F460542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 316 | 499 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10074827|Ga0182007_100748272 |
| Length | 290 |
| Sequence | MATGKEIRSKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYSDKIRNIASNLSQANPEYTHPFMVKQDNSKNVGFIVVTTDKGLCGGMNTNSLRLLTAKLRELEGQGNKVQAVAIGNKGLGFLHRIGAKVVAHAVQLGDTPHLDKLIGPVKVLLDAYQEGRLDAVYLVYTKFINTMKQEPMLQQLLPLSSDRLEADKEGSHSWDYIYEPDVQSVIDELLVRYVEALIYQAVAENMASEQSARMVAMKSASDNAGNVIGELKLVYNKTRQAAITKELSEIVAGAAAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 5 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 6 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 7 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 8 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 9 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 10 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 11 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 12 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 13 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 14 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 15 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 16 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 17 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 18 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 19 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 20 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 21 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 22 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 23 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 24 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 25 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 26 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 27 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 28 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 29 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 30 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 31 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 32 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 33 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 34 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 35 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 36 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 37 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 38 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 39 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 40 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 41 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 42 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 43 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 44 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 45 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 46 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 47 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 103 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 171 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 189 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 190 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 194 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 195 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 196 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 197 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 311 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 312 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 313 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.45 |
| Metatranscriptomes | 3 |
| Isolates | 6.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.68 |
| Nodule | 0.37 |
| Rhizoplane | 2.43 |
| Rhizosphere | 80.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2253570 | 2162886007 | Bacteria | 2247 |
| 2 | JGI25156J39149_1013055 | 3300002705 | Bacteria | 1786 |
| 3 | JGI25162J39368_1004905 | 3300002737 | Bacteria | 2866 |
| 4 | JGI25157J39369_1003315 | 3300002741 | Bacteria | 3342 |
| 5 | JGI25150J39212_1002629 | 3300002774 | Bacteria | 4410 |
| 6 | Ga0006759J45824_1023789 | 3300003163 | Bacteria | 5943 |
| 7 | JGI25151J46595_10033725 | 3300003187 | Bacteria | 1967 |
| 8 | Ga0007410J51695_1012491 | 3300003574 | Bacteria | 7287 |
| 9 | Ga0007409J51694_1005570 | 3300003575 | Bacteria | 8896 |
| 10 | Ga0007409J51694_1010509 | 3300003575 | Bacteria | 1788 |
| 11 | Ga0007416J51690_1018405 | 3300003577 | Bacteria | 5758 |
| 12 | Ga0032354_1014770 | 3300003693 | Bacteria | 7120 |
| 13 | Ga0055538_1000789 | 3300003751 | Bacteria | 8797 |
| 14 | Ga0055539_1000685 | 3300003752 | Bacteria | 8797 |
| 15 | Ga0055533_1000922 | 3300003756 | Bacteria | 8797 |
| 16 | Ga0055532_1000130 | 3300003758 | Bacteria | 74140 |
| 17 | Ga0055525_1000057 | 3300003759 | Bacteria | 211185 |
| 18 | Ga0055525_1000869 | 3300003759 | Bacteria | 8797 |
| 19 | Ga0055526_1000812 | 3300003771 | Bacteria | 23272 |
| 20 | Ga0055541_1000684 | 3300003841 | Bacteria | 8797 |
| 21 | Ga0070658_10320945 | 3300005327 | Bacteria | 1322 |
| 22 | Ga0070670_100096928 | 3300005331 | Bacteria | 2537 |
| 23 | Ga0070670_100186620 | 3300005331 | Bacteria | 1800 |
| 24 | Ga0070670_100199869 | 3300005331 | Bacteria | 1737 |
| 25 | Ga0070670_100241510 | 3300005331 | Bacteria | 1572 |
| 26 | Ga0068869_100006248 | 3300005334 | Bacteria | 7545 |
| 27 | Ga0070682_100004311 | 3300005337 | Bacteria | 7899 |
| 28 | Ga0068868_100196094 | 3300005338 | Bacteria | 1681 |
| 29 | Ga0070660_100005023 | 3300005339 | Bacteria | 9144 |
| 30 | Ga0070687_100089131 | 3300005343 | Bacteria | 1702 |
| 31 | Ga0070661_100004150 | 3300005344 | Bacteria | 9993 |
| 32 | Ga0070661_100189435 | 3300005344 | Bacteria | 1568 |
| 33 | Ga0070661_100227193 | 3300005344 | Bacteria | 1433 |
| 34 | Ga0070675_100116592 | 3300005354 | Bacteria | 2265 |
| 35 | Ga0070675_100173927 | 3300005354 | Bacteria | 1858 |
| 36 | Ga0070675_100250703 | 3300005354 | Bacteria | 1549 |
| 37 | Ga0070671_100119610 | 3300005355 | Bacteria | 2216 |
| 38 | Ga0070671_100183725 | 3300005355 | Bacteria | 1771 |
| 39 | Ga0070671_100339946 | 3300005355 | Bacteria | 1280 |
| 40 | Ga0070673_100088990 | 3300005364 | Bacteria | 2519 |
| 41 | Ga0070673_100224676 | 3300005364 | Bacteria | 1627 |
| 42 | Ga0070659_100093181 | 3300005366 | Bacteria | 2417 |
| 43 | Ga0070663_100057949 | 3300005455 | Bacteria | 2780 |
| 44 | Ga0070678_100231926 | 3300005456 | Bacteria | 1539 |
| 45 | Ga0070678_100355931 | 3300005456 | Bacteria | 1260 |
| 46 | Ga0070662_100276359 | 3300005457 | Bacteria | 1358 |
| 47 | Ga0068867_100029088 | 3300005459 | Bacteria | 3981 |
| 48 | Ga0068853_100295498 | 3300005539 | Bacteria | 1496 |
| 49 | Ga0070672_100072428 | 3300005543 | Bacteria | 2743 |
| 50 | Ga0070672_100074874 | 3300005543 | Bacteria | 2701 |
| 51 | Ga0070672_100369350 | 3300005543 | Bacteria | 1225 |
| 52 | Ga0068855_100153371 | 3300005563 | Bacteria | 2618 |
| 53 | Ga0068857_100021833 | 3300005577 | Bacteria | 5633 |
| 54 | Ga0068854_100027132 | 3300005578 | Bacteria | 3944 |
| 55 | Ga0068856_100214586 | 3300005614 | Bacteria | 1940 |
| 56 | Ga0068852_100127644 | 3300005616 | Bacteria | 2338 |
| 57 | Ga0068852_100465649 | 3300005616 | Bacteria | 1254 |
| 58 | Ga0068864_100096910 | 3300005618 | Bacteria | 2611 |
| 59 | Ga0068864_100158444 | 3300005618 | Bacteria | 2056 |
| 60 | Ga0068864_100265661 | 3300005618 | Bacteria | 1597 |
| 61 | Ga0068851_10061043 | 3300005834 | Bacteria | 1931 |
| 62 | Ga0068851_10088823 | 3300005834 | Bacteria | 1625 |
| 63 | Ga0068870_10150755 | 3300005840 | Bacteria | 1369 |
| 64 | Ga0068863_100225639 | 3300005841 | Bacteria | 1806 |
| 65 | Ga0070712_100074634 | 3300006175 | Bacteria | 2437 |
| 66 | Ga0075366_10154589 | 3300006195 | Bacteria | 1389 |
| 67 | Ga0097621_100311852 | 3300006237 | Bacteria | 1392 |
| 68 | Ga0075370_10090261 | 3300006353 | Bacteria | 1767 |
| 69 | Ga0068865_100103803 | 3300006881 | Bacteria | 2085 |
| 70 | Ga0105251_10031554 | 3300009011 | Bacteria | 2649 |
| 71 | Ga0105240_10016732 | 3300009093 | Bacteria | 9920 |
| 72 | Ga0105240_10019169 | 3300009093 | Bacteria | 9147 |
| 73 | Ga0105240_10285223 | 3300009093 | Bacteria | 1895 |
| 74 | Ga0105245_10371155 | 3300009098 | Bacteria | 1422 |
| 75 | Ga0105243_10218372 | 3300009148 | Bacteria | 1683 |
| 76 | Ga0105242_10001267 | 3300009176 | Bacteria | 19954 |
| 77 | Ga0105248_10000345 | 3300009177 | Bacteria | 54458 |
| 78 | Ga0105248_10252864 | 3300009177 | Bacteria | 1983 |
| 79 | Ga0105238_10000038 | 3300009551 | Bacteria | 162920 |
| 80 | Ga0105238_10027954 | 3300009551 | Bacteria | 5747 |
| 81 | Ga0105238_10381565 | 3300009551 | Bacteria | 1401 |
| 82 | Ga0105239_10000303 | 3300010375 | Bacteria | 72769 |
| 83 | Ga0105239_10926396 | 3300010375 | Bacteria | 1000 |
| 84 | Ga0157369_10228373 | 3300013105 | Bacteria | 1946 |
| 85 | Ga0157374_10149588 | 3300013296 | Bacteria | 2269 |
| 86 | Ga0157374_10312513 | 3300013296 | Bacteria | 1556 |
| 87 | Ga0157378_10167028 | 3300013297 | Bacteria | 2062 |
| 88 | Ga0163162_10389945 | 3300013306 | Bacteria | 1525 |
| 89 | Ga0163162_10768915 | 3300013306 | Bacteria | 1082 |
| 90 | Ga0157375_10635165 | 3300013308 | Bacteria | 1225 |
