F460542

General Info

Members Datasets Scaffolds Average Seq Length
534 316 499 287

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10074827|Ga0182007_100748272
Length 290
Sequence MATGKEIRSKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPYSDKIRNIASNLSQANPEYTHPFMVKQDNSKNVGFIVVTTDKGLCGGMNTNSLRLLTAKLRELEGQGNKVQAVAIGNKGLGFLHRIGAKVVAHAVQLGDTPHLDKLIGPVKVLLDAYQEGRLDAVYLVYTKFINTMKQEPMLQQLLPLSSDRLEADKEGSHSWDYIYEPDVQSVIDELLVRYVEALIYQAVAENMASEQSARMVAMKSASDNAGNVIGELKLVYNKTRQAAITKELSEIVAGAAAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2547132374 Acidovorax radicis N35 Isolate Unclassified
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
15 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
16 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
17 2816332133 Acidovorax radicis 2721A Isolate Unclassified
18 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
19 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
20 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
21 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
22 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
23 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
24 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
25 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
26 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
27 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
28 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
29 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
30 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
31 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
32 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
33 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
34 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
35 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
36 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
39 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
40 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
41 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
44 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
45 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
107 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
171 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
195 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
196 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
197 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.45
Metatranscriptomes 3
Isolates 6.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.68
Nodule 0.37
Rhizoplane 2.43
Rhizosphere 80.9
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2253570 2162886007 Bacteria 2247
2 JGI25156J39149_1013055 3300002705 Bacteria 1786
3 JGI25162J39368_1004905 3300002737 Bacteria 2866
4 JGI25157J39369_1003315 3300002741 Bacteria 3342
5 JGI25150J39212_1002629 3300002774 Bacteria 4410
6 Ga0006759J45824_1023789 3300003163 Bacteria 5943
7 JGI25151J46595_10033725 3300003187 Bacteria 1967
8 Ga0007410J51695_1012491 3300003574 Bacteria 7287
9 Ga0007409J51694_1005570 3300003575 Bacteria 8896
10 Ga0007409J51694_1010509 3300003575 Bacteria 1788
11 Ga0007416J51690_1018405 3300003577 Bacteria 5758
12 Ga0032354_1014770 3300003693 Bacteria 7120
13 Ga0055538_1000789 3300003751 Bacteria 8797
14 Ga0055539_1000685 3300003752 Bacteria 8797
15 Ga0055533_1000922 3300003756 Bacteria 8797
16 Ga0055532_1000130 3300003758 Bacteria 74140
17 Ga0055525_1000057 3300003759 Bacteria 211185
18 Ga0055525_1000869 3300003759 Bacteria 8797
19 Ga0055526_1000812 3300003771 Bacteria 23272
20 Ga0055541_1000684 3300003841 Bacteria 8797
21 Ga0070658_10320945 3300005327 Bacteria 1322
22 Ga0070670_100096928 3300005331 Bacteria 2537
23 Ga0070670_100186620 3300005331 Bacteria 1800
24 Ga0070670_100199869 3300005331 Bacteria 1737
25 Ga0070670_100241510 3300005331 Bacteria 1572
26 Ga0068869_100006248 3300005334 Bacteria 7545
27 Ga0070682_100004311 3300005337 Bacteria 7899
28 Ga0068868_100196094 3300005338 Bacteria 1681
29 Ga0070660_100005023 3300005339 Bacteria 9144
30 Ga0070687_100089131 3300005343 Bacteria 1702
31 Ga0070661_100004150 3300005344 Bacteria 9993
32 Ga0070661_100189435 3300005344 Bacteria 1568
33 Ga0070661_100227193 3300005344 Bacteria 1433
34 Ga0070675_100116592 3300005354 Bacteria 2265
35 Ga0070675_100173927 3300005354 Bacteria 1858
36 Ga0070675_100250703 3300005354 Bacteria 1549
37 Ga0070671_100119610 3300005355 Bacteria 2216
38 Ga0070671_100183725 3300005355 Bacteria 1771
39 Ga0070671_100339946 3300005355 Bacteria 1280
40 Ga0070673_100088990 3300005364 Bacteria 2519
41 Ga0070673_100224676 3300005364 Bacteria 1627
42 Ga0070659_100093181 3300005366 Bacteria 2417
43 Ga0070663_100057949 3300005455 Bacteria 2780
44 Ga0070678_100231926 3300005456 Bacteria 1539
45 Ga0070678_100355931 3300005456 Bacteria 1260
46 Ga0070662_100276359 3300005457 Bacteria 1358
47 Ga0068867_100029088 3300005459 Bacteria 3981
48 Ga0068853_100295498 3300005539 Bacteria 1496
49 Ga0070672_100072428 3300005543 Bacteria 2743
50 Ga0070672_100074874 3300005543 Bacteria 2701
51 Ga0070672_100369350 3300005543 Bacteria 1225
52 Ga0068855_100153371 3300005563 Bacteria 2618
53 Ga0068857_100021833 3300005577 Bacteria 5633
54 Ga0068854_100027132 3300005578 Bacteria 3944
55 Ga0068856_100214586 3300005614 Bacteria 1940
56 Ga0068852_100127644 3300005616 Bacteria 2338
57 Ga0068852_100465649 3300005616 Bacteria 1254
58 Ga0068864_100096910 3300005618 Bacteria 2611
59 Ga0068864_100158444 3300005618 Bacteria 2056
60 Ga0068864_100265661 3300005618 Bacteria 1597
61 Ga0068851_10061043 3300005834 Bacteria 1931
62 Ga0068851_10088823 3300005834 Bacteria 1625
63 Ga0068870_10150755 3300005840 Bacteria 1369
64 Ga0068863_100225639 3300005841 Bacteria 1806
65 Ga0070712_100074634 3300006175 Bacteria 2437
66 Ga0075366_10154589 3300006195 Bacteria 1389
67 Ga0097621_100311852 3300006237 Bacteria 1392
68 Ga0075370_10090261 3300006353 Bacteria 1767
69 Ga0068865_100103803 3300006881 Bacteria 2085
70 Ga0105251_10031554 3300009011 Bacteria 2649
71 Ga0105240_10016732 3300009093 Bacteria 9920
72 Ga0105240_10019169 3300009093 Bacteria 9147
73 Ga0105240_10285223 3300009093 Bacteria 1895
74 Ga0105245_10371155 3300009098 Bacteria 1422
75 Ga0105243_10218372 3300009148 Bacteria 1683
76 Ga0105242_10001267 3300009176 Bacteria 19954
77 Ga0105248_10000345 3300009177 Bacteria 54458
78 Ga0105248_10252864 3300009177 Bacteria 1983
79 Ga0105238_10000038 3300009551 Bacteria 162920
80 Ga0105238_10027954 3300009551 Bacteria 5747
81 Ga0105238_10381565 3300009551 Bacteria 1401
82 Ga0105239_10000303 3300010375 Bacteria 72769
83 Ga0105239_10926396 3300010375 Bacteria 1000
84 Ga0157369_10228373 3300013105 Bacteria 1946
85 Ga0157374_10149588 3300013296 Bacteria 2269
86 Ga0157374_10312513 3300013296 Bacteria 1556
87 Ga0157378_10167028 3300013297 Bacteria 2062
88 Ga0163162_10389945 3300013306 Bacteria 1525
89 Ga0163162_10768915 3300013306 Bacteria 1082
90 Ga0157375_10635165 3300013308 Bacteria 1225
91 Ga0157375_10786323 3300013308 Bacteria 1101
92 Ga0157380_10081632 3300014326 Bacteria 2645
93 Ga0182008_10012205 3300014497 Bacteria 4540
94 Ga0157376_10379363 3300014969 Bacteria 1361
95 Ga0182006_1013512 3300015261 Bacteria 3541
96 Ga0182007_10074827 3300015262 Bacteria 1110
97 Ga0163161_10087909 3300017792 Bacteria 2296
98 Ga0213872_10000122 3300021361 Bacteria 73335
99 Ga0213872_10000383 3300021361 Bacteria 37014
100 Ga0213872_10001440 3300021361 Bacteria 15506
101 Ga0213872_10064024 3300021361 Bacteria 1661
102 Ga0209435_100046 3300025206 Bacteria 95081
