Ga0439438_013626
775 Ga0439438_029505
776 Ga0439439_0032762
777 Ga0439466_0002535
778 Ga0439465_0001957
779 Ga0439465_0047786
780 Ga0451791_1212074
781 Ga0451797_0188075
782 Ga0451853_1003144
783 Ga0439433_0000016
784 Ga0439433_0008935
785 Ga0439433_0021282
786 Ga0439433_0030950
787 Ga0439442_000124
788 Ga0439442_000483
789 Ga0439442_002655
790 Ga0439442_003189
791 Ga0439442_028579
792 Ga0439432_009769
793 Ga0439432_051947
794 Ga0439449_0000123
795 Ga0439449_0003118
796 Ga0439452_005222
797 Ga0439457_007888
798 Ga0439457_034072
799 Ga0450920_000050
800 Ga0450920_001016
801 Ga0450907_006929
802 Ga0450907_010839
803 Ga0439434_0000220
804 Ga0439434_0007491
805 Ga0450918_000839
806 Ga0466969_0006546
807 Ga0466969_0015025
808 Ga0466969_0022869
809 Ga0466969_0098220
810 Ga0466972_0001567
811 Ga0466972_0092046
812 Ga0466965_0108682
813 Ga0466966_0005827
814 Ga0466966_0018262
815 Ga0466966_0083747
816 Ga0466961_0027971
817 Ga0466961_0058820
818 Ga0466961_0103608
819 Ga0466961_0123057
820 Ga0466963_0059687
821 Ga0466963_0200046
822 Ga0466971_0016447
823 Ga0466971_0053017
824 Ga0466971_0146163
825 Ga0466970_0007657
826 Ga0466970_0055942
827 Ga0466957_0051978
828 Ga0466957_0097356
829 Ga0466957_0228023
830 Ga0466957_0279935
831 Ga0466960_0000756
832 Ga0466960_0012365
833 Ga0466960_0013932
834 Ga0466960_0038220
835 Ga0466959_0000629
836 Ga0466959_0009621
837 Ga0466959_0103208
838 Ga0466959_0118924
839 Ga0466959_0207757
840 Ga0466958_0098800
841 Ga0466967_0086234
842 Ga0466967_0333319
843 Ga0495592_0023860
844 Ga0495603_0024041
845 Ga0495629_0046524
846 Ga0495629_0082825
847 Ga0495651_0002482
848 Ga0495653_0047560
849 Ga0495580_0003950
850 Ga0495582_0083770
851 Ga0495582_0141430
852 Ga0495639_0005295
853 Ga0495662_0082159
854 Ga0495664_0187562
855 Ga0495596_0043833
856 Ga0495608_0002796
857 Ga0495631_0038243
858 Ga0495666_0002641
859 Ga0495652_0124385
860 Ga0495665_0001040
861 Ga0495640_0110091
862 Ga0495586_0002370
863 Ga0495586_0033512
864 Ga0495587_0031907
865 Ga0495645_0071585
866 Ga0495667_0021585
867 Ga0495656_0015435
868 Ga0495635_0077798
869 Ga0495635_0138947
870 Ga0495588_0165833
871 Ga0495657_0004136
872 Ga0495657_0044557
873 Ga0495599_0139708
874 Ga0495623_0006053
875 Ga0495646_0049066
876 Ga0495613_0006145
877 Ga0495613_0043003
878 Ga0495589_0068218
879 Ga0495600_0029405
880 Ga0495581_0023809
881 Ga0495604_0001984
882 Ga0495636_0017549
883 Ga0495674_0062810
884 Ga0495675_0003933
885 Ga0495675_0025626
886 Ga0495684_0007710
887 Ga0495593_0057489
888 Ga0495593_0058436
889 Ga0495602_0170865
890 Ga0496100_0347967
891 Ga0496101_0011629
892 Ga0496102_0001262
893 Ga0496102_0018154
894 Ga0496102_0041908
895 Ga0496102_0108007
896 Ga0496102_0147732
897 Ga0496102_0164764
898 Ga0496102_0223087
899 Ga0496102_0338437
900 Ga0496103_0003834
901 Ga0496103_0009925
902 Ga0496103_0167609
903 Ga0496104_0180390
904 Ga0496105_0027464
905 Ga0496105_0040013
906 Ga0496105_0212848
907 Ga0496106_0357295
908 Ga0496108_0002365
909 Ga0496108_0023395
910 Ga0496108_0041946
911 Ga0496108_0056279
912 Ga0496108_0078585
913 Ga0496108_0107070
914 Ga0496108_0353777
915 Ga0496109_0007600
916 Ga0496109_0091679
917 Ga0496109_0169991
918 Ga0496109_0374687
919 Ga0496109_0382811
920 Ga0496110_0014191
921 Ga0496110_0034049
922 Ga0496110_0059203
923 Ga0496110_0175374
924 Ga0496111_0015138
925 Ga0496111_0028661
926 Ga0496111_0130685
927 Ga0496112_0002045
928 Ga0496112_0036117
929 Ga0496112_0229330
930 Ga0496113_0032171
931 Ga0496113_0317043
932 Ga0496114_0001123
933 Ga0496114_0001926
934 Ga0496114_0018859
935 Ga0496114_0043299
936 Ga0496114_0130171
937 Ga0496114_0155987
938 Ga0496114_0177605
939 Ga0496115_0263481
940 Ga0501031_0040543
941 Ga0501032_0001718
942 Ga0501032_0001836
943 Ga0501032_0027847
944 Ga0501032_0055765
945 Ga0501033_0057771
946 Ga0501034_0000015
947 Ga0501036_0031416
948 Ga0501036_0066359
949 Ga0501037_0002004