| 91 | Ga0157375_10786323 | 3300013308 | Bacteria | 1101 |
| 92 | Ga0157380_10081632 | 3300014326 | Bacteria | 2645 |
| 93 | Ga0182008_10012205 | 3300014497 | Bacteria | 4540 |
| 94 | Ga0157376_10379363 | 3300014969 | Bacteria | 1361 |
| 95 | Ga0182006_1013512 | 3300015261 | Bacteria | 3541 |
| 96 | Ga0182007_10074827 | 3300015262 | Bacteria | 1110 |
| 97 | Ga0163161_10087909 | 3300017792 | Bacteria | 2296 |
| 98 | Ga0213872_10000122 | 3300021361 | Bacteria | 73335 |
| 99 | Ga0213872_10000383 | 3300021361 | Bacteria | 37014 |
| 100 | Ga0213872_10001440 | 3300021361 | Bacteria | 15506 |
| 101 | Ga0213872_10064024 | 3300021361 | Bacteria | 1661 |
| 102 | Ga0209435_100046 | 3300025206 | Bacteria | 95081 |
| 103 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 104 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 105 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 106 | Ga0209147_100157 | 3300025229 | Bacteria | 92005 |
| 107 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 108 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 109 | Ga0209437_100260 | 3300025233 | Bacteria | 82215 |
| 110 | Ga0209258_100768 | 3300025242 | Bacteria | 19750 |
| 111 | Ga0207425_1000200 | 3300025245 | Bacteria | 47894 |
| 112 | Ga0209646_1000156 | 3300025246 | Bacteria | 95083 |
| 113 | Ga0209646_1004576 | 3300025246 | Bacteria | 2501 |
| 114 | Ga0209026_1000966 | 3300025250 | Bacteria | 14332 |
| 115 | Ga0209026_1009580 | 3300025250 | Bacteria | 1888 |
| 116 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 117 | Ga0209759_1006432 | 3300025256 | Bacteria | 3945 |
| 118 | Ga0209759_1013237 | 3300025256 | Bacteria | 2242 |
| 119 | Ga0209129_1000113 | 3300025258 | Bacteria | 145178 |
| 120 | Ga0209455_1004795 | 3300025272 | Bacteria | 4329 |
| 121 | Ga0209673_1032710 | 3300025273 | Bacteria | 1599 |
| 122 | Ga0209564_1000186 | 3300025295 | Bacteria | 147120 |
| 123 | Ga0209758_1000172 | 3300025297 | Bacteria | 147763 |
| 124 | Ga0209256_1017807 | 3300025299 | Bacteria | 2340 |
| 125 | Ga0209257_1036451 | 3300025304 | Bacteria | 1510 |
| 126 | Ga0207697_10081534 | 3300025315 | Bacteria | 1363 |
| 127 | Ga0207656_10099140 | 3300025321 | Bacteria | 1333 |
| 128 | Ga0207713_1017647 | 3300025735 | Bacteria | 3567 |
| 129 | Ga0207688_10067100 | 3300025901 | Bacteria | 2030 |
| 130 | Ga0207688_10099218 | 3300025901 | Bacteria | 1680 |
| 131 | Ga0207680_10157647 | 3300025903 | Bacteria | 1519 |
| 132 | Ga0207645_10001670 | 3300025907 | Bacteria | 18048 |
| 133 | Ga0207643_10091435 | 3300025908 | Bacteria | 1775 |
| 134 | Ga0207695_10002989 | 3300025913 | Bacteria | 24306 |
| 135 | Ga0207695_10005091 | 3300025913 | Bacteria | 17616 |
| 136 | Ga0207695_10069594 | 3300025913 | Bacteria | 3601 |
| 137 | Ga0207671_10003973 | 3300025914 | Bacteria | 14375 |
| 138 | Ga0207693_10087277 | 3300025915 | Bacteria | 2444 |
| 139 | Ga0207662_10072849 | 3300025918 | Bacteria | 2083 |
| 140 | Ga0207657_10037075 | 3300025919 | Bacteria | 4359 |
| 141 | Ga0207657_10122110 | 3300025919 | Bacteria | 2143 |
| 142 | Ga0207649_10142022 | 3300025920 | Bacteria | 1644 |
| 143 | Ga0207681_10233323 | 3300025923 | Bacteria | 1429 |
| 144 | Ga0207694_10000126 | 3300025924 | Bacteria | 79243 |
| 145 | Ga0207650_10044775 | 3300025925 | Bacteria | 3253 |
| 146 | Ga0207650_10179470 | 3300025925 | Bacteria | 1687 |
| 147 | Ga0207659_10039375 | 3300025926 | Bacteria | 3296 |
| 148 | Ga0207659_10144227 | 3300025926 | Bacteria | 1852 |
| 149 | Ga0207644_10011700 | 3300025931 | Bacteria | 5809 |
| 150 | Ga0207644_10090202 | 3300025931 | Bacteria | 2283 |
| 151 | Ga0207644_10279324 | 3300025931 | Bacteria | 1340 |
| 152 | Ga0207644_10332034 | 3300025931 | Bacteria | 1231 |
| 153 | Ga0207644_10385545 | 3300025931 | Bacteria | 1143 |
| 154 | Ga0207690_10019191 | 3300025932 | Bacteria | 4204 |
| 155 | Ga0207706_10278658 | 3300025933 | Bacteria | 1458 |
| 156 | Ga0207706_10311251 | 3300025933 | Bacteria | 1371 |
| 157 | Ga0207686_10001312 | 3300025934 | Bacteria | 14245 |
| 158 | Ga0207709_10217485 | 3300025935 | Bacteria | 1376 |
| 159 | Ga0207669_10268778 | 3300025937 | Bacteria | 1279 |
| 160 | Ga0207704_10057802 | 3300025938 | Bacteria | 2385 |
| 161 | Ga0207691_10020222 | 3300025940 | Bacteria | 6296 |
| 162 | Ga0207691_10111276 | 3300025940 | Bacteria | 2435 |
| 163 | Ga0207691_10230160 | 3300025940 | Bacteria | 1605 |
| 164 | Ga0207711_10003063 | 3300025941 | Bacteria | 14599 |
| 165 | Ga0207689_10097654 | 3300025942 | Bacteria | 2413 |
| 166 | Ga0207679_10176435 | 3300025945 | Bacteria | 1764 |
| 167 | Ga0207679_10209350 | 3300025945 | Bacteria | 1634 |
| 168 | Ga0207667_10023820 | 3300025949 | Bacteria | 6737 |
| 169 | Ga0207668_10155440 | 3300025972 | Bacteria | 1776 |
| 170 | Ga0207668_10176071 | 3300025972 | Bacteria | 1683 |
| 171 | Ga0207658_10443187 | 3300025986 | Bacteria | 1148 |
| 172 | Ga0207677_10047287 | 3300026023 | Bacteria | 2888 |
| 173 | Ga0207677_10061609 | 3300026023 | Bacteria | 2599 |
| 174 | Ga0207678_10178930 | 3300026067 | Bacteria | 1811 |
| 175 | Ga0207702_10209051 | 3300026078 | Bacteria | 1813 |
| 176 | Ga0207702_10345580 | 3300026078 | Bacteria | 1422 |
| 177 | Ga0207641_10107360 | 3300026088 | Bacteria | 2469 |
| 178 | Ga0207641_10457619 | 3300026088 | Bacteria | 1234 |
| 179 | Ga0207648_10041042 | 3300026089 | Bacteria | 4064 |
| 180 | Ga0207676_10076966 | 3300026095 | Bacteria | 2697 |
| 181 | Ga0207674_10025311 | 3300026116 | Bacteria | 6333 |
| 182 | Ga0207683_10206485 | 3300026121 | Bacteria | 1787 |
| 183 | Ga0207683_10284790 | 3300026121 | Bacteria | 1510 |
| 184 | Ga0207683_10427586 | 3300026121 | Bacteria | 1220 |
| 185 | Ga0207698_10005617 | 3300026142 | Bacteria | 7763 |
| 186 | Ga0207698_10352119 | 3300026142 | Bacteria | 1391 |
| 187 | Ga0207698_10450556 | 3300026142 | Bacteria | 1242 |
| 188 | Ga0209974_10006131 | 3300027876 | Bacteria | 4211 |
| 189 | Ga0268266_10143438 | 3300028379 | Bacteria | 2145 |
| 190 | Ga0307517_10017098 | 3300028786 | Bacteria | 9474 |
| 191 | Ga0307515_10083575 | 3300028794 | Bacteria | 4113 |
| 192 | Ga0316178_1077577 | 3300030735 | Bacteria | 2246 |
| 193 | Ga0316180_1184120 | 3300030736 | Bacteria | 1399 |
| 194 | Ga0265331_10019062 | 3300031250 | Bacteria | 3546 |
| 195 | Ga0265327_10000444 | 3300031251 | Bacteria | 74908 |
| 196 | Ga0307513_10117942 | 3300031456 | Bacteria | 2630 |
| 197 | Ga0307513_10283324 | 3300031456 | Bacteria | 1433 |
| 198 | Ga0307509_10082422 | 3300031507 | Bacteria | 3318 |
| 199 | Ga0307408_100103678 | 3300031548 | Bacteria | 2172 |
| 200 | Ga0307408_100275657 | 3300031548 | Bacteria | 1398 |
| 201 | Ga0307508_10000134 | 3300031616 | Bacteria | 87501 |
| 202 | Ga0307508_10000524 | 3300031616 | Bacteria | 45505 |
| 203 | Ga0307514_10136187 | 3300031649 | Bacteria | 1680 |
| 204 | Ga0307516_10125492 | 3300031730 | Bacteria | 2352 |
| 205 | Ga0307405_10063158 | 3300031731 | Bacteria | 2347 |
| 206 | Ga0307405_10377228 | 3300031731 | Bacteria | 1103 |
| 207 | Ga0307416_100048983 | 3300032002 | Bacteria | 3356 |
| 208 | Ga0307416_100330304 | 3300032002 | Bacteria | 1532 |
| 209 | Ga0307510_10005730 | 3300033180 | Bacteria | 14803 |
| 210 | Ga0373935_0142955 | 3300035692 | Bacteria | 1618 |
| 211 | Ga0395899_0257708 | 3300037312 | Bacteria | 1194 |
| 212 | Ga0395900_0191021 | 3300037418 | Bacteria | 2077 |
| 213 | Ga0395900_0244956 | 3300037418 | Bacteria | 1796 |
| 214 | Ga0395900_0412592 | 3300037418 | Bacteria | 1312 |
| 215 | Ga0395905_0004181 | 3300037471 | Bacteria | 15097 |
| 216 | Ga0395905_0004203 | 3300037471 | Bacteria | 15072 |
| 217 | Ga0395905_0013567 | 3300037471 | Bacteria | 7806 |
| 218 | Ga0395905_0502160 | 3300037471 | Bacteria | 1113 |
| 219 | Ga0436361_0004183 | 3300039447 | Bacteria | 8394 |
| 220 | Ga0436361_0066651 | 3300039447 | Bacteria | 2993 |
| 221 | Ga0436361_0108001 | 3300039447 | Bacteria | 112244 |
| 222 | Ga0436361_0264437 | 3300039447 | Bacteria | 60444 |
| 223 | Ga0436361_0619669 | 3300039447 | Bacteria | 2501 |
| 224 | Ga0436361_0709165 | 3300039447 | Bacteria | 3379 |
| 225 | Ga0436361_0813098 | 3300039447 | Bacteria | 136133 |
| 226 | Ga0439436_0017201 | 3300041404 | Bacteria | 2164 |
| 227 | Ga0439436_0022428 | 3300041404 | Bacteria | 1870 |
| 228 | Ga0439439_0016591 | 3300041406 | Bacteria | 1805 |
| 229 | Ga0439466_0021347 | 3300041411 | Bacteria | 2296 |
| 230 | Ga0439431_0032607 | 3300041997 | Bacteria | 1299 |
| 231 | Ga0439445_0024840 | 3300042004 | Bacteria | 1525 |
| 232 | Ga0439432_054416 | 3300042006 | Bacteria | 1243 |
| 233 | Ga0439452_031484 | 3300042010 | Bacteria | 1301 |
| 234 | Ga0450894_004078 | 3300042131 | Bacteria | 1906 |
| 235 | Ga0450898_018864 | 3300042134 | Bacteria | 1198 |
| 236 | Ga0450906_013385 | 3300042145 | Bacteria | 1511 |
| 237 | Ga0466972_0000825 | 3300044658 | Bacteria | 14821 |
| 238 | Ga0466972_0030647 | 3300044658 | Bacteria | 2647 |
| 239 | Ga0466972_0091952 | 3300044658 | Bacteria | 1438 |
| 240 | Ga0466965_0000541 | 3300044683 | Bacteria | 13647 |
| 241 | Ga0466965_0032455 | 3300044683 | Bacteria | 2550 |
| 242 | Ga0466970_0067315 | 3300044765 | Bacteria | 1923 |
| 243 | Ga0466957_0101619 | 3300044842 | Bacteria | 1813 |
| 244 | Ga0466959_0202289 | 3300045049 | Bacteria | 1382 |
| 245 | Ga0495617_000179 | 3300046452 | Bacteria | 40095 |