103 Ga0209784_100018 3300025224 Bacteria 456816
104 Ga0209566_100016 3300025225 Bacteria 456824
105 Ga0209674_100030 3300025226 Bacteria 456824
106 Ga0209147_100157 3300025229 Bacteria 92005
107 Ga0209563_100014 3300025230 Bacteria 940582
108 Ga0209563_100034 3300025230 Bacteria 456824
109 Ga0209437_100260 3300025233 Bacteria 82215
110 Ga0209258_100768 3300025242 Bacteria 19750
111 Ga0207425_1000200 3300025245 Bacteria 47894
112 Ga0209646_1000156 3300025246 Bacteria 95083
113 Ga0209646_1004576 3300025246 Bacteria 2501
114 Ga0209026_1000966 3300025250 Bacteria 14332
115 Ga0209026_1009580 3300025250 Bacteria 1888
116 Ga0209677_100019 3300025253 Bacteria 456824
117 Ga0209759_1006432 3300025256 Bacteria 3945
118 Ga0209759_1013237 3300025256 Bacteria 2242
119 Ga0209129_1000113 3300025258 Bacteria 145178
120 Ga0209455_1004795 3300025272 Bacteria 4329
121 Ga0209673_1032710 3300025273 Bacteria 1599
122 Ga0209564_1000186 3300025295 Bacteria 147120
123 Ga0209758_1000172 3300025297 Bacteria 147763
124 Ga0209256_1017807 3300025299 Bacteria 2340
125 Ga0209257_1036451 3300025304 Bacteria 1510
126 Ga0207697_10081534 3300025315 Bacteria 1363
127 Ga0207656_10099140 3300025321 Bacteria 1333
128 Ga0207713_1017647 3300025735 Bacteria 3567
129 Ga0207688_10067100 3300025901 Bacteria 2030
130 Ga0207688_10099218 3300025901 Bacteria 1680
131 Ga0207680_10157647 3300025903 Bacteria 1519
132 Ga0207645_10001670 3300025907 Bacteria 18048
133 Ga0207643_10091435 3300025908 Bacteria 1775
134 Ga0207695_10002989 3300025913 Bacteria 24306
135 Ga0207695_10005091 3300025913 Bacteria 17616
136 Ga0207695_10069594 3300025913 Bacteria 3601
137 Ga0207671_10003973 3300025914 Bacteria 14375
138 Ga0207693_10087277 3300025915 Bacteria 2444
139 Ga0207662_10072849 3300025918 Bacteria 2083
140 Ga0207657_10037075 3300025919 Bacteria 4359
141 Ga0207657_10122110 3300025919 Bacteria 2143
142 Ga0207649_10142022 3300025920 Bacteria 1644
143 Ga0207681_10233323 3300025923 Bacteria 1429
144 Ga0207694_10000126 3300025924 Bacteria 79243
145 Ga0207650_10044775 3300025925 Bacteria 3253
146 Ga0207650_10179470 3300025925 Bacteria 1687
147 Ga0207659_10039375 3300025926 Bacteria 3296
148 Ga0207659_10144227 3300025926 Bacteria 1852
149 Ga0207644_10011700 3300025931 Bacteria 5809
150 Ga0207644_10090202 3300025931 Bacteria 2283
151 Ga0207644_10279324 3300025931 Bacteria 1340
152 Ga0207644_10332034 3300025931 Bacteria 1231
153 Ga0207644_10385545 3300025931 Bacteria 1143
154 Ga0207690_10019191 3300025932 Bacteria 4204
155 Ga0207706_10278658 3300025933 Bacteria 1458
156 Ga0207706_10311251 3300025933 Bacteria 1371
157 Ga0207686_10001312 3300025934 Bacteria 14245
158 Ga0207709_10217485 3300025935 Bacteria 1376
159 Ga0207669_10268778 3300025937 Bacteria 1279
160 Ga0207704_10057802 3300025938 Bacteria 2385
161 Ga0207691_10020222 3300025940 Bacteria 6296
162 Ga0207691_10111276 3300025940 Bacteria 2435
163 Ga0207691_10230160 3300025940 Bacteria 1605
164 Ga0207711_10003063 3300025941 Bacteria 14599
165 Ga0207689_10097654 3300025942 Bacteria 2413
166 Ga0207679_10176435 3300025945 Bacteria 1764
167 Ga0207679_10209350 3300025945 Bacteria 1634
168 Ga0207667_10023820 3300025949 Bacteria 6737
169 Ga0207668_10155440 3300025972 Bacteria 1776
170 Ga0207668_10176071 3300025972 Bacteria 1683
171 Ga0207658_10443187 3300025986 Bacteria 1148
172 Ga0207677_10047287 3300026023 Bacteria 2888
173 Ga0207677_10061609 3300026023 Bacteria 2599
174 Ga0207678_10178930 3300026067 Bacteria 1811
175 Ga0207702_10209051 3300026078 Bacteria 1813
176 Ga0207702_10345580 3300026078 Bacteria 1422
177 Ga0207641_10107360 3300026088 Bacteria 2469
178 Ga0207641_10457619 3300026088 Bacteria 1234
179 Ga0207648_10041042 3300026089 Bacteria 4064
180 Ga0207676_10076966 3300026095 Bacteria 2697
181 Ga0207674_10025311 3300026116 Bacteria 6333
182 Ga0207683_10206485 3300026121 Bacteria 1787
183 Ga0207683_10284790 3300026121 Bacteria 1510
184 Ga0207683_10427586 3300026121 Bacteria 1220
185 Ga0207698_10005617 3300026142 Bacteria 7763
186 Ga0207698_10352119 3300026142 Bacteria 1391
187 Ga0207698_10450556 3300026142 Bacteria 1242
188 Ga0209974_10006131 3300027876 Bacteria 4211
189 Ga0268266_10143438 3300028379 Bacteria 2145
190 Ga0307517_10017098 3300028786 Bacteria 9474
191 Ga0307515_10083575 3300028794 Bacteria 4113
192 Ga0316178_1077577 3300030735 Bacteria 2246
193 Ga0316180_1184120 3300030736 Bacteria 1399
194 Ga0265331_10019062 3300031250 Bacteria 3546
195 Ga0265327_10000444 3300031251 Bacteria 74908
196 Ga0307513_10117942 3300031456 Bacteria 2630
197 Ga0307513_10283324 3300031456 Bacteria 1433
198 Ga0307509_10082422 3300031507 Bacteria 3318
199 Ga0307408_100103678 3300031548 Bacteria 2172
200 Ga0307408_100275657 3300031548 Bacteria 1398
201 Ga0307508_10000134 3300031616 Bacteria 87501
202 Ga0307508_10000524 3300031616 Bacteria 45505
203 Ga0307514_10136187 3300031649 Bacteria 1680
204 Ga0307516_10125492 3300031730 Bacteria 2352
205 Ga0307405_10063158 3300031731 Bacteria 2347
206 Ga0307405_10377228 3300031731 Bacteria 1103
207 Ga0307416_100048983 3300032002 Bacteria 3356
208 Ga0307416_100330304 3300032002 Bacteria 1532
209 Ga0307510_10005730 3300033180 Bacteria 14803
210 Ga0373935_0142955 3300035692 Bacteria 1618
211 Ga0395899_0257708 3300037312 Bacteria 1194
212 Ga0395900_0191021 3300037418 Bacteria 2077
213 Ga0395900_0244956 3300037418 Bacteria 1796
214 Ga0395900_0412592 3300037418 Bacteria 1312
215 Ga0395905_0004181 3300037471 Bacteria 15097
216 Ga0395905_0004203 3300037471 Bacteria 15072
217 Ga0395905_0013567 3300037471 Bacteria 7806
218 Ga0395905_0502160 3300037471 Bacteria 1113
219 Ga0436361_0004183 3300039447 Bacteria 8394
220 Ga0436361_0066651 3300039447 Bacteria 2993
221 Ga0436361_0108001 3300039447 Bacteria 112244
222 Ga0436361_0264437 3300039447 Bacteria 60444
223 Ga0436361_0619669 3300039447 Bacteria 2501
224 Ga0436361_0709165 3300039447 Bacteria 3379
225 Ga0436361_0813098 3300039447 Bacteria 136133
226 Ga0439436_0017201 3300041404 Bacteria 2164
227 Ga0439436_0022428 3300041404 Bacteria 1870
228 Ga0439439_0016591 3300041406 Bacteria 1805
229 Ga0439466_0021347 3300041411 Bacteria 2296
230 Ga0439431_0032607 3300041997 Bacteria 1299
231 Ga0439445_0024840 3300042004 Bacteria 1525
232 Ga0439432_054416 3300042006 Bacteria 1243
233 Ga0439452_031484 3300042010 Bacteria 1301
234 Ga0450894_004078 3300042131 Bacteria 1906
235 Ga0450898_018864 3300042134 Bacteria 1198
236 Ga0450906_013385 3300042145 Bacteria 1511
237 Ga0466972_0000825 3300044658 Bacteria 14821
238 Ga0466972_0030647 3300044658 Bacteria 2647
239 Ga0466972_0091952 3300044658 Bacteria 1438
240 Ga0466965_0000541 3300044683 Bacteria 13647
241 Ga0466965_0032455 3300044683 Bacteria 2550
242 Ga0466970_0067315 3300044765 Bacteria 1923
243 Ga0466957_0101619 3300044842 Bacteria 1813
244 Ga0466959_0202289 3300045049 Bacteria 1382
245 Ga0495617_000179 3300046452 Bacteria 40095
246 Ga0495617_000885 3300046452 Bacteria 14097
247 Ga0495627_022240 3300046453 Bacteria 2088
248 Ga0495592_0000320 3300046454 Bacteria 40220
249 Ga0495592_0143691 3300046454 Bacteria 1657
250 Ga0495603_0199056 3300046455 Bacteria 1158
251 Ga0495590_0000072 3300046457 Bacteria 70857
252 Ga0495629_0090529 3300046459 Bacteria 2134
253 Ga0495638_0007395 3300046460 Bacteria 7882
254 Ga0495651_0145136 3300046462 Bacteria 1716
255 Ga0495653_0136138 3300046463 Bacteria 1732
256 Ga0495653_0309645 3300046463 Bacteria 1027
257 Ga0495580_0032566 3300046472 Bacteria 3761
258 Ga0495580_0239858 3300046472 Bacteria 1243
259 Ga0495582_0054210 3300046473 Bacteria 2212