950 Ga0501037_0023193
951 Ga0501037_0080941
952 Ga0501037_0227242
953 Ga0501038_0021928
954 Ga0501039_0042291
955 Ga0501041_0038989
956 Ga0501042_0038377
957 Ga0501042_0050137
958 Ga0501043_0009496
959 Ga0501043_0009509
960 Ga0501043_0033398
961 Ga0501047_0000268
962 Ga0501047_0017765
963 Ga0501048_0098209
964 Ga0501070_0011458
965 Ga0501071_0055806
966 Ga0501072_0385030
967 Ga0501074_0023083
968 Ga0501076_0060741
969 Ga0501077_0048182
970 Ga0501080_0346850
971 Ga0501035_0052290
972 Ga0501035_0115135
973 Ga0501044_0104540
974 Ga0501044_0335371
975 Ga0501045_0071558
976 Ga0501045_0077705
977 nmdc:mga0yw44_79175_c1
978 nmdc:mga06z11_85768_c1
979 nmdc:mga07m45_22297_c1
980 nmdc:mga05p37_128689_c1
981 nmdc:mga05p37_65173_c1
982 nmdc:mga09592_181541_c1
983 nmdc:mga06r32_268795_c1
984 nmdc:mga06r32_270485_c1
985 nmdc:mga06r32_40958_c1
986 Ga0495601_0004774
987 Ga0495619_0175984
988 Ga0500559_0007254
989 Ga0500585_062864
990 Ga0501084_0255599
991 Ga0501082_0071920
992 Ga0466962_0064494
993 2537897781
994 2559430553
995 2585321089
996 2586060168
997 2623501113
998 2645719793
999 2676491332
1000 2691513493
1001 2739604272
1002 2768645732
1003 2774904267
1004 2775658861
1005 2785343821
1006 2791916396
1007 2795787378
1008 2795797758
1009 2808830745
1010 2808851934
1011 2808879754
1012 2808890678
1013 2808895958
1014 2809590845
1015 2810363506
1016 2812321700
1017 2812351207
1018 2816503587
1019 2817509472
1020 2819739153
1021 2842137800
1022 2844852301
1023 2857728853
1024 2857743798
1025 2862383789
1026 2867346907
1027 2884700651
1028 2891403611
1029 2895429228
1030 2895452630
1031 2899375428
1032 2902795781
1033 2904499697
1034 2904780354
1035 2905930275
1036 2910814854
1037 2915771865
1038 2919036150
1039 2919060865
1040 2919392430
1041 2919450770
1042 2919538632
1043 2920883729
1044 2932431097
1045 2933419207
1046 2939600061
1047 2939647874
1048 2939679064
1049 2945919570
1050 2945924519
1051 2945943745
1052 2945958066
1053 2946004064
1054 2946025291
1055 2946039714
1056 2946063292
1057 2954000938
1058 2966604310
1059 2974303214
1060 2990092540
1061 2995469279
1062 3001891666
1063 3003002245
1064 8003320675
1065 8008559963
1066 8053947884
1067 8054109997
1068 8054478331

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

190

354

1

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

48

180

0.97

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

199

357

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7npj-assembly2.cif.gz_F crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine 0.9671 2 343
7npj-assembly2.cif.gz_F crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine 0.9616 2 343
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9454 1 343
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9435 1 343
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9434 2 343
ID Description Score Start End Superfamily
af_P9WPZ9_6_155_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9849 2 143 3.40.50.720
2nqtA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.97 2 143 3.40.50.720
af_P9WPZ9_10_289_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9669 4 280 3.50.50.60
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9657 144 310 3.30.360.10
af_I1KL32_193_359_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.956 144 310 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A5N5VZW7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9986 1 148 GO:0006526
GO:0016620
GO:0051287
AF-A0A3B0AYM5-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9972 1 165 GO:0003942
GO:0006526
GO:0051287
AF-A0A359FCN8-F1-model_v4 deleted 0.9936 1 122
AF-A0A1P8YGV8-F1-model_v4 Semialdehyde dehydrogenase, NAD binding domain protein 0.9925 2 157 GO:0003942
GO:0006526
GO:0051287
AF-A0A5N5VZW7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9919 1 148 GO:0006526
GO:0016620
GO:0051287

Map