| 246 | Ga0495617_000885 | 3300046452 | Bacteria | 14097 |
| 247 | Ga0495627_022240 | 3300046453 | Bacteria | 2088 |
| 248 | Ga0495592_0000320 | 3300046454 | Bacteria | 40220 |
| 249 | Ga0495592_0143691 | 3300046454 | Bacteria | 1657 |
| 250 | Ga0495603_0199056 | 3300046455 | Bacteria | 1158 |
| 251 | Ga0495590_0000072 | 3300046457 | Bacteria | 70857 |
| 252 | Ga0495629_0090529 | 3300046459 | Bacteria | 2134 |
| 253 | Ga0495638_0007395 | 3300046460 | Bacteria | 7882 |
| 254 | Ga0495651_0145136 | 3300046462 | Bacteria | 1716 |
| 255 | Ga0495653_0136138 | 3300046463 | Bacteria | 1732 |
| 256 | Ga0495653_0309645 | 3300046463 | Bacteria | 1027 |
| 257 | Ga0495580_0032566 | 3300046472 | Bacteria | 3761 |
| 258 | Ga0495580_0239858 | 3300046472 | Bacteria | 1243 |
| 259 | Ga0495582_0054210 | 3300046473 | Bacteria | 2212 |
| 260 | Ga0495582_0334435 | 3300046473 | Bacteria | 872 |
| 261 | Ga0495605_0000400 | 3300046474 | Bacteria | 39776 |
| 262 | Ga0495605_0039256 | 3300046474 | Bacteria | 2372 |
| 263 | Ga0495605_0107058 | 3300046474 | Bacteria | 1279 |
| 264 | Ga0495639_0047574 | 3300046475 | Bacteria | 1944 |
| 265 | Ga0495584_0000001 | 3300046491 | Bacteria | 649329 |
| 266 | Ga0495584_0000434 | 3300046491 | Bacteria | 28794 |
| 267 | Ga0495584_0036935 | 3300046491 | Bacteria | 2467 |
| 268 | Ga0495584_0039249 | 3300046491 | Bacteria | 2392 |
| 269 | Ga0495584_0049269 | 3300046491 | Bacteria | 2122 |
| 270 | Ga0495584_0056432 | 3300046491 | Bacteria | 1976 |
| 271 | Ga0495584_0069936 | 3300046491 | Bacteria | 1764 |
| 272 | Ga0495584_0182030 | 3300046491 | Bacteria | 1068 |
| 273 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 274 | Ga0495585_0000026 | 3300046492 | Bacteria | 148243 |
| 275 | Ga0495585_0002790 | 3300046492 | Bacteria | 12176 |
| 276 | Ga0495585_0006880 | 3300046492 | Bacteria | 7009 |
| 277 | Ga0495585_0013940 | 3300046492 | Bacteria | 4695 |
| 278 | Ga0495585_0022958 | 3300046492 | Bacteria | 3581 |
| 279 | Ga0495585_0024985 | 3300046492 | Bacteria | 3424 |
| 280 | Ga0495585_0032845 | 3300046492 | Bacteria | 2938 |
| 281 | Ga0495585_0054879 | 3300046492 | Bacteria | 2202 |
| 282 | Ga0495585_0061007 | 3300046492 | Bacteria | 2074 |
| 283 | Ga0495585_0115671 | 3300046492 | Bacteria | 1422 |
| 284 | Ga0495585_0237037 | 3300046492 | Bacteria | 915 |
| 285 | Ga0495594_0000459 | 3300046499 | Bacteria | 20756 |
| 286 | Ga0495594_0020790 | 3300046499 | Bacteria | 3498 |
| 287 | Ga0495596_0000149 | 3300046500 | Bacteria | 48579 |
| 288 | Ga0495596_0008791 | 3300046500 | Bacteria | 4471 |
| 289 | Ga0495596_0011580 | 3300046500 | Bacteria | 3797 |
| 290 | Ga0495596_0012741 | 3300046500 | Bacteria | 3588 |
| 291 | Ga0495596_0025299 | 3300046500 | Bacteria | 2400 |
| 292 | Ga0495596_0053807 | 3300046500 | Bacteria | 1575 |
| 293 | Ga0495607_0024066 | 3300046501 | Bacteria | 3801 |
| 294 | Ga0495607_0086222 | 3300046501 | Bacteria | 1712 |
| 295 | Ga0495607_0110230 | 3300046501 | Bacteria | 1460 |
| 296 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 297 | Ga0495583_0015888 | 3300046506 | Bacteria | 4072 |
| 298 | Ga0495606_0003300 | 3300046507 | Bacteria | 17230 |
| 299 | Ga0495606_0011711 | 3300046507 | Bacteria | 7119 |
| 300 | Ga0495606_0013480 | 3300046507 | Bacteria | 6451 |
| 301 | Ga0495606_0056394 | 3300046507 | Bacteria | 2536 |
| 302 | Ga0495608_0009994 | 3300046511 | Bacteria | 6623 |
| 303 | Ga0495610_0000400 | 3300046512 | Bacteria | 45021 |
| 304 | Ga0495616_0000616 | 3300046513 | Bacteria | 26772 |
| 305 | Ga0495616_0004636 | 3300046513 | Bacteria | 8631 |
| 306 | Ga0495616_0024211 | 3300046513 | Bacteria | 3258 |
| 307 | Ga0495616_0041061 | 3300046513 | Bacteria | 2361 |
| 308 | Ga0495616_0050622 | 3300046513 | Bacteria | 2076 |
| 309 | Ga0495616_0051322 | 3300046513 | Bacteria | 2057 |
| 310 | Ga0495618_0189665 | 3300046514 | Bacteria | 1304 |
| 311 | Ga0495620_0003122 | 3300046515 | Bacteria | 9516 |
| 312 | Ga0495628_0009618 | 3300046516 | Bacteria | 8248 |
| 313 | Ga0495631_0050460 | 3300046518 | Bacteria | 1819 |
| 314 | Ga0495632_0000447 | 3300046519 | Bacteria | 39298 |
| 315 | Ga0495632_0006352 | 3300046519 | Bacteria | 7623 |
| 316 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 317 | Ga0495643_0006229 | 3300046522 | Bacteria | 7910 |
| 318 | Ga0495643_0038091 | 3300046522 | Bacteria | 2634 |
| 319 | Ga0495644_0005175 | 3300046523 | Bacteria | 5104 |
| 320 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 321 | Ga0495648_0000451 | 3300046524 | Bacteria | 44465 |
| 322 | Ga0495648_0075765 | 3300046524 | Bacteria | 1934 |
| 323 | Ga0495648_0083888 | 3300046524 | Bacteria | 1804 |
| 324 | Ga0495663_0033585 | 3300046525 | Bacteria | 1532 |
| 325 | Ga0495663_0050747 | 3300046525 | Bacteria | 1283 |
| 326 | Ga0495666_0004810 | 3300046526 | Bacteria | 6827 |
| 327 | Ga0495666_0031370 | 3300046526 | Bacteria | 2604 |
| 328 | Ga0495666_0041586 | 3300046526 | Bacteria | 2225 |
| 329 | Ga0495666_0041664 | 3300046526 | Bacteria | 2223 |
| 330 | Ga0495666_0042326 | 3300046526 | Bacteria | 2202 |
| 331 | Ga0495666_0068890 | 3300046526 | Bacteria | 1684 |
| 332 | Ga0495642_0005181 | 3300046528 | Bacteria | 5014 |
| 333 | Ga0495642_0012390 | 3300046528 | Bacteria | 3287 |
| 334 | Ga0495642_0017412 | 3300046528 | Bacteria | 2807 |
| 335 | Ga0495642_0028012 | 3300046528 | Bacteria | 2242 |
| 336 | Ga0495642_0066485 | 3300046528 | Bacteria | 1502 |
| 337 | Ga0495642_0094716 | 3300046528 | Bacteria | 1266 |
| 338 | Ga0495652_0109209 | 3300046529 | Bacteria | 2227 |
| 339 | Ga0495654_0073221 | 3300046530 | Bacteria | 1620 |
| 340 | Ga0495665_0029505 | 3300046531 | Bacteria | 2938 |
| 341 | Ga0495665_0060938 | 3300046531 | Bacteria | 1992 |
| 342 | Ga0495665_0072572 | 3300046531 | Bacteria | 1812 |
| 343 | Ga0495640_0148136 | 3300046533 | Bacteria | 1509 |
| 344 | Ga0495586_0003588 | 3300046535 | Bacteria | 8312 |
| 345 | Ga0495586_0036809 | 3300046535 | Bacteria | 2626 |
| 346 | Ga0495587_0008957 | 3300046536 | Bacteria | 6423 |
| 347 | Ga0495598_0019470 | 3300046537 | Bacteria | 1781 |
| 348 | Ga0495598_0068999 | 3300046537 | Bacteria | 1109 |
| 349 | Ga0495609_0033334 | 3300046538 | Bacteria | 2338 |
| 350 | Ga0495609_0046710 | 3300046538 | Bacteria | 1938 |
| 351 | Ga0495609_0056352 | 3300046538 | Bacteria | 1741 |
| 352 | Ga0495597_0017154 | 3300046542 | Bacteria | 3412 |
| 353 | Ga0495597_0039290 | 3300046542 | Bacteria | 2119 |
| 354 | Ga0495597_0040465 | 3300046542 | Bacteria | 2083 |
| 355 | Ga0495645_0235786 | 3300046543 | Bacteria | 1223 |
| 356 | Ga0495622_0001203 | 3300046557 | Bacteria | 13333 |
| 357 | Ga0495622_0017177 | 3300046557 | Bacteria | 3368 |
| 358 | Ga0495622_0063308 | 3300046557 | Bacteria | 1711 |
| 359 | Ga0495633_0007168 | 3300046558 | Bacteria | 6463 |
| 360 | Ga0495633_0008638 | 3300046558 | Bacteria | 5719 |
| 361 | Ga0495633_0021618 | 3300046558 | Bacteria | 3215 |
| 362 | Ga0495633_0022792 | 3300046558 | Bacteria | 3110 |
| 363 | Ga0495656_0000268 | 3300046615 | Bacteria | 18431 |
| 364 | Ga0495656_0066880 | 3300046615 | Bacteria | 1584 |
| 365 | Ga0495656_0068636 | 3300046615 | Bacteria | 1568 |
| 366 | Ga0495656_0143283 | 3300046615 | Bacteria | 1148 |
| 367 | Ga0495668_0005031 | 3300046616 | Bacteria | 9110 |
| 368 | Ga0495668_0028953 | 3300046616 | Bacteria | 3130 |
| 369 | Ga0495668_0030455 | 3300046616 | Bacteria | 3046 |
| 370 | Ga0495668_0057554 | 3300046616 | Bacteria | 2145 |
| 371 | Ga0495668_0084689 | 3300046616 | Bacteria | 1738 |
| 372 | Ga0495668_0098753 | 3300046616 | Bacteria | 1597 |
| 373 | Ga0495611_0003947 | 3300046648 | Bacteria | 6449 |
| 374 | Ga0495611_0010140 | 3300046648 | Bacteria | 3986 |
| 375 | Ga0495611_0028892 | 3300046648 | Bacteria | 2430 |
| 376 | Ga0495611_0035329 | 3300046648 | Bacteria | 2213 |
| 377 | Ga0495625_0039489 | 3300046660 | Bacteria | 3446 |
| 378 | Ga0495635_0150537 | 3300046663 | Bacteria | 1584 |
| 379 | Ga0495635_0156145 | 3300046663 | Bacteria | 1553 |
| 380 | Ga0495635_0165816 | 3300046663 | Bacteria | 1503 |
| 381 | Ga0495661_0005389 | 3300046665 | Bacteria | 9092 |
| 382 | Ga0495661_0005963 | 3300046665 | Bacteria | 8600 |
| 383 | Ga0495661_0009548 | 3300046665 | Bacteria | 6654 |
| 384 | Ga0495661_0014001 | 3300046665 | Bacteria | 5377 |
| 385 | Ga0495661_0112611 | 3300046665 | Bacteria | 1514 |
| 386 | Ga0495661_0157119 | 3300046665 | Bacteria | 1223 |
| 387 | Ga0495588_0002056 | 3300046674 | Bacteria | 8606 |
| 388 | Ga0495588_0016701 | 3300046674 | Bacteria | 3550 |
| 389 | Ga0495623_0019581 | 3300046679 | Bacteria | 4374 |
| 390 | Ga0495623_0093626 | 3300046679 | Bacteria | 1839 |
| 391 | Ga0495646_0049539 | 3300046680 | Bacteria | 2549 |
| 392 | Ga0495646_0070578 | 3300046680 | Bacteria | 2057 |
| 393 | Ga0495658_0089261 | 3300046683 | Bacteria | 1823 |
| 394 | Ga0495669_0001037 | 3300046684 | Bacteria | 11578 |
| 395 | Ga0495669_0104078 | 3300046684 | Bacteria | 1320 |
| 396 | Ga0495613_0031230 | 3300046689 | Bacteria | 3956 |
| 397 | Ga0495624_0001290 | 3300046690 | Bacteria | 19765 |
| 398 | Ga0495624_0161413 | 3300046690 | Bacteria | 1369 |
| 399 | Ga0495670_0000914 | 3300046691 | Bacteria | 14240 |
| 400 | Ga0495670_0003232 | 3300046691 | Bacteria | 8026 |
| 401 | Ga0495670_0030579 | 3300046691 | Bacteria | 2675 |