260 Ga0495582_0334435 3300046473 Bacteria 872
261 Ga0495605_0000400 3300046474 Bacteria 39776
262 Ga0495605_0039256 3300046474 Bacteria 2372
263 Ga0495605_0107058 3300046474 Bacteria 1279
264 Ga0495639_0047574 3300046475 Bacteria 1944
265 Ga0495584_0000001 3300046491 Bacteria 649329
266 Ga0495584_0000434 3300046491 Bacteria 28794
267 Ga0495584_0036935 3300046491 Bacteria 2467
268 Ga0495584_0039249 3300046491 Bacteria 2392
269 Ga0495584_0049269 3300046491 Bacteria 2122
270 Ga0495584_0056432 3300046491 Bacteria 1976
271 Ga0495584_0069936 3300046491 Bacteria 1764
272 Ga0495584_0182030 3300046491 Bacteria 1068
273 Ga0495585_0000002 3300046492 Bacteria 529316
274 Ga0495585_0000026 3300046492 Bacteria 148243
275 Ga0495585_0002790 3300046492 Bacteria 12176
276 Ga0495585_0006880 3300046492 Bacteria 7009
277 Ga0495585_0013940 3300046492 Bacteria 4695
278 Ga0495585_0022958 3300046492 Bacteria 3581
279 Ga0495585_0024985 3300046492 Bacteria 3424
280 Ga0495585_0032845 3300046492 Bacteria 2938
281 Ga0495585_0054879 3300046492 Bacteria 2202
282 Ga0495585_0061007 3300046492 Bacteria 2074
283 Ga0495585_0115671 3300046492 Bacteria 1422
284 Ga0495585_0237037 3300046492 Bacteria 915
285 Ga0495594_0000459 3300046499 Bacteria 20756
286 Ga0495594_0020790 3300046499 Bacteria 3498
287 Ga0495596_0000149 3300046500 Bacteria 48579
288 Ga0495596_0008791 3300046500 Bacteria 4471
289 Ga0495596_0011580 3300046500 Bacteria 3797
290 Ga0495596_0012741 3300046500 Bacteria 3588
291 Ga0495596_0025299 3300046500 Bacteria 2400
292 Ga0495596_0053807 3300046500 Bacteria 1575
293 Ga0495607_0024066 3300046501 Bacteria 3801
294 Ga0495607_0086222 3300046501 Bacteria 1712
295 Ga0495607_0110230 3300046501 Bacteria 1460
296 Ga0495583_0000009 3300046506 Bacteria 372527
297 Ga0495583_0015888 3300046506 Bacteria 4072
298 Ga0495606_0003300 3300046507 Bacteria 17230
299 Ga0495606_0011711 3300046507 Bacteria 7119
300 Ga0495606_0013480 3300046507 Bacteria 6451
301 Ga0495606_0056394 3300046507 Bacteria 2536
302 Ga0495608_0009994 3300046511 Bacteria 6623
303 Ga0495610_0000400 3300046512 Bacteria 45021
304 Ga0495616_0000616 3300046513 Bacteria 26772
305 Ga0495616_0004636 3300046513 Bacteria 8631
306 Ga0495616_0024211 3300046513 Bacteria 3258
307 Ga0495616_0041061 3300046513 Bacteria 2361
308 Ga0495616_0050622 3300046513 Bacteria 2076
309 Ga0495616_0051322 3300046513 Bacteria 2057
310 Ga0495618_0189665 3300046514 Bacteria 1304
311 Ga0495620_0003122 3300046515 Bacteria 9516
312 Ga0495628_0009618 3300046516 Bacteria 8248
313 Ga0495631_0050460 3300046518 Bacteria 1819
314 Ga0495632_0000447 3300046519 Bacteria 39298
315 Ga0495632_0006352 3300046519 Bacteria 7623
316 Ga0495637_0000003 3300046520 Bacteria 623293
317 Ga0495643_0006229 3300046522 Bacteria 7910
318 Ga0495643_0038091 3300046522 Bacteria 2634
319 Ga0495644_0005175 3300046523 Bacteria 5104
320 Ga0495648_0000012 3300046524 Bacteria 294111
321 Ga0495648_0000451 3300046524 Bacteria 44465
322 Ga0495648_0075765 3300046524 Bacteria 1934
323 Ga0495648_0083888 3300046524 Bacteria 1804
324 Ga0495663_0033585 3300046525 Bacteria 1532
325 Ga0495663_0050747 3300046525 Bacteria 1283
326 Ga0495666_0004810 3300046526 Bacteria 6827
327 Ga0495666_0031370 3300046526 Bacteria 2604
328 Ga0495666_0041586 3300046526 Bacteria 2225
329 Ga0495666_0041664 3300046526 Bacteria 2223
330 Ga0495666_0042326 3300046526 Bacteria 2202
331 Ga0495666_0068890 3300046526 Bacteria 1684
332 Ga0495642_0005181 3300046528 Bacteria 5014
333 Ga0495642_0012390 3300046528 Bacteria 3287
334 Ga0495642_0017412 3300046528 Bacteria 2807
335 Ga0495642_0028012 3300046528 Bacteria 2242
336 Ga0495642_0066485 3300046528 Bacteria 1502
337 Ga0495642_0094716 3300046528 Bacteria 1266
338 Ga0495652_0109209 3300046529 Bacteria 2227
339 Ga0495654_0073221 3300046530 Bacteria 1620
340 Ga0495665_0029505 3300046531 Bacteria 2938
341 Ga0495665_0060938 3300046531 Bacteria 1992
342 Ga0495665_0072572 3300046531 Bacteria 1812
343 Ga0495640_0148136 3300046533 Bacteria 1509
344 Ga0495586_0003588 3300046535 Bacteria 8312
345 Ga0495586_0036809 3300046535 Bacteria 2626
346 Ga0495587_0008957 3300046536 Bacteria 6423
347 Ga0495598_0019470 3300046537 Bacteria 1781
348 Ga0495598_0068999 3300046537 Bacteria 1109
349 Ga0495609_0033334 3300046538 Bacteria 2338
350 Ga0495609_0046710 3300046538 Bacteria 1938
351 Ga0495609_0056352 3300046538 Bacteria 1741
352 Ga0495597_0017154 3300046542 Bacteria 3412
353 Ga0495597_0039290 3300046542 Bacteria 2119
354 Ga0495597_0040465 3300046542 Bacteria 2083
355 Ga0495645_0235786 3300046543 Bacteria 1223
356 Ga0495622_0001203 3300046557 Bacteria 13333
357 Ga0495622_0017177 3300046557 Bacteria 3368
358 Ga0495622_0063308 3300046557 Bacteria 1711
359 Ga0495633_0007168 3300046558 Bacteria 6463
360 Ga0495633_0008638 3300046558 Bacteria 5719
361 Ga0495633_0021618 3300046558 Bacteria 3215
362 Ga0495633_0022792 3300046558 Bacteria 3110
363 Ga0495656_0000268 3300046615 Bacteria 18431
364 Ga0495656_0066880 3300046615 Bacteria 1584
365 Ga0495656_0068636 3300046615 Bacteria 1568
366 Ga0495656_0143283 3300046615 Bacteria 1148
367 Ga0495668_0005031 3300046616 Bacteria 9110
368 Ga0495668_0028953 3300046616 Bacteria 3130
369 Ga0495668_0030455 3300046616 Bacteria 3046
370 Ga0495668_0057554 3300046616 Bacteria 2145
371 Ga0495668_0084689 3300046616 Bacteria 1738
372 Ga0495668_0098753 3300046616 Bacteria 1597
373 Ga0495611_0003947 3300046648 Bacteria 6449
374 Ga0495611_0010140 3300046648 Bacteria 3986
375 Ga0495611_0028892 3300046648 Bacteria 2430
376 Ga0495611_0035329 3300046648 Bacteria 2213
377 Ga0495625_0039489 3300046660 Bacteria 3446
378 Ga0495635_0150537 3300046663 Bacteria 1584
379 Ga0495635_0156145 3300046663 Bacteria 1553
380 Ga0495635_0165816 3300046663 Bacteria 1503
381 Ga0495661_0005389 3300046665 Bacteria 9092
382 Ga0495661_0005963 3300046665 Bacteria 8600
383 Ga0495661_0009548 3300046665 Bacteria 6654
384 Ga0495661_0014001 3300046665 Bacteria 5377
385 Ga0495661_0112611 3300046665 Bacteria 1514
386 Ga0495661_0157119 3300046665 Bacteria 1223
387 Ga0495588_0002056 3300046674 Bacteria 8606
388 Ga0495588_0016701 3300046674 Bacteria 3550
389 Ga0495623_0019581 3300046679 Bacteria 4374
390 Ga0495623_0093626 3300046679 Bacteria 1839
391 Ga0495646_0049539 3300046680 Bacteria 2549
392 Ga0495646_0070578 3300046680 Bacteria 2057
393 Ga0495658_0089261 3300046683 Bacteria 1823
394 Ga0495669_0001037 3300046684 Bacteria 11578
395 Ga0495669_0104078 3300046684 Bacteria 1320
396 Ga0495613_0031230 3300046689 Bacteria 3956
397 Ga0495624_0001290 3300046690 Bacteria 19765
398 Ga0495624_0161413 3300046690 Bacteria 1369
399 Ga0495670_0000914 3300046691 Bacteria 14240
400 Ga0495670_0003232 3300046691 Bacteria 8026
401 Ga0495670_0030579 3300046691 Bacteria 2675
402 Ga0495670_0083158 3300046691 Bacteria 1632
403 Ga0495670_0134063 3300046691 Bacteria 1292
404 Ga0495670_0180064 3300046691 Bacteria 1116
405 Ga0495671_0018226 3300046692 Bacteria 3728
406 Ga0495671_0022422 3300046692 Bacteria 3309
407 Ga0495671_0045770 3300046692 Bacteria 2189
408 Ga0495649_0109701 3300046694 Bacteria 1463
409 Ga0495589_0008248 3300046794 Bacteria 5442
410 Ga0495589_0052777 3300046794 Bacteria 2007
411 Ga0495589_0058348 3300046794 Bacteria 1897
412 Ga0495589_0066536 3300046794 Bacteria 1764
413 Ga0495600_0006165 3300046809 Bacteria 7270
414 Ga0495660_0004560 3300046810 Bacteria 8366
415 Ga0495604_0028054 3300047317 Bacteria 4477
416 Ga0495604_0076182 3300047317 Bacteria 2523
417 Ga0495604_0124784 3300047317 Bacteria 1858
418 Ga0495604_0337219 3300047317 Bacteria 1004
419 Ga0495672_0000565 3300047320 Bacteria 41841
420 Ga0495676_0015149 3300047321 Bacteria 6880
421 Ga0495676_0120604 3300047321 Bacteria 1908
422 Ga0495683_0000009 3300047323 Bacteria 241385
423 Ga0495683_0000470 3300047323 Bacteria 31364
424 Ga0495683_0009822 3300047323 Bacteria 5085
425 Ga0495683_0021528 3300047323 Bacteria 3322
426 Ga0495683_0029627 3300047323 Bacteria 2796
427 Ga0495683_0044908 3300047323 Bacteria 2221
428 Ga0495683_0132015 3300047323 Bacteria 1177
429 Ga0495687_000117 3300047443 Bacteria 122591
430 Ga0495687_003873 3300047443 Bacteria 10508
431 Ga0495687_013939 3300047443 Bacteria 4163
432 Ga0495675_0025874 3300047444 Bacteria 3739
433 Ga0495675_0080440 3300047444 Bacteria 2052
434 Ga0495675_0175936 3300047444 Bacteria 1312
435 Ga0495677_0005865 3300047445 Bacteria 4652
436 Ga0495677_0010385 3300047445 Bacteria 3420
437 Ga0495677_0023711 3300047445 Bacteria 2226
438 Ga0495677_0033246 3300047445 Bacteria 1879
439 Ga0495677_0040406 3300047445 Bacteria 1706
440 Ga0495677_0107051 3300047445 Bacteria 1061
441 Ga0495685_008100 3300047447 Bacteria 3482
442 Ga0495685_022776 3300047447 Bacteria 2155
443 Ga0495681_0030280 3300047470 Bacteria 2758
444 Ga0495681_0053592 3300047470 Bacteria 1887
445 Ga0495681_0087727 3300047470 Bacteria 1378
446 Ga0495681_0089297 3300047470 Bacteria 1363
447 Ga0495686_0121269 3300047472 Bacteria 1558
448 Ga0495593_0002312 3300047673 Bacteria 11439
449 Ga0495593_0015203 3300047673 Bacteria 4366
450 Ga0495593_0113490 3300047673 Bacteria 1382
451 Ga0495602_0018666 3300048088 Bacteria 6915
452 Ga0495626_0001381 3300048091 Bacteria 19521
453 Ga0495626_0002812 3300048091 Bacteria 11650
454 Ga0495626_0004895 3300048091 Bacteria 8049
455 Ga0495626_0017849 3300048091 Bacteria 3578
456 Ga0495626_0023413 3300048091 Bacteria 3041
457 Ga0496102_0000854 3300048905 Bacteria 29260
458 Ga0496102_0175083 3300048905 Bacteria 2020
459 Ga0496102_0352308 3300048905 Bacteria 1386
460 Ga0496104_0163453 3300048907 Bacteria 2135
461 Ga0496105_0270880 3300048908 Bacteria 1371
462 Ga0496108_0168930 3300048911 Bacteria 1892
463 Ga0496108_0410797 3300048911 Bacteria 1182
464 Ga0496109_0184910 3300048912 Bacteria 1958
465 Ga0496112_0009014 3300048915 Bacteria 8959
466 Ga0496112_0193496 3300048915 Bacteria 1995
467 Ga0496114_0019820 3300048917 Bacteria 5454
468 Ga0496115_0026720 3300048918 Bacteria 4508
469 Ga0496115_0044126 3300048918 Bacteria 3555
470 Ga0496116_0020222 3300048919 Bacteria 5063
471 Ga0496121_0077293 3300048924 Bacteria 2651
472 Ga0496123_0001111 3300048926 Bacteria 40321
473 Ga0496125_0003463 3300048928 Bacteria 19109
474 Ga0496125_0041386 3300048928 Bacteria 3939
475 Ga0496126_0230986 3300048929 Bacteria 1550
476 Ga0501308_002776 3300049128 Bacteria 1566
477 Ga0501310_001960 3300049130 Bacteria 1916
478 Ga0495678_028129 3300049459 Bacteria 2376
479 Ga0495682_0000286 3300049460 Bacteria 39332
480 Ga0495682_0026885 3300049460 Bacteria 2135
481 Ga0501312_003316 3300049528 Bacteria 1819
482 Ga0501320_000823 3300049536 Bacteria 2003
483 Ga0501323_019981 3300049539 Bacteria 877
484 Ga0501335_003445 3300049551 Bacteria 1341
485 nmdc:mga03683_31053_c1 3300050489 Bacteria 2141
486 nmdc:mga07m45_115090_c1 3300050496 Bacteria 1551
487 nmdc:mga07m45_230885_c1 3300050496 Bacteria 1077
488 Ga0500644_0032904 3300053088 Bacteria 1660
489 Ga0500583_0140750 3300053092 Bacteria 1199
490 Ga0500651_0112936 3300053093 Bacteria 1656
491 Ga0500594_0004095 3300053118 Bacteria 3210
492 Ga0500559_0000049 3300053136 Bacteria 93378
493 Ga0500590_072900 3300053148 Bacteria 1703
494 Ga0500622_0001472 3300053156 Bacteria 18751
495 Ga0500634_0125877 3300053161 Bacteria 1239
496 Ga0587083_0014016 3300059505 Bacteria 1374
497 Ga0587078_007031 3300059646 Bacteria 1235
498 Ga0587079_009551 3300059647 Bacteria 1513
499 Ga0587102_000845 3300059649 Bacteria 1928

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0028012 Ga0495642_0028012_1473_2228 242
2 3300046615 Ga0495656_0143283 Ga0495656_0143283_375_1130 242
3 3300049539 Ga0501323_019981 Ga0501323_019981_16_792 242
4 3300042006 Ga0439432_054416 Ga0439432_054416_15_776 243
5 3300037471 Ga0395905_0502160 Ga0395905_0502160_14_814 249
6 3300046492 Ga0495585_0237037 Ga0495585_0237037_102_902 249
7 3300050496 nmdc:mga07m45_230885_c1 nmdc:mga07m45_230885_c1_23_823 249
8 3300041404 Ga0439436_0022428 Ga0439436_0022428_1054_1860 250
9 3300046473 Ga0495582_0334435 Ga0495582_0334435_51_857 250
10 3300046491 Ga0495584_0182030 Ga0495584_0182030_10_816 250
11 3300031456 Ga0307513_10117942 Ga0307513_101179422 267
12 iso_pu_bacteria 2511231003 2511251513 268
13 iso_pu_bacteria 2511231026 2511383543 268
14 iso_pu_bacteria 2521172590 2521560309 268
15 iso_pu_bacteria 2551306416 2553005128 268
16 iso_pu_bacteria 2643221603 2644026078 268
17 iso_pu_bacteria 2765235838 2765571484 268
18 iso_pu_bacteria 2808606386 2808982357 268
19 iso_pu_bacteria 2808606415 2809129843 268
20 iso_pu_bacteria 2808606419 2809149102 268
21 iso_pu_bacteria 2818991445 2819593054 268
22 iso_pu_bacteria 2818991449 2819616669 268
23 iso_pu_bacteria 2839094727 2839098774 268
24 iso_pu_bacteria 2852618963 2852619242 268
25 iso_pu_bacteria 2904439833 2904442545 268
26 iso_pu_bacteria 2904530477 2904535248 268
27 iso_pu_bacteria 2904584206 2904589592 268
28 iso_pu_bacteria 2904589729 2904594499 268
29 iso_pu_bacteria 2904601388 2904606243 268
30 iso_pu_bacteria 2919046199 2919048822 268
31 iso_pu_bacteria 2919079590 2919084192 268
32 iso_pu_bacteria 2923510766 2923514083 268
33 iso_pu_bacteria 2928130867 2928134668 268
34 3300046500 Ga0495596_0012741 Ga0495596_0012741_1460_2329 269
35 3300048918 Ga0496115_0044126 Ga0496115_0044126_1641_2510 269
36 iso_pu_bacteria 2547132374 2548501904 269
37 iso_pu_bacteria 2643221609 2644061030 269
38 iso_pu_bacteria 2643221611 2644071662 269
39 iso_pu_bacteria 2643221660 2644339716 269
40 iso_pu_bacteria 2643221717 2644647202 269
41 iso_pu_bacteria 2738543012 2739247183 269
42 iso_pu_bacteria 2816332133 2816476233 269
43 iso_pu_bacteria 2842718218 2842722356 269
44 iso_pu_bacteria 2885192300 2885197609 269
45 iso_pu_bacteria 2894023352 2894023553 269
46 iso_pu_bacteria 2904541872 2904549138 269
47 iso_pu_bacteria 2929160207 2929160766 269
48 iso_pu_bacteria 2974320154 2974321074 269
49 3300005327 Ga0070658_10320945 Ga0070658_103209452 270
50 3300005331 Ga0070670_100186620 Ga0070670_1001866202 270
51 3300005338 Ga0068868_100196094 Ga0068868_1001960942 270
52 3300005354 Ga0070675_100173927 Ga0070675_1001739272 270
53 3300005355 Ga0070671_100339946 Ga0070671_1003399462 270
54 3300005364 Ga0070673_100088990 Ga0070673_1000889902 270
55 3300005364 Ga0070673_100224676 Ga0070673_1002246762 270
56 3300005456 Ga0070678_100231926 Ga0070678_1002319262 270
57 3300005543 Ga0070672_100074874 Ga0070672_1000748742 270
58 3300005618 Ga0068864_100158444 Ga0068864_1001584441 270
59 3300005834 Ga0068851_10061043 Ga0068851_100610432 270
60 3300005840 Ga0068870_10150755 Ga0068870_101507552 270
61 3300006881 Ga0068865_100103803 Ga0068865_1001038032 270
62 3300009148 Ga0105243_10218372 Ga0105243_102183722 270
63 3300009177 Ga0105248_10252864 Ga0105248_102528642 270
64 3300013296 Ga0157374_10312513 Ga0157374_103125132 270
65 3300013306 Ga0163162_10389945 Ga0163162_103899452 270
66 3300013308 Ga0157375_10635165 Ga0157375_106351651 270
67 3300013308 Ga0157375_10786323 Ga0157375_107863231 270
68 3300014326 Ga0157380_10081632 Ga0157380_100816322 270
69 3300014969 Ga0157376_10379363 Ga0157376_103793632 270
70 3300017792 Ga0163161_10087909 Ga0163161_100879092 270
71 3300025315 Ga0207697_10081534 Ga0207697_100815342 270