| 402 | Ga0495670_0083158 | 3300046691 | Bacteria | 1632 |
| 403 | Ga0495670_0134063 | 3300046691 | Bacteria | 1292 |
| 404 | Ga0495670_0180064 | 3300046691 | Bacteria | 1116 |
| 405 | Ga0495671_0018226 | 3300046692 | Bacteria | 3728 |
| 406 | Ga0495671_0022422 | 3300046692 | Bacteria | 3309 |
| 407 | Ga0495671_0045770 | 3300046692 | Bacteria | 2189 |
| 408 | Ga0495649_0109701 | 3300046694 | Bacteria | 1463 |
| 409 | Ga0495589_0008248 | 3300046794 | Bacteria | 5442 |
| 410 | Ga0495589_0052777 | 3300046794 | Bacteria | 2007 |
| 411 | Ga0495589_0058348 | 3300046794 | Bacteria | 1897 |
| 412 | Ga0495589_0066536 | 3300046794 | Bacteria | 1764 |
| 413 | Ga0495600_0006165 | 3300046809 | Bacteria | 7270 |
| 414 | Ga0495660_0004560 | 3300046810 | Bacteria | 8366 |
| 415 | Ga0495604_0028054 | 3300047317 | Bacteria | 4477 |
| 416 | Ga0495604_0076182 | 3300047317 | Bacteria | 2523 |
| 417 | Ga0495604_0124784 | 3300047317 | Bacteria | 1858 |
| 418 | Ga0495604_0337219 | 3300047317 | Bacteria | 1004 |
| 419 | Ga0495672_0000565 | 3300047320 | Bacteria | 41841 |
| 420 | Ga0495676_0015149 | 3300047321 | Bacteria | 6880 |
| 421 | Ga0495676_0120604 | 3300047321 | Bacteria | 1908 |
| 422 | Ga0495683_0000009 | 3300047323 | Bacteria | 241385 |
| 423 | Ga0495683_0000470 | 3300047323 | Bacteria | 31364 |
| 424 | Ga0495683_0009822 | 3300047323 | Bacteria | 5085 |
| 425 | Ga0495683_0021528 | 3300047323 | Bacteria | 3322 |
| 426 | Ga0495683_0029627 | 3300047323 | Bacteria | 2796 |
| 427 | Ga0495683_0044908 | 3300047323 | Bacteria | 2221 |
| 428 | Ga0495683_0132015 | 3300047323 | Bacteria | 1177 |
| 429 | Ga0495687_000117 | 3300047443 | Bacteria | 122591 |
| 430 | Ga0495687_003873 | 3300047443 | Bacteria | 10508 |
| 431 | Ga0495687_013939 | 3300047443 | Bacteria | 4163 |
| 432 | Ga0495675_0025874 | 3300047444 | Bacteria | 3739 |
| 433 | Ga0495675_0080440 | 3300047444 | Bacteria | 2052 |
| 434 | Ga0495675_0175936 | 3300047444 | Bacteria | 1312 |
| 435 | Ga0495677_0005865 | 3300047445 | Bacteria | 4652 |
| 436 | Ga0495677_0010385 | 3300047445 | Bacteria | 3420 |
| 437 | Ga0495677_0023711 | 3300047445 | Bacteria | 2226 |
| 438 | Ga0495677_0033246 | 3300047445 | Bacteria | 1879 |
| 439 | Ga0495677_0040406 | 3300047445 | Bacteria | 1706 |
| 440 | Ga0495677_0107051 | 3300047445 | Bacteria | 1061 |
| 441 | Ga0495685_008100 | 3300047447 | Bacteria | 3482 |
| 442 | Ga0495685_022776 | 3300047447 | Bacteria | 2155 |
| 443 | Ga0495681_0030280 | 3300047470 | Bacteria | 2758 |
| 444 | Ga0495681_0053592 | 3300047470 | Bacteria | 1887 |
| 445 | Ga0495681_0087727 | 3300047470 | Bacteria | 1378 |
| 446 | Ga0495681_0089297 | 3300047470 | Bacteria | 1363 |
| 447 | Ga0495686_0121269 | 3300047472 | Bacteria | 1558 |
| 448 | Ga0495593_0002312 | 3300047673 | Bacteria | 11439 |
| 449 | Ga0495593_0015203 | 3300047673 | Bacteria | 4366 |
| 450 | Ga0495593_0113490 | 3300047673 | Bacteria | 1382 |
| 451 | Ga0495602_0018666 | 3300048088 | Bacteria | 6915 |
| 452 | Ga0495626_0001381 | 3300048091 | Bacteria | 19521 |
| 453 | Ga0495626_0002812 | 3300048091 | Bacteria | 11650 |
| 454 | Ga0495626_0004895 | 3300048091 | Bacteria | 8049 |
| 455 | Ga0495626_0017849 | 3300048091 | Bacteria | 3578 |
| 456 | Ga0495626_0023413 | 3300048091 | Bacteria | 3041 |
| 457 | Ga0496102_0000854 | 3300048905 | Bacteria | 29260 |
| 458 | Ga0496102_0175083 | 3300048905 | Bacteria | 2020 |
| 459 | Ga0496102_0352308 | 3300048905 | Bacteria | 1386 |
| 460 | Ga0496104_0163453 | 3300048907 | Bacteria | 2135 |
| 461 | Ga0496105_0270880 | 3300048908 | Bacteria | 1371 |
| 462 | Ga0496108_0168930 | 3300048911 | Bacteria | 1892 |
| 463 | Ga0496108_0410797 | 3300048911 | Bacteria | 1182 |
| 464 | Ga0496109_0184910 | 3300048912 | Bacteria | 1958 |
| 465 | Ga0496112_0009014 | 3300048915 | Bacteria | 8959 |
| 466 | Ga0496112_0193496 | 3300048915 | Bacteria | 1995 |
| 467 | Ga0496114_0019820 | 3300048917 | Bacteria | 5454 |
| 468 | Ga0496115_0026720 | 3300048918 | Bacteria | 4508 |
| 469 | Ga0496115_0044126 | 3300048918 | Bacteria | 3555 |
| 470 | Ga0496116_0020222 | 3300048919 | Bacteria | 5063 |
| 471 | Ga0496121_0077293 | 3300048924 | Bacteria | 2651 |
| 472 | Ga0496123_0001111 | 3300048926 | Bacteria | 40321 |
| 473 | Ga0496125_0003463 | 3300048928 | Bacteria | 19109 |
| 474 | Ga0496125_0041386 | 3300048928 | Bacteria | 3939 |
| 475 | Ga0496126_0230986 | 3300048929 | Bacteria | 1550 |
| 476 | Ga0501308_002776 | 3300049128 | Bacteria | 1566 |
| 477 | Ga0501310_001960 | 3300049130 | Bacteria | 1916 |
| 478 | Ga0495678_028129 | 3300049459 | Bacteria | 2376 |
| 479 | Ga0495682_0000286 | 3300049460 | Bacteria | 39332 |
| 480 | Ga0495682_0026885 | 3300049460 | Bacteria | 2135 |
| 481 | Ga0501312_003316 | 3300049528 | Bacteria | 1819 |
| 482 | Ga0501320_000823 | 3300049536 | Bacteria | 2003 |
| 483 | Ga0501323_019981 | 3300049539 | Bacteria | 877 |
| 484 | Ga0501335_003445 | 3300049551 | Bacteria | 1341 |
| 485 | nmdc:mga03683_31053_c1 | 3300050489 | Bacteria | 2141 |
| 486 | nmdc:mga07m45_115090_c1 | 3300050496 | Bacteria | 1551 |
| 487 | nmdc:mga07m45_230885_c1 | 3300050496 | Bacteria | 1077 |
| 488 | Ga0500644_0032904 | 3300053088 | Bacteria | 1660 |
| 489 | Ga0500583_0140750 | 3300053092 | Bacteria | 1199 |
| 490 | Ga0500651_0112936 | 3300053093 | Bacteria | 1656 |
| 491 | Ga0500594_0004095 | 3300053118 | Bacteria | 3210 |
| 492 | Ga0500559_0000049 | 3300053136 | Bacteria | 93378 |
| 493 | Ga0500590_072900 | 3300053148 | Bacteria | 1703 |
| 494 | Ga0500622_0001472 | 3300053156 | Bacteria | 18751 |
| 495 | Ga0500634_0125877 | 3300053161 | Bacteria | 1239 |
| 496 | Ga0587083_0014016 | 3300059505 | Bacteria | 1374 |
| 497 | Ga0587078_007031 | 3300059646 | Bacteria | 1235 |
| 498 | Ga0587079_009551 | 3300059647 | Bacteria | 1513 |
| 499 | Ga0587102_000845 | 3300059649 | Bacteria | 1928 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0028012 | Ga0495642_0028012_1473_2228 | 242 |
| 2 | 3300046615 | Ga0495656_0143283 | Ga0495656_0143283_375_1130 | 242 |
| 3 | 3300049539 | Ga0501323_019981 | Ga0501323_019981_16_792 | 242 |
| 4 | 3300042006 | Ga0439432_054416 | Ga0439432_054416_15_776 | 243 |
| 5 | 3300037471 | Ga0395905_0502160 | Ga0395905_0502160_14_814 | 249 |
| 6 | 3300046492 | Ga0495585_0237037 | Ga0495585_0237037_102_902 | 249 |
| 7 | 3300050496 | nmdc:mga07m45_230885_c1 | nmdc:mga07m45_230885_c1_23_823 | 249 |
| 8 | 3300041404 | Ga0439436_0022428 | Ga0439436_0022428_1054_1860 | 250 |
| 9 | 3300046473 | Ga0495582_0334435 | Ga0495582_0334435_51_857 | 250 |
| 10 | 3300046491 | Ga0495584_0182030 | Ga0495584_0182030_10_816 | 250 |
| 11 | 3300031456 | Ga0307513_10117942 | Ga0307513_101179422 | 267 |
| 12 | iso_pu_bacteria | 2511231003 | 2511251513 | 268 |
| 13 | iso_pu_bacteria | 2511231026 | 2511383543 | 268 |
| 14 | iso_pu_bacteria | 2521172590 | 2521560309 | 268 |
| 15 | iso_pu_bacteria | 2551306416 | 2553005128 | 268 |
| 16 | iso_pu_bacteria | 2643221603 | 2644026078 | 268 |
| 17 | iso_pu_bacteria | 2765235838 | 2765571484 | 268 |
| 18 | iso_pu_bacteria | 2808606386 | 2808982357 | 268 |
| 19 | iso_pu_bacteria | 2808606415 | 2809129843 | 268 |
| 20 | iso_pu_bacteria | 2808606419 | 2809149102 | 268 |
| 21 | iso_pu_bacteria | 2818991445 | 2819593054 | 268 |
| 22 | iso_pu_bacteria | 2818991449 | 2819616669 | 268 |
| 23 | iso_pu_bacteria | 2839094727 | 2839098774 | 268 |
| 24 | iso_pu_bacteria | 2852618963 | 2852619242 | 268 |
| 25 | iso_pu_bacteria | 2904439833 | 2904442545 | 268 |
| 26 | iso_pu_bacteria | 2904530477 | 2904535248 | 268 |
| 27 | iso_pu_bacteria | 2904584206 | 2904589592 | 268 |
| 28 | iso_pu_bacteria | 2904589729 | 2904594499 | 268 |
| 29 | iso_pu_bacteria | 2904601388 | 2904606243 | 268 |
| 30 | iso_pu_bacteria | 2919046199 | 2919048822 | 268 |
| 31 | iso_pu_bacteria | 2919079590 | 2919084192 | 268 |
| 32 | iso_pu_bacteria | 2923510766 | 2923514083 | 268 |
| 33 | iso_pu_bacteria | 2928130867 | 2928134668 | 268 |
| 34 | 3300046500 | Ga0495596_0012741 | Ga0495596_0012741_1460_2329 | 269 |
| 35 | 3300048918 | Ga0496115_0044126 | Ga0496115_0044126_1641_2510 | 269 |
| 36 | iso_pu_bacteria | 2547132374 | 2548501904 | 269 |
| 37 | iso_pu_bacteria | 2643221609 | 2644061030 | 269 |
| 38 | iso_pu_bacteria | 2643221611 | 2644071662 | 269 |
| 39 | iso_pu_bacteria | 2643221660 | 2644339716 | 269 |
| 40 | iso_pu_bacteria | 2643221717 | 2644647202 | 269 |
| 41 | iso_pu_bacteria | 2738543012 | 2739247183 | 269 |
| 42 | iso_pu_bacteria | 2816332133 | 2816476233 | 269 |
| 43 | iso_pu_bacteria | 2842718218 | 2842722356 | 269 |
| 44 | iso_pu_bacteria | 2885192300 | 2885197609 | 269 |
| 45 | iso_pu_bacteria | 2894023352 | 2894023553 | 269 |
| 46 | iso_pu_bacteria | 2904541872 | 2904549138 | 269 |
| 47 | iso_pu_bacteria | 2929160207 | 2929160766 | 269 |
| 48 | iso_pu_bacteria | 2974320154 | 2974321074 | 269 |
| 49 | 3300005327 | Ga0070658_10320945 | Ga0070658_103209452 | 270 |
| 50 | 3300005331 | Ga0070670_100186620 | Ga0070670_1001866202 | 270 |
| 51 | 3300005338 | Ga0068868_100196094 | Ga0068868_1001960942 | 270 |
| 52 | 3300005354 | Ga0070675_100173927 | Ga0070675_1001739272 | 270 |
| 53 | 3300005355 | Ga0070671_100339946 | Ga0070671_1003399462 | 270 |
| 54 | 3300005364 | Ga0070673_100088990 | Ga0070673_1000889902 | 270 |
| 55 | 3300005364 | Ga0070673_100224676 | Ga0070673_1002246762 | 270 |