72 3300025903 Ga0207680_10157647 Ga0207680_101576472 270
73 3300025908 Ga0207643_10091435 Ga0207643_100914352 270
74 3300025919 Ga0207657_10122110 Ga0207657_101221102 270
75 3300025923 Ga0207681_10233323 Ga0207681_102333232 270
76 3300025925 Ga0207650_10044775 Ga0207650_100447752 270
77 3300025926 Ga0207659_10144227 Ga0207659_101442272 270
78 3300025931 Ga0207644_10279324 Ga0207644_102793241 270
79 3300025931 Ga0207644_10385545 Ga0207644_103855452 270
80 3300025937 Ga0207669_10268778 Ga0207669_102687782 270
81 3300025940 Ga0207691_10020222 Ga0207691_100202227 270
82 3300025972 Ga0207668_10155440 Ga0207668_101554402 270
83 3300026023 Ga0207677_10047287 Ga0207677_100472872 270
84 3300026067 Ga0207678_10178930 Ga0207678_101789302 270
85 3300026121 Ga0207683_10206485 Ga0207683_102064852 270
86 3300026142 Ga0207698_10352119 Ga0207698_103521191 270
87 3300028379 Ga0268266_10143438 Ga0268266_101434382 270
88 3300037418 Ga0395900_0412592 Ga0395900_0412592_187_1050 270
89 3300037471 Ga0395905_0004181 Ga0395905_0004181_10187_11050 270
90 3300046455 Ga0495603_0199056 Ga0495603_0199056_195_1064 270
91 3300046615 Ga0495656_0000268 Ga0495656_0000268_748_1623 270
92 3300046691 Ga0495670_0180064 Ga0495670_0180064_222_1091 270
93 3300048911 Ga0496108_0410797 Ga0496108_0410797_262_1131 270
94 3300059505 Ga0587083_0014016 Ga0587083_0014016_476_1339 270
95 3300059646 Ga0587078_007031 Ga0587078_007031_328_1191 270
96 3300059647 Ga0587079_009551 Ga0587079_009551_626_1495 270
97 3300059649 Ga0587102_000845 Ga0587102_000845_881_1744 270
98 3300046507 Ga0495606_0003300 Ga0495606_0003300_3505_4374 271
99 3300046528 Ga0495642_0017412 Ga0495642_0017412_1165_2034 271
100 3300047323 Ga0495683_0132015 Ga0495683_0132015_180_1049 271
101 3300047445 Ga0495677_0040406 Ga0495677_0040406_53_922 271
102 3300002705 JGI25156J39149_1013055 JGI25156J39149_10130552 272
103 3300002737 JGI25162J39368_1004905 JGI25162J39368_10049052 272
104 3300002741 JGI25157J39369_1003315 JGI25157J39369_10033152 272
105 3300002774 JGI25150J39212_1002629 JGI25150J39212_10026292 272
106 3300003163 Ga0006759J45824_1023789 Ga0006759J45824_10237895 272
107 3300003574 Ga0007410J51695_1012491 Ga0007410J51695_10124917 272
108 3300003575 Ga0007409J51694_1005570 Ga0007409J51694_10055708 272
109 3300003577 Ga0007416J51690_1018405 Ga0007416J51690_10184057 272
110 3300003693 Ga0032354_1014770 Ga0032354_10147705 272
111 3300003751 Ga0055538_1000789 Ga0055538_10007899 272
112 3300003752 Ga0055539_1000685 Ga0055539_10006859 272
113 3300003756 Ga0055533_1000922 Ga0055533_10009229 272
114 3300003758 Ga0055532_1000130 Ga0055532_100013014 272
115 3300003759 Ga0055525_1000057 Ga0055525_100005730 272
116 3300003759 Ga0055525_1000869 Ga0055525_10008699 272
117 3300003771 Ga0055526_1000812 Ga0055526_100081214 272
118 3300003841 Ga0055541_1000684 Ga0055541_10006849 272
119 3300005331 Ga0070670_100096928 Ga0070670_1000969282 272
120 3300005331 Ga0070670_100199869 Ga0070670_1001998692 272
121 3300005334 Ga0068869_100006248 Ga0068869_1000062482 272
122 3300005337 Ga0070682_100004311 Ga0070682_1000043113 272
123 3300005339 Ga0070660_100005023 Ga0070660_1000050238 272
124 3300005343 Ga0070687_100089131 Ga0070687_1000891312 272
125 3300005344 Ga0070661_100004150 Ga0070661_1000041502 272
126 3300005344 Ga0070661_100189435 Ga0070661_1001894351 272
127 3300005344 Ga0070661_100227193 Ga0070661_1002271931 272
128 3300005354 Ga0070675_100116592 Ga0070675_1001165922 272
129 3300005354 Ga0070675_100250703 Ga0070675_1002507031 272
130 3300005355 Ga0070671_100119610 Ga0070671_1001196102 272
131 3300005366 Ga0070659_100093181 Ga0070659_1000931812 272
132 3300005457 Ga0070662_100276359 Ga0070662_1002763592 272
133 3300005459 Ga0068867_100029088 Ga0068867_1000290885 272
134 3300005539 Ga0068853_100295498 Ga0068853_1002954982 272
135 3300005543 Ga0070672_100072428 Ga0070672_1000724282 272
136 3300005543 Ga0070672_100369350 Ga0070672_1003693502 272
137 3300005563 Ga0068855_100153371 Ga0068855_1001533712 272
138 3300005577 Ga0068857_100021833 Ga0068857_1000218335 272
139 3300005578 Ga0068854_100027132 Ga0068854_1000271322 272
140 3300005614 Ga0068856_100214586 Ga0068856_1002145862 272
141 3300005616 Ga0068852_100127644 Ga0068852_1001276441 272
142 3300005616 Ga0068852_100465649 Ga0068852_1004656491 272
143 3300005618 Ga0068864_100265661 Ga0068864_1002656612 272
144 3300005834 Ga0068851_10088823 Ga0068851_100888232 272
145 3300006175 Ga0070712_100074634 Ga0070712_1000746342 272
146 3300006237 Ga0097621_100311852 Ga0097621_1003118522 272
147 3300006353 Ga0075370_10090261 Ga0075370_100902612 272
148 3300009011 Ga0105251_10031554 Ga0105251_100315542 272
149 3300009093 Ga0105240_10016732 Ga0105240_100167322 272
150 3300009093 Ga0105240_10019169 Ga0105240_100191697 272
151 3300009093 Ga0105240_10285223 Ga0105240_102852232 272
152 3300009098 Ga0105245_10371155 Ga0105245_103711552 272
153 3300009551 Ga0105238_10000038 Ga0105238_10000038119 272
154 3300009551 Ga0105238_10027954 Ga0105238_100279545 272
155 3300010375 Ga0105239_10000303 Ga0105239_1000030310 272
156 3300010375 Ga0105239_10926396 Ga0105239_109263961 272
157 3300013105 Ga0157369_10228373 Ga0157369_102283732 272
158 3300013297 Ga0157378_10167028 Ga0157378_101670282 272
159 3300013306 Ga0163162_10768915 Ga0163162_107689152 272
160 3300014497 Ga0182008_10012205 Ga0182008_100122052 272
161 3300015261 Ga0182006_1013512 Ga0182006_10135122 272
162 3300015262 Ga0182007_10074827 Ga0182007_100748272 272
163 3300021361 Ga0213872_10000122 Ga0213872_1000012225 272
164 3300021361 Ga0213872_10000383 Ga0213872_1000038331 272
165 3300021361 Ga0213872_10001440 Ga0213872_100014402 272
166 3300021361 Ga0213872_10064024 Ga0213872_100640242 272
167 3300025206 Ga0209435_100046 Ga0209435_10004635 272
168 3300025224 Ga0209784_100018 Ga0209784_100018428 272
169 3300025225 Ga0209566_100016 Ga0209566_100016428 272
170 3300025226 Ga0209674_100030 Ga0209674_100030428 272
171 3300025229 Ga0209147_100157 Ga0209147_10015756 272
172 3300025230 Ga0209563_100014 Ga0209563_100014222 272
173 3300025230 Ga0209563_100034 Ga0209563_100034428 272
174 3300025233 Ga0209437_100260 Ga0209437_10026041 272
175 3300025242 Ga0209258_100768 Ga0209258_10076814 272
176 3300025245 Ga0207425_1000200 Ga0207425_100020048 272
177 3300025246 Ga0209646_1000156 Ga0209646_100015658 272
178 3300025246 Ga0209646_1004576 Ga0209646_10045762 272
179 3300025250 Ga0209026_1000966 Ga0209026_10009661 272
180 3300025250 Ga0209026_1009580 Ga0209026_10095802 272
181 3300025253 Ga0209677_100019 Ga0209677_100019428 272
182 3300025256 Ga0209759_1006432 Ga0209759_10064322 272
183 3300025256 Ga0209759_1013237 Ga0209759_10132371 272
184 3300025258 Ga0209129_1000113 Ga0209129_100011346 272
185 3300025272 Ga0209455_1004795 Ga0209455_10047952 272
186 3300025273 Ga0209673_1032710 Ga0209673_10327102 272
187 3300025295 Ga0209564_1000186 Ga0209564_100018646 272
188 3300025297 Ga0209758_1000172 Ga0209758_100017246 272
189 3300025299 Ga0209256_1017807 Ga0209256_10178072 272
190 3300025304 Ga0209257_1036451 Ga0209257_10364512 272
191 3300025321 Ga0207656_10099140 Ga0207656_100991402 272
192 3300025735 Ga0207713_1017647 Ga0207713_10176473 272
193 3300025901 Ga0207688_10067100 Ga0207688_100671002 272
194 3300025901 Ga0207688_10099218 Ga0207688_100992182 272
195 3300025907 Ga0207645_10001670 Ga0207645_100016702 272
196 3300025913 Ga0207695_10002989 Ga0207695_100029897 272
197 3300025913 Ga0207695_10005091 Ga0207695_100050915 272
198 3300025913 Ga0207695_10069594 Ga0207695_100695944 272
199 3300025914 Ga0207671_10003973 Ga0207671_100039732 272
200 3300025915 Ga0207693_10087277 Ga0207693_100872772 272
201 3300025918 Ga0207662_10072849 Ga0207662_100728492 272
202 3300025919 Ga0207657_10037075 Ga0207657_100370754 272
203 3300025920 Ga0207649_10142022 Ga0207649_101420221 272
204 3300025924 Ga0207694_10000126 Ga0207694_1000012613 272
205 3300025925 Ga0207650_10179470 Ga0207650_101794702 272
206 3300025926 Ga0207659_10039375 Ga0207659_100393754 272
207 3300025931 Ga0207644_10090202 Ga0207644_100902022 272
208 3300025931 Ga0207644_10332034 Ga0207644_103320341 272
209 3300025932 Ga0207690_10019191 Ga0207690_100191912 272
210 3300025933 Ga0207706_10278658 Ga0207706_102786582 272
211 3300025933 Ga0207706_10311251 Ga0207706_103112512 272
212 3300025935 Ga0207709_10217485 Ga0207709_102174852 272
213 3300025940 Ga0207691_10111276 Ga0207691_101112762 272
214 3300025942 Ga0207689_10097654 Ga0207689_100976542 272
215 3300025945 Ga0207679_10176435 Ga0207679_101764352 272
216 3300025945 Ga0207679_10209350 Ga0207679_102093502 272
217 3300025949 Ga0207667_10023820 Ga0207667_100238203 272
218 3300025986 Ga0207658_10443187 Ga0207658_104431872 272
219 3300026023 Ga0207677_10061609 Ga0207677_100616092 272
220 3300026078 Ga0207702_10209051 Ga0207702_102090512 272
221 3300026088 Ga0207641_10457619 Ga0207641_104576192 272
222 3300026089 Ga0207648_10041042 Ga0207648_100410424 272
223 3300026116 Ga0207674_10025311 Ga0207674_100253113 272
224 3300026121 Ga0207683_10427586 Ga0207683_104275861 272
225 3300026142 Ga0207698_10005617 Ga0207698_100056171 272
226 3300026142 Ga0207698_10450556 Ga0207698_104505561 272
227 3300027876 Ga0209974_10006131 Ga0209974_100061312 272
228 3300028786 Ga0307517_10017098 Ga0307517_1001709810 272
229 3300028794 Ga0307515_10083575 Ga0307515_100835752 272
230 3300031250 Ga0265331_10019062 Ga0265331_100190622 272
231 3300031251 Ga0265327_10000444 Ga0265327_1000044441 272
232 3300031456 Ga0307513_10283324 Ga0307513_102833242 272
233 3300031507 Ga0307509_10082422 Ga0307509_100824222 272
234 3300031548 Ga0307408_100103678 Ga0307408_1001036782 272
235 3300031616 Ga0307508_10000134 Ga0307508_1000013449 272
236 3300031616 Ga0307508_10000524 Ga0307508_100005249 272
237 3300031649 Ga0307514_10136187 Ga0307514_101361872 272
238 3300031730 Ga0307516_10125492 Ga0307516_101254922 272
239 3300031731 Ga0307405_10377228 Ga0307405_103772281 272
240 3300032002 Ga0307416_100330304 Ga0307416_1003303042 272
241 3300033180 Ga0307510_10005730 Ga0307510_1000573010 272
242 3300035692 Ga0373935_0142955 Ga0373935_0142955_297_1166 272
243 3300037312 Ga0395899_0257708 Ga0395899_0257708_183_1052 272
244 3300037418 Ga0395900_0191021 Ga0395900_0191021_290_1159 272
245 3300037471 Ga0395905_0004203 Ga0395905_0004203_11721_12590 272
246 3300037471 Ga0395905_0013567 Ga0395905_0013567_3663_4532 272
247 3300039447 Ga0436361_0066651 Ga0436361_0066651_1179_2048 272
248 3300039447 Ga0436361_0108001 Ga0436361_0108001_110648_111517 272
249 3300039447 Ga0436361_0264437 Ga0436361_0264437_1871_2746 272
250 3300039447 Ga0436361_0619669 Ga0436361_0619669_1072_1941 272
251 3300039447 Ga0436361_0709165 Ga0436361_0709165_1039_1911 272
252 3300039447 Ga0436361_0813098 Ga0436361_0813098_111527_112399 272
253 3300044658 Ga0466972_0000825 Ga0466972_0000825_13262_14131 272
254 3300044658 Ga0466972_0091952 Ga0466972_0091952_351_1220 272
255 3300044683 Ga0466965_0000541 Ga0466965_0000541_12300_13169 272
256 3300044765 Ga0466970_0067315 Ga0466970_0067315_612_1481 272
257 3300044842 Ga0466957_0101619 Ga0466957_0101619_447_1316 272
258 3300045049 Ga0466959_0202289 Ga0466959_0202289_344_1213 272
259 3300046452 Ga0495617_000885 Ga0495617_000885_10237_11106 272
260 3300046454 Ga0495592_0000320 Ga0495592_0000320_36428_37297 272
261 3300046454 Ga0495592_0143691 Ga0495592_0143691_737_1606 272
262 3300046459 Ga0495629_0090529 Ga0495629_0090529_923_1792 272
263 3300046460 Ga0495638_0007395 Ga0495638_0007395_5994_6863 272
264 3300046462 Ga0495651_0145136 Ga0495651_0145136_236_1108 272
265 3300046463 Ga0495653_0136138 Ga0495653_0136138_527_1396 272
266 3300046463 Ga0495653_0309645 Ga0495653_0309645_147_1016 272
267 3300046472 Ga0495580_0032566 Ga0495580_0032566_259_1128 272
268 3300046472 Ga0495580_0239858 Ga0495580_0239858_17_886 272
269 3300046473 Ga0495582_0054210 Ga0495582_0054210_563_1432 272
270 3300046474 Ga0495605_0039256 Ga0495605_0039256_619_1488 272
271 3300046474 Ga0495605_0107058 Ga0495605_0107058_374_1243 272
272 3300046475 Ga0495639_0047574 Ga0495639_0047574_111_980 272
273 3300046491 Ga0495584_0000001 Ga0495584_0000001_66768_67637 272
274 3300046491 Ga0495584_0000434 Ga0495584_0000434_8105_8974 272
275 3300046491 Ga0495584_0036935 Ga0495584_0036935_1386_2255 272
276 3300046491 Ga0495584_0039249 Ga0495584_0039249_620_1489 272
277 3300046491 Ga0495584_0049269 Ga0495584_0049269_516_1385 272
278 3300046491 Ga0495584_0056432 Ga0495584_0056432_381_1250 272
279 3300046491 Ga0495584_0069936 Ga0495584_0069936_359_1228 272
280 3300046492 Ga0495585_0000002 Ga0495585_0000002_410902_411771 272
281 3300046492 Ga0495585_0000026 Ga0495585_0000026_88235_89167 272
282 3300046492 Ga0495585_0002790 Ga0495585_0002790_3438_4307 272
283 3300046492 Ga0495585_0006880 Ga0495585_0006880_2395_3264 272
284 3300046492 Ga0495585_0013940 Ga0495585_0013940_1071_1940 272
285 3300046492 Ga0495585_0022958 Ga0495585_0022958_981_1850 272
286 3300046492 Ga0495585_0024985 Ga0495585_0024985_283_1152 272
287 3300046492 Ga0495585_0054879 Ga0495585_0054879_957_1826 272
288 3300046499 Ga0495594_0000459 Ga0495594_0000459_13336_14205 272
289 3300046500 Ga0495596_0000149 Ga0495596_0000149_41938_42807 272
290 3300046500 Ga0495596_0008791 Ga0495596_0008791_2538_3407 272
291 3300046500 Ga0495596_0011580 Ga0495596_0011580_1423_2292 272
292 3300046501 Ga0495607_0110230 Ga0495607_0110230_523_1392 272
293 3300046506 Ga0495583_0000009 Ga0495583_0000009_86691_87560 272
294 3300046506 Ga0495583_0015888 Ga0495583_0015888_1686_2555 272
295 3300046507 Ga0495606_0011711 Ga0495606_0011711_1199_2068 272
296 3300046507 Ga0495606_0013480 Ga0495606_0013480_5566_6435 272
297 3300046507 Ga0495606_0056394 Ga0495606_0056394_751_1620 272
298 3300046511 Ga0495608_0009994 Ga0495608_0009994_4905_5777 272
299 3300046513 Ga0495616_0000616 Ga0495616_0000616_25338_26207 272
300 3300046513 Ga0495616_0004636 Ga0495616_0004636_3537_4406 272
301 3300046513 Ga0495616_0024211 Ga0495616_0024211_1004_1873 272
302 3300046514 Ga0495618_0189665 Ga0495618_0189665_139_1011 272
303 3300046515 Ga0495620_0003122 Ga0495620_0003122_5590_6459 272
304 3300046516 Ga0495628_0009618 Ga0495628_0009618_348_1220 272
305 3300046519 Ga0495632_0006352 Ga0495632_0006352_5723_6592 272
306 3300046522 Ga0495643_0006229 Ga0495643_0006229_838_1707 272
307 3300046522 Ga0495643_0038091 Ga0495643_0038091_1270_2139 272
308 3300046524 Ga0495648_0000012 Ga0495648_0000012_117546_118415 272
309 3300046524 Ga0495648_0075765 Ga0495648_0075765_821_1690 272
310 3300046525 Ga0495663_0050747 Ga0495663_0050747_43_912 272
311 3300046526 Ga0495666_0004810 Ga0495666_0004810_368_1237 272
312 3300046526 Ga0495666_0031370 Ga0495666_0031370_1211_2080 272
313 3300046526 Ga0495666_0041664 Ga0495666_0041664_598_1467 272
314 3300046526 Ga0495666_0042326 Ga0495666_0042326_580_1449 272
315 3300046526 Ga0495666_0068890 Ga0495666_0068890_545_1414 272
316 3300046528 Ga0495642_0005181 Ga0495642_0005181_3882_4751 272
317 3300046528 Ga0495642_0066485 Ga0495642_0066485_463_1332 272
318 3300046529 Ga0495652_0109209 Ga0495652_0109209_417_1289 272
319 3300046531 Ga0495665_0029505 Ga0495665_0029505_758_1627 272