| 56 | 3300005456 | Ga0070678_100231926 | Ga0070678_1002319262 | 270 |
| 57 | 3300005543 | Ga0070672_100074874 | Ga0070672_1000748742 | 270 |
| 58 | 3300005618 | Ga0068864_100158444 | Ga0068864_1001584441 | 270 |
| 59 | 3300005834 | Ga0068851_10061043 | Ga0068851_100610432 | 270 |
| 60 | 3300005840 | Ga0068870_10150755 | Ga0068870_101507552 | 270 |
| 61 | 3300006881 | Ga0068865_100103803 | Ga0068865_1001038032 | 270 |
| 62 | 3300009148 | Ga0105243_10218372 | Ga0105243_102183722 | 270 |
| 63 | 3300009177 | Ga0105248_10252864 | Ga0105248_102528642 | 270 |
| 64 | 3300013296 | Ga0157374_10312513 | Ga0157374_103125132 | 270 |
| 65 | 3300013306 | Ga0163162_10389945 | Ga0163162_103899452 | 270 |
| 66 | 3300013308 | Ga0157375_10635165 | Ga0157375_106351651 | 270 |
| 67 | 3300013308 | Ga0157375_10786323 | Ga0157375_107863231 | 270 |
| 68 | 3300014326 | Ga0157380_10081632 | Ga0157380_100816322 | 270 |
| 69 | 3300014969 | Ga0157376_10379363 | Ga0157376_103793632 | 270 |
| 70 | 3300017792 | Ga0163161_10087909 | Ga0163161_100879092 | 270 |
| 71 | 3300025315 | Ga0207697_10081534 | Ga0207697_100815342 | 270 |
| 72 | 3300025903 | Ga0207680_10157647 | Ga0207680_101576472 | 270 |
| 73 | 3300025908 | Ga0207643_10091435 | Ga0207643_100914352 | 270 |
| 74 | 3300025919 | Ga0207657_10122110 | Ga0207657_101221102 | 270 |
| 75 | 3300025923 | Ga0207681_10233323 | Ga0207681_102333232 | 270 |
| 76 | 3300025925 | Ga0207650_10044775 | Ga0207650_100447752 | 270 |
| 77 | 3300025926 | Ga0207659_10144227 | Ga0207659_101442272 | 270 |
| 78 | 3300025931 | Ga0207644_10279324 | Ga0207644_102793241 | 270 |
| 79 | 3300025931 | Ga0207644_10385545 | Ga0207644_103855452 | 270 |
| 80 | 3300025937 | Ga0207669_10268778 | Ga0207669_102687782 | 270 |
| 81 | 3300025940 | Ga0207691_10020222 | Ga0207691_100202227 | 270 |
| 82 | 3300025972 | Ga0207668_10155440 | Ga0207668_101554402 | 270 |
| 83 | 3300026023 | Ga0207677_10047287 | Ga0207677_100472872 | 270 |
| 84 | 3300026067 | Ga0207678_10178930 | Ga0207678_101789302 | 270 |
| 85 | 3300026121 | Ga0207683_10206485 | Ga0207683_102064852 | 270 |
| 86 | 3300026142 | Ga0207698_10352119 | Ga0207698_103521191 | 270 |
| 87 | 3300028379 | Ga0268266_10143438 | Ga0268266_101434382 | 270 |
| 88 | 3300037418 | Ga0395900_0412592 | Ga0395900_0412592_187_1050 | 270 |
| 89 | 3300037471 | Ga0395905_0004181 | Ga0395905_0004181_10187_11050 | 270 |
| 90 | 3300046455 | Ga0495603_0199056 | Ga0495603_0199056_195_1064 | 270 |
| 91 | 3300046615 | Ga0495656_0000268 | Ga0495656_0000268_748_1623 | 270 |
| 92 | 3300046691 | Ga0495670_0180064 | Ga0495670_0180064_222_1091 | 270 |
| 93 | 3300048911 | Ga0496108_0410797 | Ga0496108_0410797_262_1131 | 270 |
| 94 | 3300059505 | Ga0587083_0014016 | Ga0587083_0014016_476_1339 | 270 |
| 95 | 3300059646 | Ga0587078_007031 | Ga0587078_007031_328_1191 | 270 |
| 96 | 3300059647 | Ga0587079_009551 | Ga0587079_009551_626_1495 | 270 |
| 97 | 3300059649 | Ga0587102_000845 | Ga0587102_000845_881_1744 | 270 |
| 98 | 3300046507 | Ga0495606_0003300 | Ga0495606_0003300_3505_4374 | 271 |
| 99 | 3300046528 | Ga0495642_0017412 | Ga0495642_0017412_1165_2034 | 271 |
| 100 | 3300047323 | Ga0495683_0132015 | Ga0495683_0132015_180_1049 | 271 |
| 101 | 3300047445 | Ga0495677_0040406 | Ga0495677_0040406_53_922 | 271 |
| 102 | 3300002705 | JGI25156J39149_1013055 | JGI25156J39149_10130552 | 272 |
| 103 | 3300002737 | JGI25162J39368_1004905 | JGI25162J39368_10049052 | 272 |
| 104 | 3300002741 | JGI25157J39369_1003315 | JGI25157J39369_10033152 | 272 |
| 105 | 3300002774 | JGI25150J39212_1002629 | JGI25150J39212_10026292 | 272 |
| 106 | 3300003163 | Ga0006759J45824_1023789 | Ga0006759J45824_10237895 | 272 |
| 107 | 3300003574 | Ga0007410J51695_1012491 | Ga0007410J51695_10124917 | 272 |
| 108 | 3300003575 | Ga0007409J51694_1005570 | Ga0007409J51694_10055708 | 272 |
| 109 | 3300003577 | Ga0007416J51690_1018405 | Ga0007416J51690_10184057 | 272 |
| 110 | 3300003693 | Ga0032354_1014770 | Ga0032354_10147705 | 272 |
| 111 | 3300003751 | Ga0055538_1000789 | Ga0055538_10007899 | 272 |
| 112 | 3300003752 | Ga0055539_1000685 | Ga0055539_10006859 | 272 |
| 113 | 3300003756 | Ga0055533_1000922 | Ga0055533_10009229 | 272 |
| 114 | 3300003758 | Ga0055532_1000130 | Ga0055532_100013014 | 272 |
| 115 | 3300003759 | Ga0055525_1000057 | Ga0055525_100005730 | 272 |
| 116 | 3300003759 | Ga0055525_1000869 | Ga0055525_10008699 | 272 |
| 117 | 3300003771 | Ga0055526_1000812 | Ga0055526_100081214 | 272 |
| 118 | 3300003841 | Ga0055541_1000684 | Ga0055541_10006849 | 272 |
| 119 | 3300005331 | Ga0070670_100096928 | Ga0070670_1000969282 | 272 |
| 120 | 3300005331 | Ga0070670_100199869 | Ga0070670_1001998692 | 272 |
| 121 | 3300005334 | Ga0068869_100006248 | Ga0068869_1000062482 | 272 |
| 122 | 3300005337 | Ga0070682_100004311 | Ga0070682_1000043113 | 272 |
| 123 | 3300005339 | Ga0070660_100005023 | Ga0070660_1000050238 | 272 |
| 124 | 3300005343 | Ga0070687_100089131 | Ga0070687_1000891312 | 272 |
| 125 | 3300005344 | Ga0070661_100004150 | Ga0070661_1000041502 | 272 |
| 126 | 3300005344 | Ga0070661_100189435 | Ga0070661_1001894351 | 272 |
| 127 | 3300005344 | Ga0070661_100227193 | Ga0070661_1002271931 | 272 |
| 128 | 3300005354 | Ga0070675_100116592 | Ga0070675_1001165922 | 272 |
| 129 | 3300005354 | Ga0070675_100250703 | Ga0070675_1002507031 | 272 |
| 130 | 3300005355 | Ga0070671_100119610 | Ga0070671_1001196102 | 272 |
| 131 | 3300005366 | Ga0070659_100093181 | Ga0070659_1000931812 | 272 |
| 132 | 3300005457 | Ga0070662_100276359 | Ga0070662_1002763592 | 272 |
| 133 | 3300005459 | Ga0068867_100029088 | Ga0068867_1000290885 | 272 |
| 134 | 3300005539 | Ga0068853_100295498 | Ga0068853_1002954982 | 272 |
| 135 | 3300005543 | Ga0070672_100072428 | Ga0070672_1000724282 | 272 |
| 136 | 3300005543 | Ga0070672_100369350 | Ga0070672_1003693502 | 272 |
| 137 | 3300005563 | Ga0068855_100153371 | Ga0068855_1001533712 | 272 |
| 138 | 3300005577 | Ga0068857_100021833 | Ga0068857_1000218335 | 272 |
| 139 | 3300005578 | Ga0068854_100027132 | Ga0068854_1000271322 | 272 |
| 140 | 3300005614 | Ga0068856_100214586 | Ga0068856_1002145862 | 272 |
| 141 | 3300005616 | Ga0068852_100127644 | Ga0068852_1001276441 | 272 |
| 142 | 3300005616 | Ga0068852_100465649 | Ga0068852_1004656491 | 272 |
| 143 | 3300005618 | Ga0068864_100265661 | Ga0068864_1002656612 | 272 |
| 144 | 3300005834 | Ga0068851_10088823 | Ga0068851_100888232 | 272 |
| 145 | 3300006175 | Ga0070712_100074634 | Ga0070712_1000746342 | 272 |
| 146 | 3300006237 | Ga0097621_100311852 | Ga0097621_1003118522 | 272 |
| 147 | 3300006353 | Ga0075370_10090261 | Ga0075370_100902612 | 272 |
| 148 | 3300009011 | Ga0105251_10031554 | Ga0105251_100315542 | 272 |
| 149 | 3300009093 | Ga0105240_10016732 | Ga0105240_100167322 | 272 |
| 150 | 3300009093 | Ga0105240_10019169 | Ga0105240_100191697 | 272 |
| 151 | 3300009093 | Ga0105240_10285223 | Ga0105240_102852232 | 272 |
| 152 | 3300009098 | Ga0105245_10371155 | Ga0105245_103711552 | 272 |
| 153 | 3300009551 | Ga0105238_10000038 | Ga0105238_10000038119 | 272 |
| 154 | 3300009551 | Ga0105238_10027954 | Ga0105238_100279545 | 272 |
| 155 | 3300010375 | Ga0105239_10000303 | Ga0105239_1000030310 | 272 |
| 156 | 3300010375 | Ga0105239_10926396 | Ga0105239_109263961 | 272 |
| 157 | 3300013105 | Ga0157369_10228373 | Ga0157369_102283732 | 272 |
| 158 | 3300013297 | Ga0157378_10167028 | Ga0157378_101670282 | 272 |
| 159 | 3300013306 | Ga0163162_10768915 | Ga0163162_107689152 | 272 |
| 160 | 3300014497 | Ga0182008_10012205 | Ga0182008_100122052 | 272 |
| 161 | 3300015261 | Ga0182006_1013512 | Ga0182006_10135122 | 272 |
| 162 | 3300015262 | Ga0182007_10074827 | Ga0182007_100748272 | 272 |
| 163 | 3300021361 | Ga0213872_10000122 | Ga0213872_1000012225 | 272 |
| 164 | 3300021361 | Ga0213872_10000383 | Ga0213872_1000038331 | 272 |
| 165 | 3300021361 | Ga0213872_10001440 | Ga0213872_100014402 | 272 |
| 166 | 3300021361 | Ga0213872_10064024 | Ga0213872_100640242 | 272 |
| 167 | 3300025206 | Ga0209435_100046 | Ga0209435_10004635 | 272 |
| 168 | 3300025224 | Ga0209784_100018 | Ga0209784_100018428 | 272 |
| 169 | 3300025225 | Ga0209566_100016 | Ga0209566_100016428 | 272 |
| 170 | 3300025226 | Ga0209674_100030 | Ga0209674_100030428 | 272 |
| 171 | 3300025229 | Ga0209147_100157 | Ga0209147_10015756 | 272 |
| 172 | 3300025230 | Ga0209563_100014 | Ga0209563_100014222 | 272 |
| 173 | 3300025230 | Ga0209563_100034 | Ga0209563_100034428 | 272 |
| 174 | 3300025233 | Ga0209437_100260 | Ga0209437_10026041 | 272 |
| 175 | 3300025242 | Ga0209258_100768 | Ga0209258_10076814 | 272 |
| 176 | 3300025245 | Ga0207425_1000200 | Ga0207425_100020048 | 272 |
| 177 | 3300025246 | Ga0209646_1000156 | Ga0209646_100015658 | 272 |
| 178 | 3300025246 | Ga0209646_1004576 | Ga0209646_10045762 | 272 |
| 179 | 3300025250 | Ga0209026_1000966 | Ga0209026_10009661 | 272 |
| 180 | 3300025250 | Ga0209026_1009580 | Ga0209026_10095802 | 272 |
| 181 | 3300025253 | Ga0209677_100019 | Ga0209677_100019428 | 272 |
| 182 | 3300025256 | Ga0209759_1006432 | Ga0209759_10064322 | 272 |
| 183 | 3300025256 | Ga0209759_1013237 | Ga0209759_10132371 | 272 |
| 184 | 3300025258 | Ga0209129_1000113 | Ga0209129_100011346 | 272 |
| 185 | 3300025272 | Ga0209455_1004795 | Ga0209455_10047952 | 272 |