320 3300046531 Ga0495665_0060938 Ga0495665_0060938_987_1856 272
321 3300046535 Ga0495586_0003588 Ga0495586_0003588_3781_4650 272
322 3300046535 Ga0495586_0036809 Ga0495586_0036809_389_1258 272
323 3300046536 Ga0495587_0008957 Ga0495587_0008957_1255_2124 272
324 3300046537 Ga0495598_0068999 Ga0495598_0068999_62_931 272
325 3300046538 Ga0495609_0033334 Ga0495609_0033334_677_1546 272
326 3300046538 Ga0495609_0046710 Ga0495609_0046710_1057_1926 272
327 3300046542 Ga0495597_0039290 Ga0495597_0039290_731_1600 272
328 3300046557 Ga0495622_0001203 Ga0495622_0001203_2223_3092 272
329 3300046557 Ga0495622_0017177 Ga0495622_0017177_1004_1873 272
330 3300046558 Ga0495633_0007168 Ga0495633_0007168_3690_4559 272
331 3300046558 Ga0495633_0008638 Ga0495633_0008638_1188_2057 272
332 3300046558 Ga0495633_0021618 Ga0495633_0021618_725_1594 272
333 3300046558 Ga0495633_0022792 Ga0495633_0022792_1209_2078 272
334 3300046615 Ga0495656_0066880 Ga0495656_0066880_370_1239 272
335 3300046615 Ga0495656_0068636 Ga0495656_0068636_111_980 272
336 3300046616 Ga0495668_0005031 Ga0495668_0005031_3387_4256 272
337 3300046616 Ga0495668_0028953 Ga0495668_0028953_1386_2255 272
338 3300046616 Ga0495668_0030455 Ga0495668_0030455_638_1507 272
339 3300046616 Ga0495668_0057554 Ga0495668_0057554_401_1270 272
340 3300046648 Ga0495611_0003947 Ga0495611_0003947_4067_4936 272
341 3300046648 Ga0495611_0010140 Ga0495611_0010140_1519_2388 272
342 3300046660 Ga0495625_0039489 Ga0495625_0039489_1111_1980 272
343 3300046663 Ga0495635_0165816 Ga0495635_0165816_576_1445 272
344 3300046665 Ga0495661_0005389 Ga0495661_0005389_2920_3789 272
345 3300046665 Ga0495661_0005963 Ga0495661_0005963_534_1403 272
346 3300046665 Ga0495661_0009548 Ga0495661_0009548_2944_3813 272
347 3300046665 Ga0495661_0014001 Ga0495661_0014001_3584_4453 272
348 3300046665 Ga0495661_0112611 Ga0495661_0112611_439_1308 272
349 3300046674 Ga0495588_0002056 Ga0495588_0002056_4336_5205 272
350 3300046674 Ga0495588_0016701 Ga0495588_0016701_1695_2564 272
351 3300046679 Ga0495623_0019581 Ga0495623_0019581_2446_3318 272
352 3300046680 Ga0495646_0049539 Ga0495646_0049539_241_1113 272
353 3300046680 Ga0495646_0070578 Ga0495646_0070578_968_1837 272
354 3300046683 Ga0495658_0089261 Ga0495658_0089261_200_1069 272
355 3300046684 Ga0495669_0001037 Ga0495669_0001037_8983_9852 272
356 3300046689 Ga0495613_0031230 Ga0495613_0031230_830_1699 272
357 3300046690 Ga0495624_0001290 Ga0495624_0001290_8545_9414 272
358 3300046690 Ga0495624_0161413 Ga0495624_0161413_226_1095 272
359 3300046691 Ga0495670_0000914 Ga0495670_0000914_12640_13509 272
360 3300046691 Ga0495670_0003232 Ga0495670_0003232_5661_6530 272
361 3300046691 Ga0495670_0030579 Ga0495670_0030579_1784_2653 272
362 3300046691 Ga0495670_0134063 Ga0495670_0134063_280_1149 272
363 3300046692 Ga0495671_0018226 Ga0495671_0018226_2484_3353 272
364 3300046794 Ga0495589_0008248 Ga0495589_0008248_1082_1951 272
365 3300046809 Ga0495600_0006165 Ga0495600_0006165_3745_4614 272
366 3300046810 Ga0495660_0004560 Ga0495660_0004560_5123_5992 272
367 3300047317 Ga0495604_0028054 Ga0495604_0028054_778_1647 272
368 3300047317 Ga0495604_0076182 Ga0495604_0076182_811_1680 272
369 3300047317 Ga0495604_0124784 Ga0495604_0124784_799_1731 272
370 3300047321 Ga0495676_0015149 Ga0495676_0015149_4194_5063 272
371 3300047323 Ga0495683_0000009 Ga0495683_0000009_172283_173152 272
372 3300047323 Ga0495683_0009822 Ga0495683_0009822_3582_4451 272
373 3300047323 Ga0495683_0021528 Ga0495683_0021528_2105_2974 272
374 3300047323 Ga0495683_0029627 Ga0495683_0029627_1668_2537 272
375 3300047443 Ga0495687_003873 Ga0495687_003873_2091_2960 272
376 3300047444 Ga0495675_0025874 Ga0495675_0025874_37_906 272
377 3300047444 Ga0495675_0080440 Ga0495675_0080440_227_1096 272
378 3300047445 Ga0495677_0005865 Ga0495677_0005865_376_1245 272
379 3300047445 Ga0495677_0010385 Ga0495677_0010385_1087_1956 272
380 3300047445 Ga0495677_0107051 Ga0495677_0107051_160_1029 272
381 3300047447 Ga0495685_008100 Ga0495685_008100_883_1752 272
382 3300047470 Ga0495681_0030280 Ga0495681_0030280_897_1766 272
383 3300047470 Ga0495681_0089297 Ga0495681_0089297_126_995 272
384 3300047472 Ga0495686_0121269 Ga0495686_0121269_653_1522 272
385 3300047673 Ga0495593_0002312 Ga0495593_0002312_9795_10664 272
386 3300047673 Ga0495593_0015203 Ga0495593_0015203_2608_3477 272
387 3300048088 Ga0495602_0018666 Ga0495602_0018666_368_1237 272
388 3300048091 Ga0495626_0001381 Ga0495626_0001381_16779_17648 272
389 3300048091 Ga0495626_0002812 Ga0495626_0002812_3486_4355 272
390 3300048091 Ga0495626_0004895 Ga0495626_0004895_6948_7817 272
391 3300048091 Ga0495626_0017849 Ga0495626_0017849_1229_2098 272
392 3300048905 Ga0496102_0175083 Ga0496102_0175083_294_1163 272
393 3300048917 Ga0496114_0019820 Ga0496114_0019820_548_1417 272
394 3300048918 Ga0496115_0026720 Ga0496115_0026720_3135_4004 272
395 3300048919 Ga0496116_0020222 Ga0496116_0020222_831_1700 272
396 3300048924 Ga0496121_0077293 Ga0496121_0077293_437_1306 272
397 3300048926 Ga0496123_0001111 Ga0496123_0001111_38647_39516 272
398 3300048928 Ga0496125_0003463 Ga0496125_0003463_13807_14676 272
399 3300048928 Ga0496125_0041386 Ga0496125_0041386_2619_3488 272
400 3300048929 Ga0496126_0230986 Ga0496126_0230986_317_1186 272
401 3300049128 Ga0501308_002776 Ga0501308_002776_301_1170 272
402 3300049460 Ga0495682_0026885 Ga0495682_0026885_592_1461 272
403 3300049528 Ga0501312_003316 Ga0501312_003316_671_1540 272
404 3300049551 Ga0501335_003445 Ga0501335_003445_88_957 272
405 3300053088 Ga0500644_0032904 Ga0500644_0032904_550_1419 272
406 3300053092 Ga0500583_0140750 Ga0500583_0140750_159_1028 272
407 3300053093 Ga0500651_0112936 Ga0500651_0112936_545_1414 272
408 3300053118 Ga0500594_0004095 Ga0500594_0004095_1519_2388 272
409 3300053136 Ga0500559_0000049 Ga0500559_0000049_55963_56832 272
410 3300053148 Ga0500590_072900 Ga0500590_072900_329_1198 272
411 3300053156 Ga0500622_0001472 Ga0500622_0001472_14282_15151 272
412 3300053161 Ga0500634_0125877 Ga0500634_0125877_94_966 272
413 2162886007 SwRhRL2b_contig_2253570 SwRhRL2b_0452.00003310 273
414 3300003187 JGI25151J46595_10033725 JGI25151J46595_100337252 273
415 3300003575 Ga0007409J51694_1010509 Ga0007409J51694_10105091 273
416 3300005331 Ga0070670_100241510 Ga0070670_1002415102 273
417 3300005355 Ga0070671_100183725 Ga0070671_1001837251 273
418 3300005455 Ga0070663_100057949 Ga0070663_1000579492 273
419 3300005456 Ga0070678_100355931 Ga0070678_1003559311 273
420 3300005618 Ga0068864_100096910 Ga0068864_1000969102 273
421 3300005841 Ga0068863_100225639 Ga0068863_1002256392 273
422 3300006195 Ga0075366_10154589 Ga0075366_101545892 273
423 3300009176 Ga0105242_10001267 Ga0105242_100012672 273
424 3300009177 Ga0105248_10000345 Ga0105248_1000034524 273
425 3300009551 Ga0105238_10381565 Ga0105238_103815651 273
426 3300013296 Ga0157374_10149588 Ga0157374_101495882 273
427 3300025931 Ga0207644_10011700 Ga0207644_100117006 273
428 3300025934 Ga0207686_10001312 Ga0207686_1000131213 273
429 3300025938 Ga0207704_10057802 Ga0207704_100578022 273
430 3300025940 Ga0207691_10230160 Ga0207691_102301602 273
431 3300025941 Ga0207711_10003063 Ga0207711_100030638 273
432 3300025972 Ga0207668_10176071 Ga0207668_101760712 273
433 3300026078 Ga0207702_10345580 Ga0207702_103455801 273
434 3300026088 Ga0207641_10107360 Ga0207641_101073602 273
435 3300026095 Ga0207676_10076966 Ga0207676_100769662 273
436 3300026121 Ga0207683_10284790 Ga0207683_102847902 273
437 3300030735 Ga0316178_1077577 Ga0316178_10775772 273
438 3300030736 Ga0316180_1184120 Ga0316180_11841202 273