| 186 | 3300025273 | Ga0209673_1032710 | Ga0209673_10327102 | 272 |
| 187 | 3300025295 | Ga0209564_1000186 | Ga0209564_100018646 | 272 |
| 188 | 3300025297 | Ga0209758_1000172 | Ga0209758_100017246 | 272 |
| 189 | 3300025299 | Ga0209256_1017807 | Ga0209256_10178072 | 272 |
| 190 | 3300025304 | Ga0209257_1036451 | Ga0209257_10364512 | 272 |
| 191 | 3300025321 | Ga0207656_10099140 | Ga0207656_100991402 | 272 |
| 192 | 3300025735 | Ga0207713_1017647 | Ga0207713_10176473 | 272 |
| 193 | 3300025901 | Ga0207688_10067100 | Ga0207688_100671002 | 272 |
| 194 | 3300025901 | Ga0207688_10099218 | Ga0207688_100992182 | 272 |
| 195 | 3300025907 | Ga0207645_10001670 | Ga0207645_100016702 | 272 |
| 196 | 3300025913 | Ga0207695_10002989 | Ga0207695_100029897 | 272 |
| 197 | 3300025913 | Ga0207695_10005091 | Ga0207695_100050915 | 272 |
| 198 | 3300025913 | Ga0207695_10069594 | Ga0207695_100695944 | 272 |
| 199 | 3300025914 | Ga0207671_10003973 | Ga0207671_100039732 | 272 |
| 200 | 3300025915 | Ga0207693_10087277 | Ga0207693_100872772 | 272 |
| 201 | 3300025918 | Ga0207662_10072849 | Ga0207662_100728492 | 272 |
| 202 | 3300025919 | Ga0207657_10037075 | Ga0207657_100370754 | 272 |
| 203 | 3300025920 | Ga0207649_10142022 | Ga0207649_101420221 | 272 |
| 204 | 3300025924 | Ga0207694_10000126 | Ga0207694_1000012613 | 272 |
| 205 | 3300025925 | Ga0207650_10179470 | Ga0207650_101794702 | 272 |
| 206 | 3300025926 | Ga0207659_10039375 | Ga0207659_100393754 | 272 |
| 207 | 3300025931 | Ga0207644_10090202 | Ga0207644_100902022 | 272 |
| 208 | 3300025931 | Ga0207644_10332034 | Ga0207644_103320341 | 272 |
| 209 | 3300025932 | Ga0207690_10019191 | Ga0207690_100191912 | 272 |
| 210 | 3300025933 | Ga0207706_10278658 | Ga0207706_102786582 | 272 |
| 211 | 3300025933 | Ga0207706_10311251 | Ga0207706_103112512 | 272 |
| 212 | 3300025935 | Ga0207709_10217485 | Ga0207709_102174852 | 272 |
| 213 | 3300025940 | Ga0207691_10111276 | Ga0207691_101112762 | 272 |
| 214 | 3300025942 | Ga0207689_10097654 | Ga0207689_100976542 | 272 |
| 215 | 3300025945 | Ga0207679_10176435 | Ga0207679_101764352 | 272 |
| 216 | 3300025945 | Ga0207679_10209350 | Ga0207679_102093502 | 272 |
| 217 | 3300025949 | Ga0207667_10023820 | Ga0207667_100238203 | 272 |
| 218 | 3300025986 | Ga0207658_10443187 | Ga0207658_104431872 | 272 |
| 219 | 3300026023 | Ga0207677_10061609 | Ga0207677_100616092 | 272 |
| 220 | 3300026078 | Ga0207702_10209051 | Ga0207702_102090512 | 272 |
| 221 | 3300026088 | Ga0207641_10457619 | Ga0207641_104576192 | 272 |
| 222 | 3300026089 | Ga0207648_10041042 | Ga0207648_100410424 | 272 |
| 223 | 3300026116 | Ga0207674_10025311 | Ga0207674_100253113 | 272 |
| 224 | 3300026121 | Ga0207683_10427586 | Ga0207683_104275861 | 272 |
| 225 | 3300026142 | Ga0207698_10005617 | Ga0207698_100056171 | 272 |
| 226 | 3300026142 | Ga0207698_10450556 | Ga0207698_104505561 | 272 |
| 227 | 3300027876 | Ga0209974_10006131 | Ga0209974_100061312 | 272 |
| 228 | 3300028786 | Ga0307517_10017098 | Ga0307517_1001709810 | 272 |
| 229 | 3300028794 | Ga0307515_10083575 | Ga0307515_100835752 | 272 |
| 230 | 3300031250 | Ga0265331_10019062 | Ga0265331_100190622 | 272 |
| 231 | 3300031251 | Ga0265327_10000444 | Ga0265327_1000044441 | 272 |
| 232 | 3300031456 | Ga0307513_10283324 | Ga0307513_102833242 | 272 |
| 233 | 3300031507 | Ga0307509_10082422 | Ga0307509_100824222 | 272 |
| 234 | 3300031548 | Ga0307408_100103678 | Ga0307408_1001036782 | 272 |
| 235 | 3300031616 | Ga0307508_10000134 | Ga0307508_1000013449 | 272 |
| 236 | 3300031616 | Ga0307508_10000524 | Ga0307508_100005249 | 272 |
| 237 | 3300031649 | Ga0307514_10136187 | Ga0307514_101361872 | 272 |
| 238 | 3300031730 | Ga0307516_10125492 | Ga0307516_101254922 | 272 |
| 239 | 3300031731 | Ga0307405_10377228 | Ga0307405_103772281 | 272 |
| 240 | 3300032002 | Ga0307416_100330304 | Ga0307416_1003303042 | 272 |
| 241 | 3300033180 | Ga0307510_10005730 | Ga0307510_1000573010 | 272 |
| 242 | 3300035692 | Ga0373935_0142955 | Ga0373935_0142955_297_1166 | 272 |
| 243 | 3300037312 | Ga0395899_0257708 | Ga0395899_0257708_183_1052 | 272 |
| 244 | 3300037418 | Ga0395900_0191021 | Ga0395900_0191021_290_1159 | 272 |
| 245 | 3300037471 | Ga0395905_0004203 | Ga0395905_0004203_11721_12590 | 272 |
| 246 | 3300037471 | Ga0395905_0013567 | Ga0395905_0013567_3663_4532 | 272 |
| 247 | 3300039447 | Ga0436361_0066651 | Ga0436361_0066651_1179_2048 | 272 |
| 248 | 3300039447 | Ga0436361_0108001 | Ga0436361_0108001_110648_111517 | 272 |
| 249 | 3300039447 | Ga0436361_0264437 | Ga0436361_0264437_1871_2746 | 272 |
| 250 | 3300039447 | Ga0436361_0619669 | Ga0436361_0619669_1072_1941 | 272 |
| 251 | 3300039447 | Ga0436361_0709165 | Ga0436361_0709165_1039_1911 | 272 |
| 252 | 3300039447 | Ga0436361_0813098 | Ga0436361_0813098_111527_112399 | 272 |
| 253 | 3300044658 | Ga0466972_0000825 | Ga0466972_0000825_13262_14131 | 272 |
| 254 | 3300044658 | Ga0466972_0091952 | Ga0466972_0091952_351_1220 | 272 |
| 255 | 3300044683 | Ga0466965_0000541 | Ga0466965_0000541_12300_13169 | 272 |
| 256 | 3300044765 | Ga0466970_0067315 | Ga0466970_0067315_612_1481 | 272 |
| 257 | 3300044842 | Ga0466957_0101619 | Ga0466957_0101619_447_1316 | 272 |
| 258 | 3300045049 | Ga0466959_0202289 | Ga0466959_0202289_344_1213 | 272 |
| 259 | 3300046452 | Ga0495617_000885 | Ga0495617_000885_10237_11106 | 272 |
| 260 | 3300046454 | Ga0495592_0000320 | Ga0495592_0000320_36428_37297 | 272 |
| 261 | 3300046454 | Ga0495592_0143691 | Ga0495592_0143691_737_1606 | 272 |
| 262 | 3300046459 | Ga0495629_0090529 | Ga0495629_0090529_923_1792 | 272 |
| 263 | 3300046460 | Ga0495638_0007395 | Ga0495638_0007395_5994_6863 | 272 |
| 264 | 3300046462 | Ga0495651_0145136 | Ga0495651_0145136_236_1108 | 272 |
| 265 | 3300046463 | Ga0495653_0136138 | Ga0495653_0136138_527_1396 | 272 |
| 266 | 3300046463 | Ga0495653_0309645 | Ga0495653_0309645_147_1016 | 272 |
| 267 | 3300046472 | Ga0495580_0032566 | Ga0495580_0032566_259_1128 | 272 |
| 268 | 3300046472 | Ga0495580_0239858 | Ga0495580_0239858_17_886 | 272 |
| 269 | 3300046473 | Ga0495582_0054210 | Ga0495582_0054210_563_1432 | 272 |
| 270 | 3300046474 | Ga0495605_0039256 | Ga0495605_0039256_619_1488 | 272 |
| 271 | 3300046474 | Ga0495605_0107058 | Ga0495605_0107058_374_1243 | 272 |
| 272 | 3300046475 | Ga0495639_0047574 | Ga0495639_0047574_111_980 | 272 |
| 273 | 3300046491 | Ga0495584_0000001 | Ga0495584_0000001_66768_67637 | 272 |
| 274 | 3300046491 | Ga0495584_0000434 | Ga0495584_0000434_8105_8974 | 272 |
| 275 | 3300046491 | Ga0495584_0036935 | Ga0495584_0036935_1386_2255 | 272 |
| 276 | 3300046491 | Ga0495584_0039249 | Ga0495584_0039249_620_1489 | 272 |
| 277 | 3300046491 | Ga0495584_0049269 | Ga0495584_0049269_516_1385 | 272 |
| 278 | 3300046491 | Ga0495584_0056432 | Ga0495584_0056432_381_1250 | 272 |
| 279 | 3300046491 | Ga0495584_0069936 | Ga0495584_0069936_359_1228 | 272 |
| 280 | 3300046492 | Ga0495585_0000002 | Ga0495585_0000002_410902_411771 | 272 |
| 281 | 3300046492 | Ga0495585_0000026 | Ga0495585_0000026_88235_89167 | 272 |
| 282 | 3300046492 | Ga0495585_0002790 | Ga0495585_0002790_3438_4307 | 272 |
| 283 | 3300046492 | Ga0495585_0006880 | Ga0495585_0006880_2395_3264 | 272 |
| 284 | 3300046492 | Ga0495585_0013940 | Ga0495585_0013940_1071_1940 | 272 |
| 285 | 3300046492 | Ga0495585_0022958 | Ga0495585_0022958_981_1850 | 272 |
| 286 | 3300046492 | Ga0495585_0024985 | Ga0495585_0024985_283_1152 | 272 |
| 287 | 3300046492 | Ga0495585_0054879 | Ga0495585_0054879_957_1826 | 272 |
| 288 | 3300046499 | Ga0495594_0000459 | Ga0495594_0000459_13336_14205 | 272 |
| 289 | 3300046500 | Ga0495596_0000149 | Ga0495596_0000149_41938_42807 | 272 |
| 290 | 3300046500 | Ga0495596_0008791 | Ga0495596_0008791_2538_3407 | 272 |
| 291 | 3300046500 | Ga0495596_0011580 | Ga0495596_0011580_1423_2292 | 272 |
| 292 | 3300046501 | Ga0495607_0110230 | Ga0495607_0110230_523_1392 | 272 |
| 293 | 3300046506 | Ga0495583_0000009 | Ga0495583_0000009_86691_87560 | 272 |
| 294 | 3300046506 | Ga0495583_0015888 | Ga0495583_0015888_1686_2555 | 272 |
| 295 | 3300046507 | Ga0495606_0011711 | Ga0495606_0011711_1199_2068 | 272 |
| 296 | 3300046507 | Ga0495606_0013480 | Ga0495606_0013480_5566_6435 | 272 |
| 297 | 3300046507 | Ga0495606_0056394 | Ga0495606_0056394_751_1620 | 272 |
| 298 | 3300046511 | Ga0495608_0009994 | Ga0495608_0009994_4905_5777 | 272 |
| 299 | 3300046513 | Ga0495616_0000616 | Ga0495616_0000616_25338_26207 | 272 |
| 300 | 3300046513 | Ga0495616_0004636 | Ga0495616_0004636_3537_4406 | 272 |
| 301 | 3300046513 | Ga0495616_0024211 | Ga0495616_0024211_1004_1873 | 272 |
| 302 | 3300046514 | Ga0495618_0189665 | Ga0495618_0189665_139_1011 | 272 |
| 303 | 3300046515 | Ga0495620_0003122 | Ga0495620_0003122_5590_6459 | 272 |
| 304 | 3300046516 | Ga0495628_0009618 | Ga0495628_0009618_348_1220 | 272 |
| 305 | 3300046519 | Ga0495632_0006352 | Ga0495632_0006352_5723_6592 | 272 |
| 306 | 3300046522 | Ga0495643_0006229 | Ga0495643_0006229_838_1707 | 272 |
| 307 | 3300046522 | Ga0495643_0038091 | Ga0495643_0038091_1270_2139 | 272 |
| 308 | 3300046524 | Ga0495648_0000012 | Ga0495648_0000012_117546_118415 | 272 |
| 309 | 3300046524 | Ga0495648_0075765 | Ga0495648_0075765_821_1690 | 272 |
| 310 | 3300046525 | Ga0495663_0050747 | Ga0495663_0050747_43_912 | 272 |