439 3300031548 Ga0307408_100275657 Ga0307408_1002756572 273
440 3300031731 Ga0307405_10063158 Ga0307405_100631582 273
441 3300032002 Ga0307416_100048983 Ga0307416_1000489833 273
442 3300037418 Ga0395900_0244956 Ga0395900_0244956_392_1273 273
443 3300039447 Ga0436361_0004183 Ga0436361_0004183_1994_2860 273
444 3300041404 Ga0439436_0017201 Ga0439436_0017201_610_1485 273
445 3300041406 Ga0439439_0016591 Ga0439439_0016591_41_916 273
446 3300041411 Ga0439466_0021347 Ga0439466_0021347_401_1276 273
447 3300041997 Ga0439431_0032607 Ga0439431_0032607_409_1284 273
448 3300042004 Ga0439445_0024840 Ga0439445_0024840_54_929 273
449 3300042010 Ga0439452_031484 Ga0439452_031484_191_1066 273
450 3300042131 Ga0450894_004078 Ga0450894_004078_382_1257 273
451 3300042134 Ga0450898_018864 Ga0450898_018864_231_1106 273
452 3300042145 Ga0450906_013385 Ga0450906_013385_516_1391 273
453 3300044658 Ga0466972_0030647 Ga0466972_0030647_757_1638 273
454 3300044683 Ga0466965_0032455 Ga0466965_0032455_691_1566 273
455 3300046452 Ga0495617_000179 Ga0495617_000179_38247_39128 273
456 3300046453 Ga0495627_022240 Ga0495627_022240_570_1451 273
457 3300046457 Ga0495590_0000072 Ga0495590_0000072_956_1837 273
458 3300046474 Ga0495605_0000400 Ga0495605_0000400_649_1530 273
459 3300046492 Ga0495585_0032845 Ga0495585_0032845_1368_2249 273
460 3300046492 Ga0495585_0061007 Ga0495585_0061007_582_1463 273
461 3300046492 Ga0495585_0115671 Ga0495585_0115671_27_908 273
462 3300046499 Ga0495594_0020790 Ga0495594_0020790_2316_3197 273
463 3300046500 Ga0495596_0025299 Ga0495596_0025299_1234_2115 273
464 3300046500 Ga0495596_0053807 Ga0495596_0053807_615_1496 273
465 3300046501 Ga0495607_0024066 Ga0495607_0024066_254_1135 273
466 3300046501 Ga0495607_0086222 Ga0495607_0086222_366_1247 273
467 3300046512 Ga0495610_0000400 Ga0495610_0000400_972_1853 273
468 3300046513 Ga0495616_0041061 Ga0495616_0041061_873_1754 273
469 3300046513 Ga0495616_0050622 Ga0495616_0050622_422_1303 273
470 3300046513 Ga0495616_0051322 Ga0495616_0051322_392_1273 273
471 3300046518 Ga0495631_0050460 Ga0495631_0050460_366_1247 273
472 3300046519 Ga0495632_0000447 Ga0495632_0000447_37259_38140 273
473 3300046520 Ga0495637_0000003 Ga0495637_0000003_366430_367311 273
474 3300046523 Ga0495644_0005175 Ga0495644_0005175_3793_4674 273
475 3300046524 Ga0495648_0000451 Ga0495648_0000451_662_1543 273
476 3300046524 Ga0495648_0083888 Ga0495648_0083888_366_1247 273
477 3300046525 Ga0495663_0033585 Ga0495663_0033585_322_1197 273
478 3300046526 Ga0495666_0041586 Ga0495666_0041586_577_1452 273
479 3300046528 Ga0495642_0012390 Ga0495642_0012390_1186_2067 273
480 3300046528 Ga0495642_0094716 Ga0495642_0094716_95_976 273
481 3300046530 Ga0495654_0073221 Ga0495654_0073221_549_1430 273
482 3300046531 Ga0495665_0072572 Ga0495665_0072572_362_1237 273
483 3300046533 Ga0495640_0148136 Ga0495640_0148136_348_1223 273
484 3300046537 Ga0495598_0019470 Ga0495598_0019470_498_1376 273
485 3300046538 Ga0495609_0056352 Ga0495609_0056352_848_1729 273
486 3300046542 Ga0495597_0017154 Ga0495597_0017154_915_1796 273
487 3300046542 Ga0495597_0040465 Ga0495597_0040465_616_1491 273
488 3300046543 Ga0495645_0235786 Ga0495645_0235786_111_983 273
489 3300046557 Ga0495622_0063308 Ga0495622_0063308_523_1398 273
490 3300046616 Ga0495668_0084689 Ga0495668_0084689_648_1529 273
491 3300046616 Ga0495668_0098753 Ga0495668_0098753_530_1411 273
492 3300046648 Ga0495611_0028892 Ga0495611_0028892_864_1745 273
493 3300046648 Ga0495611_0035329 Ga0495611_0035329_840_1721 273
494 3300046663 Ga0495635_0150537 Ga0495635_0150537_566_1441 273
495 3300046663 Ga0495635_0156145 Ga0495635_0156145_539_1414 273
496 3300046665 Ga0495661_0157119 Ga0495661_0157119_42_923 273
497 3300046679 Ga0495623_0093626 Ga0495623_0093626_405_1280 273
498 3300046684 Ga0495669_0104078 Ga0495669_0104078_229_1110 273
499 3300046691 Ga0495670_0083158 Ga0495670_0083158_165_1046 273
500 3300046692 Ga0495671_0022422 Ga0495671_0022422_981_1862 273
501 3300046692 Ga0495671_0045770 Ga0495671_0045770_459_1340 273
502 3300046694 Ga0495649_0109701 Ga0495649_0109701_28_909 273
503 3300046794 Ga0495589_0052777 Ga0495589_0052777_366_1247 273
504 3300046794 Ga0495589_0058348 Ga0495589_0058348_36_917 273
505 3300046794 Ga0495589_0066536 Ga0495589_0066536_856_1737 273
506 3300047317 Ga0495604_0337219 Ga0495604_0337219_93_968 273
507 3300047320 Ga0495672_0000565 Ga0495672_0000565_39984_40865 273
508 3300047321 Ga0495676_0120604 Ga0495676_0120604_458_1333 273
509 3300047323 Ga0495683_0000470 Ga0495683_0000470_29792_30673 273
510 3300047323 Ga0495683_0044908 Ga0495683_0044908_693_1574 273
511 3300047443 Ga0495687_000117 Ga0495687_000117_63352_64233 273
512 3300047443 Ga0495687_013939 Ga0495687_013939_2315_3196 273
513 3300047444 Ga0495675_0175936 Ga0495675_0175936_341_1216 273
514 3300047445 Ga0495677_0023711 Ga0495677_0023711_664_1545 273
515 3300047445 Ga0495677_0033246 Ga0495677_0033246_28_909 273
516 3300047447 Ga0495685_022776 Ga0495685_022776_638_1519 273
517 3300047470 Ga0495681_0053592 Ga0495681_0053592_530_1411 273
518 3300047470 Ga0495681_0087727 Ga0495681_0087727_21_902 273
519 3300047673 Ga0495593_0113490 Ga0495593_0113490_166_1041 273
520 3300048091 Ga0495626_0023413 Ga0495626_0023413_1181_2062 273
521 3300048905 Ga0496102_0000854 Ga0496102_0000854_961_1842 273
522 3300048905 Ga0496102_0352308 Ga0496102_0352308_397_1269 273
523 3300048907 Ga0496104_0163453 Ga0496104_0163453_1034_1906 273
524 3300048908 Ga0496105_0270880 Ga0496105_0270880_353_1225 273
525 3300048911 Ga0496108_0168930 Ga0496108_0168930_214_1086 273
526 3300048912 Ga0496109_0184910 Ga0496109_0184910_404_1276 273
527 3300048915 Ga0496112_0009014 Ga0496112_0009014_6780_7652 273
528 3300048915 Ga0496112_0193496 Ga0496112_0193496_417_1298 273
529 3300049130 Ga0501310_001960 Ga0501310_001960_574_1449 273
530 3300049459 Ga0495678_028129 Ga0495678_028129_986_1867 273
531 3300049460 Ga0495682_0000286 Ga0495682_0000286_807_1688 273
532 3300049536 Ga0501320_000823 Ga0501320_000823_705_1580 273
533 3300050489 nmdc:mga03683_31053_c1 nmdc:mga03683_31053_c1_425_1300 273
534 3300050496 nmdc:mga07m45_115090_c1 nmdc:mga07m45_115090_c1_306_1181 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

3

290

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.9261 6 233
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.91 6 233
7nkn-assembly1.cif.gz_G mycobacterium smegmatis atp synthase rotor state 3 0.8638 3 239
5zwl-assembly1.cif.gz_G crystal structure of the gamma - epsilon complex of photosynthetic cyanobacterial f1-atpase 0.856 13 235
5hkk-assembly2.cif.gz_O caldalaklibacillus thermarum f1-atpase (wild type) 0.8308 3 270
ID Description Score Start End Superfamily
3oaaG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9457 47 178 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9451 48 177 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9381 48 177 3.40.1380.10
af_Q2FWE9_9_222_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9186 18 230 3.40.1380.10
2qe7G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.91 49 178 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A0P8H924-F1-model_v4 deleted 0.9604 51 161
AF-A0A011PFB0-F1-model_v4 F-ATPase gamma subunit 0.9565 14 155 GO:0045261
GO:0046933
AF-A0A7W2GEH4-F1-model_v4 deleted 0.955 14 176
AF-A0A0P8H924-F1-model_v4 deleted 0.9521 51 161
AF-H6UJB5-F1-model_v4 ATP synthase F1 subunit gamma 0.9377 11 154 GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
80.48 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map