| 311 | 3300046526 | Ga0495666_0004810 | Ga0495666_0004810_368_1237 | 272 |
| 312 | 3300046526 | Ga0495666_0031370 | Ga0495666_0031370_1211_2080 | 272 |
| 313 | 3300046526 | Ga0495666_0041664 | Ga0495666_0041664_598_1467 | 272 |
| 314 | 3300046526 | Ga0495666_0042326 | Ga0495666_0042326_580_1449 | 272 |
| 315 | 3300046526 | Ga0495666_0068890 | Ga0495666_0068890_545_1414 | 272 |
| 316 | 3300046528 | Ga0495642_0005181 | Ga0495642_0005181_3882_4751 | 272 |
| 317 | 3300046528 | Ga0495642_0066485 | Ga0495642_0066485_463_1332 | 272 |
| 318 | 3300046529 | Ga0495652_0109209 | Ga0495652_0109209_417_1289 | 272 |
| 319 | 3300046531 | Ga0495665_0029505 | Ga0495665_0029505_758_1627 | 272 |
| 320 | 3300046531 | Ga0495665_0060938 | Ga0495665_0060938_987_1856 | 272 |
| 321 | 3300046535 | Ga0495586_0003588 | Ga0495586_0003588_3781_4650 | 272 |
| 322 | 3300046535 | Ga0495586_0036809 | Ga0495586_0036809_389_1258 | 272 |
| 323 | 3300046536 | Ga0495587_0008957 | Ga0495587_0008957_1255_2124 | 272 |
| 324 | 3300046537 | Ga0495598_0068999 | Ga0495598_0068999_62_931 | 272 |
| 325 | 3300046538 | Ga0495609_0033334 | Ga0495609_0033334_677_1546 | 272 |
| 326 | 3300046538 | Ga0495609_0046710 | Ga0495609_0046710_1057_1926 | 272 |
| 327 | 3300046542 | Ga0495597_0039290 | Ga0495597_0039290_731_1600 | 272 |
| 328 | 3300046557 | Ga0495622_0001203 | Ga0495622_0001203_2223_3092 | 272 |
| 329 | 3300046557 | Ga0495622_0017177 | Ga0495622_0017177_1004_1873 | 272 |
| 330 | 3300046558 | Ga0495633_0007168 | Ga0495633_0007168_3690_4559 | 272 |
| 331 | 3300046558 | Ga0495633_0008638 | Ga0495633_0008638_1188_2057 | 272 |
| 332 | 3300046558 | Ga0495633_0021618 | Ga0495633_0021618_725_1594 | 272 |
| 333 | 3300046558 | Ga0495633_0022792 | Ga0495633_0022792_1209_2078 | 272 |
| 334 | 3300046615 | Ga0495656_0066880 | Ga0495656_0066880_370_1239 | 272 |
| 335 | 3300046615 | Ga0495656_0068636 | Ga0495656_0068636_111_980 | 272 |
| 336 | 3300046616 | Ga0495668_0005031 | Ga0495668_0005031_3387_4256 | 272 |
| 337 | 3300046616 | Ga0495668_0028953 | Ga0495668_0028953_1386_2255 | 272 |
| 338 | 3300046616 | Ga0495668_0030455 | Ga0495668_0030455_638_1507 | 272 |
| 339 | 3300046616 | Ga0495668_0057554 | Ga0495668_0057554_401_1270 | 272 |
| 340 | 3300046648 | Ga0495611_0003947 | Ga0495611_0003947_4067_4936 | 272 |
| 341 | 3300046648 | Ga0495611_0010140 | Ga0495611_0010140_1519_2388 | 272 |
| 342 | 3300046660 | Ga0495625_0039489 | Ga0495625_0039489_1111_1980 | 272 |
| 343 | 3300046663 | Ga0495635_0165816 | Ga0495635_0165816_576_1445 | 272 |
| 344 | 3300046665 | Ga0495661_0005389 | Ga0495661_0005389_2920_3789 | 272 |
| 345 | 3300046665 | Ga0495661_0005963 | Ga0495661_0005963_534_1403 | 272 |
| 346 | 3300046665 | Ga0495661_0009548 | Ga0495661_0009548_2944_3813 | 272 |
| 347 | 3300046665 | Ga0495661_0014001 | Ga0495661_0014001_3584_4453 | 272 |
| 348 | 3300046665 | Ga0495661_0112611 | Ga0495661_0112611_439_1308 | 272 |
| 349 | 3300046674 | Ga0495588_0002056 | Ga0495588_0002056_4336_5205 | 272 |
| 350 | 3300046674 | Ga0495588_0016701 | Ga0495588_0016701_1695_2564 | 272 |
| 351 | 3300046679 | Ga0495623_0019581 | Ga0495623_0019581_2446_3318 | 272 |
| 352 | 3300046680 | Ga0495646_0049539 | Ga0495646_0049539_241_1113 | 272 |
| 353 | 3300046680 | Ga0495646_0070578 | Ga0495646_0070578_968_1837 | 272 |
| 354 | 3300046683 | Ga0495658_0089261 | Ga0495658_0089261_200_1069 | 272 |
| 355 | 3300046684 | Ga0495669_0001037 | Ga0495669_0001037_8983_9852 | 272 |
| 356 | 3300046689 | Ga0495613_0031230 | Ga0495613_0031230_830_1699 | 272 |
| 357 | 3300046690 | Ga0495624_0001290 | Ga0495624_0001290_8545_9414 | 272 |
| 358 | 3300046690 | Ga0495624_0161413 | Ga0495624_0161413_226_1095 | 272 |
| 359 | 3300046691 | Ga0495670_0000914 | Ga0495670_0000914_12640_13509 | 272 |
| 360 | 3300046691 | Ga0495670_0003232 | Ga0495670_0003232_5661_6530 | 272 |
| 361 | 3300046691 | Ga0495670_0030579 | Ga0495670_0030579_1784_2653 | 272 |
| 362 | 3300046691 | Ga0495670_0134063 | Ga0495670_0134063_280_1149 | 272 |
| 363 | 3300046692 | Ga0495671_0018226 | Ga0495671_0018226_2484_3353 | 272 |
| 364 | 3300046794 | Ga0495589_0008248 | Ga0495589_0008248_1082_1951 | 272 |
| 365 | 3300046809 | Ga0495600_0006165 | Ga0495600_0006165_3745_4614 | 272 |
| 366 | 3300046810 | Ga0495660_0004560 | Ga0495660_0004560_5123_5992 | 272 |
| 367 | 3300047317 | Ga0495604_0028054 | Ga0495604_0028054_778_1647 | 272 |
| 368 | 3300047317 | Ga0495604_0076182 | Ga0495604_0076182_811_1680 | 272 |
| 369 | 3300047317 | Ga0495604_0124784 | Ga0495604_0124784_799_1731 | 272 |
| 370 | 3300047321 | Ga0495676_0015149 | Ga0495676_0015149_4194_5063 | 272 |
| 371 | 3300047323 | Ga0495683_0000009 | Ga0495683_0000009_172283_173152 | 272 |
| 372 | 3300047323 | Ga0495683_0009822 | Ga0495683_0009822_3582_4451 | 272 |
| 373 | 3300047323 | Ga0495683_0021528 | Ga0495683_0021528_2105_2974 | 272 |
| 374 | 3300047323 | Ga0495683_0029627 | Ga0495683_0029627_1668_2537 | 272 |
| 375 | 3300047443 | Ga0495687_003873 | Ga0495687_003873_2091_2960 | 272 |
| 376 | 3300047444 | Ga0495675_0025874 | Ga0495675_0025874_37_906 | 272 |
| 377 | 3300047444 | Ga0495675_0080440 | Ga0495675_0080440_227_1096 | 272 |
| 378 | 3300047445 | Ga0495677_0005865 | Ga0495677_0005865_376_1245 | 272 |
| 379 | 3300047445 | Ga0495677_0010385 | Ga0495677_0010385_1087_1956 | 272 |
| 380 | 3300047445 | Ga0495677_0107051 | Ga0495677_0107051_160_1029 | 272 |
| 381 | 3300047447 | Ga0495685_008100 | Ga0495685_008100_883_1752 | 272 |
| 382 | 3300047470 | Ga0495681_0030280 | Ga0495681_0030280_897_1766 | 272 |
| 383 | 3300047470 | Ga0495681_0089297 | Ga0495681_0089297_126_995 | 272 |
| 384 | 3300047472 | Ga0495686_0121269 | Ga0495686_0121269_653_1522 | 272 |
| 385 | 3300047673 | Ga0495593_0002312 | Ga0495593_0002312_9795_10664 | 272 |
| 386 | 3300047673 | Ga0495593_0015203 | Ga0495593_0015203_2608_3477 | 272 |
| 387 | 3300048088 | Ga0495602_0018666 | Ga0495602_0018666_368_1237 | 272 |
| 388 | 3300048091 | Ga0495626_0001381 | Ga0495626_0001381_16779_17648 | 272 |
| 389 | 3300048091 | Ga0495626_0002812 | Ga0495626_0002812_3486_4355 | 272 |
| 390 | 3300048091 | Ga0495626_0004895 | Ga0495626_0004895_6948_7817 | 272 |
| 391 | 3300048091 | Ga0495626_0017849 | Ga0495626_0017849_1229_2098 | 272 |
| 392 | 3300048905 | Ga0496102_0175083 | Ga0496102_0175083_294_1163 | 272 |
| 393 | 3300048917 | Ga0496114_0019820 | Ga0496114_0019820_548_1417 | 272 |
| 394 | 3300048918 | Ga0496115_0026720 | Ga0496115_0026720_3135_4004 | 272 |
| 395 | 3300048919 | Ga0496116_0020222 | Ga0496116_0020222_831_1700 | 272 |
| 396 | 3300048924 | Ga0496121_0077293 | Ga0496121_0077293_437_1306 | 272 |
| 397 | 3300048926 | Ga0496123_0001111 | Ga0496123_0001111_38647_39516 | 272 |
| 398 | 3300048928 | Ga0496125_0003463 | Ga0496125_0003463_13807_14676 | 272 |
| 399 | 3300048928 | Ga0496125_0041386 | Ga0496125_0041386_2619_3488 | 272 |
| 400 | 3300048929 | Ga0496126_0230986 | Ga0496126_0230986_317_1186 | 272 |
| 401 | 3300049128 | Ga0501308_002776 | Ga0501308_002776_301_1170 | 272 |
| 402 | 3300049460 | Ga0495682_0026885 | Ga0495682_0026885_592_1461 | 272 |
| 403 | 3300049528 | Ga0501312_003316 | Ga0501312_003316_671_1540 | 272 |
| 404 | 3300049551 | Ga0501335_003445 | Ga0501335_003445_88_957 | 272 |
| 405 | 3300053088 | Ga0500644_0032904 | Ga0500644_0032904_550_1419 | 272 |
| 406 | 3300053092 | Ga0500583_0140750 | Ga0500583_0140750_159_1028 | 272 |
| 407 | 3300053093 | Ga0500651_0112936 | Ga0500651_0112936_545_1414 | 272 |
| 408 | 3300053118 | Ga0500594_0004095 | Ga0500594_0004095_1519_2388 | 272 |
| 409 | 3300053136 | Ga0500559_0000049 | Ga0500559_0000049_55963_56832 | 272 |
| 410 | 3300053148 | Ga0500590_072900 | Ga0500590_072900_329_1198 | 272 |
| 411 | 3300053156 | Ga0500622_0001472 | Ga0500622_0001472_14282_15151 | 272 |
| 412 | 3300053161 | Ga0500634_0125877 | Ga0500634_0125877_94_966 | 272 |
| 413 | 2162886007 | SwRhRL2b_contig_2253570 | SwRhRL2b_0452.00003310 | 273 |
| 414 | 3300003187 | JGI25151J46595_10033725 | JGI25151J46595_100337252 | 273 |
| 415 | 3300003575 | Ga0007409J51694_1010509 | Ga0007409J51694_10105091 | 273 |
| 416 | 3300005331 | Ga0070670_100241510 | Ga0070670_1002415102 | 273 |
| 417 | 3300005355 | Ga0070671_100183725 | Ga0070671_1001837251 | 273 |
| 418 | 3300005455 | Ga0070663_100057949 | Ga0070663_1000579492 | 273 |
| 419 | 3300005456 | Ga0070678_100355931 | Ga0070678_1003559311 | 273 |
| 420 | 3300005618 | Ga0068864_100096910 | Ga0068864_1000969102 | 273 |
| 421 | 3300005841 | Ga0068863_100225639 | Ga0068863_1002256392 | 273 |
| 422 | 3300006195 | Ga0075366_10154589 | Ga0075366_101545892 | 273 |
| 423 | 3300009176 | Ga0105242_10001267 | Ga0105242_100012672 | 273 |
| 424 | 3300009177 | Ga0105248_10000345 | Ga0105248_1000034524 | 273 |
| 425 | 3300009551 | Ga0105238_10381565 | Ga0105238_103815651 | 273 |
| 426 | 3300013296 | Ga0157374_10149588 | Ga0157374_101495882 | 273 |
| 427 | 3300025931 | Ga0207644_10011700 | Ga0207644_100117006 | 273 |
| 428 | 3300025934 | Ga0207686_10001312 | Ga0207686_1000131213 | 273 |
| 429 | 3300025938 | Ga0207704_10057802 | Ga0207704_100578022 | 273 |
| 430 | 3300025940 | Ga0207691_10230160 | Ga0207691_102301602 | 273 |
| 431 | 3300025941 | Ga0207711_10003063 | Ga0207711_100030638 | 273 |
| 432 | 3300025972 | Ga0207668_10176071 | Ga0207668_101760712 | 273 |
| 433 | 3300026078 | Ga0207702_10345580 | Ga0207702_103455801 | 273 |
| 434 | 3300026088 | Ga0207641_10107360 | Ga0207641_101073602 | 273 |
| 435 | 3300026095 | Ga0207676_10076966 | Ga0207676_100769662 | 273 |
| 436 | 3300026121 | Ga0207683_10284790 | Ga0207683_102847902 | 273 |
| 437 | 3300030735 | Ga0316178_1077577 | Ga0316178_10775772 | 273 |
| 438 | 3300030736 | Ga0316180_1184120 | Ga0316180_11841202 | 273 |
| 439 | 3300031548 | Ga0307408_100275657 | Ga0307408_1002756572 | 273 |
| 440 | 3300031731 | Ga0307405_10063158 | Ga0307405_100631582 | 273 |
| 441 | 3300032002 | Ga0307416_100048983 | Ga0307416_1000489833 | 273 |
| 442 | 3300037418 | Ga0395900_0244956 | Ga0395900_0244956_392_1273 | 273 |
| 443 | 3300039447 | Ga0436361_0004183 | Ga0436361_0004183_1994_2860 | 273 |
| 444 | 3300041404 | Ga0439436_0017201 | Ga0439436_0017201_610_1485 | 273 |
| 445 | 3300041406 | Ga0439439_0016591 | Ga0439439_0016591_41_916 | 273 |
| 446 | 3300041411 | Ga0439466_0021347 | Ga0439466_0021347_401_1276 | 273 |
| 447 | 3300041997 | Ga0439431_0032607 | Ga0439431_0032607_409_1284 | 273 |
| 448 | 3300042004 | Ga0439445_0024840 | Ga0439445_0024840_54_929 | 273 |
| 449 | 3300042010 | Ga0439452_031484 | Ga0439452_031484_191_1066 | 273 |
| 450 | 3300042131 | Ga0450894_004078 | Ga0450894_004078_382_1257 | 273 |
| 451 | 3300042134 | Ga0450898_018864 | Ga0450898_018864_231_1106 | 273 |
| 452 | 3300042145 | Ga0450906_013385 | Ga0450906_013385_516_1391 | 273 |
| 453 | 3300044658 | Ga0466972_0030647 | Ga0466972_0030647_757_1638 | 273 |
| 454 | 3300044683 | Ga0466965_0032455 | Ga0466965_0032455_691_1566 | 273 |
| 455 | 3300046452 | Ga0495617_000179 | Ga0495617_000179_38247_39128 | 273 |
| 456 | 3300046453 | Ga0495627_022240 | Ga0495627_022240_570_1451 | 273 |
| 457 | 3300046457 | Ga0495590_0000072 | Ga0495590_0000072_956_1837 | 273 |
| 458 | 3300046474 | Ga0495605_0000400 | Ga0495605_0000400_649_1530 | 273 |
| 459 | 3300046492 | Ga0495585_0032845 | Ga0495585_0032845_1368_2249 | 273 |
| 460 | 3300046492 | Ga0495585_0061007 | Ga0495585_0061007_582_1463 | 273 |
| 461 | 3300046492 | Ga0495585_0115671 | Ga0495585_0115671_27_908 | 273 |
| 462 | 3300046499 | Ga0495594_0020790 | Ga0495594_0020790_2316_3197 | 273 |
| 463 | 3300046500 | Ga0495596_0025299 | Ga0495596_0025299_1234_2115 | 273 |
| 464 | 3300046500 | Ga0495596_0053807 | Ga0495596_0053807_615_1496 | 273 |
| 465 | 3300046501 | Ga0495607_0024066 | Ga0495607_0024066_254_1135 | 273 |
| 466 | 3300046501 | Ga0495607_0086222 | Ga0495607_0086222_366_1247 | 273 |
| 467 | 3300046512 | Ga0495610_0000400 | Ga0495610_0000400_972_1853 | 273 |
| 468 | 3300046513 | Ga0495616_0041061 | Ga0495616_0041061_873_1754 | 273 |
| 469 | 3300046513 | Ga0495616_0050622 | Ga0495616_0050622_422_1303 | 273 |
| 470 | 3300046513 | Ga0495616_0051322 | Ga0495616_0051322_392_1273 | 273 |
| 471 | 3300046518 | Ga0495631_0050460 | Ga0495631_0050460_366_1247 | 273 |
| 472 | 3300046519 | Ga0495632_0000447 | Ga0495632_0000447_37259_38140 | 273 |
| 473 | 3300046520 | Ga0495637_0000003 | Ga0495637_0000003_366430_367311 | 273 |
| 474 | 3300046523 | Ga0495644_0005175 | Ga0495644_0005175_3793_4674 | 273 |
| 475 | 3300046524 | Ga0495648_0000451 | Ga0495648_0000451_662_1543 | 273 |
| 476 | 3300046524 | Ga0495648_0083888 | Ga0495648_0083888_366_1247 | 273 |
| 477 | 3300046525 | Ga0495663_0033585 | Ga0495663_0033585_322_1197 | 273 |
| 478 | 3300046526 | Ga0495666_0041586 | Ga0495666_0041586_577_1452 | 273 |
| 479 | 3300046528 | Ga0495642_0012390 | Ga0495642_0012390_1186_2067 | 273 |
| 480 | 3300046528 | Ga0495642_0094716 | Ga0495642_0094716_95_976 | 273 |
| 481 | 3300046530 | Ga0495654_0073221 | Ga0495654_0073221_549_1430 | 273 |
| 482 | 3300046531 | Ga0495665_0072572 | Ga0495665_0072572_362_1237 | 273 |
| 483 | 3300046533 | Ga0495640_0148136 | Ga0495640_0148136_348_1223 | 273 |
| 484 | 3300046537 | Ga0495598_0019470 | Ga0495598_0019470_498_1376 | 273 |
| 485 | 3300046538 | Ga0495609_0056352 | Ga0495609_0056352_848_1729 | 273 |
| 486 | 3300046542 | Ga0495597_0017154 | Ga0495597_0017154_915_1796 | 273 |
| 487 | 3300046542 | Ga0495597_0040465 | Ga0495597_0040465_616_1491 | 273 |
| 488 | 3300046543 | Ga0495645_0235786 | Ga0495645_0235786_111_983 | 273 |
| 489 | 3300046557 | Ga0495622_0063308 | Ga0495622_0063308_523_1398 | 273 |
| 490 | 3300046616 | Ga0495668_0084689 | Ga0495668_0084689_648_1529 | 273 |
| 491 | 3300046616 | Ga0495668_0098753 | Ga0495668_0098753_530_1411 | 273 |
| 492 | 3300046648 | Ga0495611_0028892 | Ga0495611_0028892_864_1745 | 273 |
| 493 | 3300046648 | Ga0495611_0035329 | Ga0495611_0035329_840_1721 | 273 |
| 494 | 3300046663 | Ga0495635_0150537 | Ga0495635_0150537_566_1441 | 273 |
| 495 | 3300046663 | Ga0495635_0156145 | Ga0495635_0156145_539_1414 | 273 |
| 496 | 3300046665 | Ga0495661_0157119 | Ga0495661_0157119_42_923 | 273 |
| 497 | 3300046679 | Ga0495623_0093626 | Ga0495623_0093626_405_1280 | 273 |
| 498 | 3300046684 | Ga0495669_0104078 | Ga0495669_0104078_229_1110 | 273 |
| 499 | 3300046691 | Ga0495670_0083158 | Ga0495670_0083158_165_1046 | 273 |
| 500 | 3300046692 | Ga0495671_0022422 | Ga0495671_0022422_981_1862 | 273 |
| 501 | 3300046692 | Ga0495671_0045770 | Ga0495671_0045770_459_1340 | 273 |
| 502 | 3300046694 | Ga0495649_0109701 | Ga0495649_0109701_28_909 | 273 |
| 503 | 3300046794 | Ga0495589_0052777 | Ga0495589_0052777_366_1247 | 273 |
| 504 | 3300046794 | Ga0495589_0058348 | Ga0495589_0058348_36_917 | 273 |
| 505 | 3300046794 | Ga0495589_0066536 | Ga0495589_0066536_856_1737 | 273 |
| 506 | 3300047317 | Ga0495604_0337219 | Ga0495604_0337219_93_968 | 273 |
| 507 | 3300047320 | Ga0495672_0000565 | Ga0495672_0000565_39984_40865 | 273 |
| 508 | 3300047321 | Ga0495676_0120604 | Ga0495676_0120604_458_1333 | 273 |
| 509 | 3300047323 | Ga0495683_0000470 | Ga0495683_0000470_29792_30673 | 273 |
| 510 | 3300047323 | Ga0495683_0044908 | Ga0495683_0044908_693_1574 | 273 |
| 511 | 3300047443 | Ga0495687_000117 | Ga0495687_000117_63352_64233 | 273 |
| 512 | 3300047443 | Ga0495687_013939 | Ga0495687_013939_2315_3196 | 273 |
| 513 | 3300047444 | Ga0495675_0175936 | Ga0495675_0175936_341_1216 | 273 |
| 514 | 3300047445 | Ga0495677_0023711 | Ga0495677_0023711_664_1545 | 273 |
| 515 | 3300047445 | Ga0495677_0033246 | Ga0495677_0033246_28_909 | 273 |
| 516 | 3300047447 | Ga0495685_022776 | Ga0495685_022776_638_1519 | 273 |
| 517 | 3300047470 | Ga0495681_0053592 | Ga0495681_0053592_530_1411 | 273 |
| 518 | 3300047470 | Ga0495681_0087727 | Ga0495681_0087727_21_902 | 273 |
| 519 | 3300047673 | Ga0495593_0113490 | Ga0495593_0113490_166_1041 | 273 |
| 520 | 3300048091 | Ga0495626_0023413 | Ga0495626_0023413_1181_2062 | 273 |
| 521 | 3300048905 | Ga0496102_0000854 | Ga0496102_0000854_961_1842 | 273 |
| 522 | 3300048905 | Ga0496102_0352308 | Ga0496102_0352308_397_1269 | 273 |
| 523 | 3300048907 | Ga0496104_0163453 | Ga0496104_0163453_1034_1906 | 273 |
| 524 | 3300048908 | Ga0496105_0270880 | Ga0496105_0270880_353_1225 | 273 |
| 525 | 3300048911 | Ga0496108_0168930 | Ga0496108_0168930_214_1086 | 273 |
| 526 | 3300048912 | Ga0496109_0184910 | Ga0496109_0184910_404_1276 | 273 |
| 527 | 3300048915 | Ga0496112_0009014 | Ga0496112_0009014_6780_7652 | 273 |
| 528 | 3300048915 | Ga0496112_0193496 | Ga0496112_0193496_417_1298 | 273 |
| 529 | 3300049130 | Ga0501310_001960 | Ga0501310_001960_574_1449 | 273 |
| 530 | 3300049459 | Ga0495678_028129 | Ga0495678_028129_986_1867 | 273 |
| 531 | 3300049460 | Ga0495682_0000286 | Ga0495682_0000286_807_1688 | 273 |
| 532 | 3300049536 | Ga0501320_000823 | Ga0501320_000823_705_1580 | 273 |
| 533 | 3300050489 | nmdc:mga03683_31053_c1 | nmdc:mga03683_31053_c1_425_1300 | 273 |
| 534 | 3300050496 | nmdc:mga07m45_115090_c1 | nmdc:mga07m45_115090_c1_306_1181 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fs0-assembly1.cif.gz_G | complex of gamma/epsilon atp synthase from e.coli | 0.9261 | 6 | 233 |
| 1fs0-assembly1.cif.gz_G | complex of gamma/epsilon atp synthase from e.coli | 0.91 | 6 | 233 |
| 7nkn-assembly1.cif.gz_G | mycobacterium smegmatis atp synthase rotor state 3 | 0.8638 | 3 | 239 |
| 5zwl-assembly1.cif.gz_G | crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase | 0.856 | 13 | 235 |
| 5hkk-assembly2.cif.gz_O | caldalaklibacillus thermarum f1-atpase (wild type) | 0.8308 | 3 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oaaG02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9457 | 47 | 178 | 3.40.1380.10 |
| 1fs0G01 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9451 | 48 | 177 | 3.40.1380.10 |
| 1fs0G01 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9381 | 48 | 177 | 3.40.1380.10 |
| af_Q2FWE9_9_222_3.40.1380.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9186 | 18 | 230 | 3.40.1380.10 |
| 2qe7G02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.91 | 49 | 178 | 3.40.1380.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P8H924-F1-model_v4 | deleted | 0.9604 | 51 | 161 |
|
| AF-A0A011PFB0-F1-model_v4 | F-ATPase gamma subunit | 0.9565 | 14 | 155 |
GO:0045261
GO:0046933 |
| AF-A0A7W2GEH4-F1-model_v4 | deleted | 0.955 | 14 | 176 |
|
| AF-A0A0P8H924-F1-model_v4 | deleted | 0.9521 | 51 | 161 |
|
| AF-H6UJB5-F1-model_v4 | ATP synthase F1 subunit gamma | 0.9377 | 11 | 154 |
GO:0045261
GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar