F460523

General Info

Members Datasets Scaffolds Average Seq Length
534 258 1068 170

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100239668|Ga0070716_1002396683
Length 193
Sequence LRLRALAVKGFNLMSRVGNKPIPLPKGVTISVGEQLQVEGPKGKLTVPIPAGIKIKQENGIVQIARDGDEQAALHGLTRALAANAVNGVSTGFTRELDIVGIGFRADVKGRIATFTLGYSHPIEVLLPDGVDLKIDKQTHLVLTSFDKQLLGQTAANIRALRKPDPYKNKGIRYTGEVLRKKVGKTGATGAKA

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.31
Rhizosphere 91.39
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100239668 3300006173 Bacteria 1229
2 Ga0058863_11307950 3300004799 Bacteria 723
3 Ga0058863_11698189 3300004799 Bacteria 658
4 Ga0070658_10253597 3300005327 Bacteria 1493
5 Ga0070658_10381052 3300005327 Bacteria 1210
6 Ga0070683_101110485 3300005329 Bacteria 760
7 Ga0070683_101763082 3300005329 Bacteria 595
8 Ga0070690_100108522 3300005330 Bacteria 1849
9 Ga0068869_101282194 3300005334 Bacteria 646
10 Ga0070680_100003385 3300005336 Bacteria 11897
11 Ga0070680_100085128 3300005336 Bacteria 2612
12 Ga0070680_100422512 3300005336 Bacteria 1137
13 Ga0068868_100146981 3300005338 Bacteria 1939
14 Ga0070689_100081141 3300005340 Bacteria 2546
15 Ga0070689_100284218 3300005340 Bacteria 1373
16 Ga0070669_100207488 3300005353 Bacteria 1544
17 Ga0070669_100308774 3300005353 Bacteria 1274
18 Ga0070675_100528993 3300005354 Bacteria 1064
19 Ga0070671_100001915 3300005355 Bacteria 15937
20 Ga0070671_100168494 3300005355 Bacteria 1852
21 Ga0070674_100293671 3300005356 Bacteria 1293
22 Ga0070688_100172936 3300005365 Bacteria 1492
23 Ga0070688_100228848 3300005365 Bacteria 1314
24 Ga0070667_100577066 3300005367 Bacteria 1035
25 Ga0070709_10438206 3300005434 Bacteria 982
26 Ga0070714_100011348 3300005435 Bacteria 7066
27 Ga0070714_100063187 3300005435 Bacteria 3183
28 Ga0070714_100410392 3300005435 Bacteria 1282
29 Ga0070713_100001320 3300005436 Bacteria 15863
30 Ga0070713_100068731 3300005436 Bacteria 2985
31 Ga0070713_100964237 3300005436 Unclassified 822
32 Ga0070713_101119388 3300005436 Unclassified 761
33 Ga0070711_100009101 3300005439 Bacteria 6104
34 Ga0070711_100091433 3300005439 Bacteria 2194
35 Ga0070711_100672241 3300005439 Unclassified 870
36 Ga0070711_101126573 3300005439 Bacteria 677
37 Ga0070705_100230039 3300005440 Bacteria 1289
38 Ga0070705_100290456 3300005440 Unclassified 1167
39 Ga0070694_100031462 3300005444 Bacteria 3480
40 Ga0070708_100894492 3300005445 Unclassified 834
41 Ga0070663_100307096 3300005455 Bacteria 1272
42 Ga0070678_100173124 3300005456 Bacteria 1760
43 Ga0070678_100233852 3300005456 Bacteria 1533
44 Ga0070681_10126011 3300005458 Bacteria 2494
45 Ga0070681_11456968 3300005458 Unclassified 609
46 Ga0068867_101134919 3300005459 Unclassified 715
47 Ga0070685_10125837 3300005466 Bacteria 1596
48 Ga0070685_10477270 3300005466 Bacteria 878
49 Ga0070706_100317826 3300005467 Unclassified 1452
50 Ga0070699_100090023 3300005518 Bacteria 2682
51 Ga0070699_100304427 3300005518 Bacteria 1430
52 Ga0070699_100323636 3300005518 Bacteria 1386
53 Ga0070679_100101926 3300005530 Bacteria 2857
54 Ga0070684_100020620 3300005535 Bacteria 5467
55 Ga0070684_100347560 3300005535 Bacteria 1364
56 Ga0070697_100855695 3300005536 Bacteria 806
57 Ga0068853_100603873 3300005539 Bacteria 1042
58 Ga0068853_100762163 3300005539 Bacteria 925
59 Ga0070695_101245126 3300005545 Bacteria 613
60 Ga0070696_100001670 3300005546 Bacteria 14549
61 Ga0070693_100382234 3300005547 Bacteria 971
62 Ga0070665_100151417 3300005548 Bacteria 2322
63 Ga0070704_101754188 3300005549 Unclassified 574
64 Ga0068855_100005394 3300005563 Bacteria 15600
65 Ga0068855_100084716 3300005563 Bacteria 3669
66 Ga0068854_100282890 3300005578 Unclassified 1336
67 Ga0068856_100080273 3300005614 Bacteria 3235
68 Ga0068852_100009021 3300005616 Bacteria 7380
69 Ga0068852_100234995 3300005616 Bacteria 1749
70 Ga0068859_100207083 3300005617 Bacteria 2047
71 Ga0068864_101298747 3300005618 Bacteria 728
72 Ga0068858_100101333 3300005842 Bacteria 2685
73 Ga0068858_100409861 3300005842 Bacteria 1303
74 Ga0068860_100358866 3300005843 Bacteria 1435
75 Ga0068862_100152179 3300005844 Bacteria 2060
76 Ga0068862_101180580 3300005844 Bacteria 763
77 Ga0081455_10017775 3300005937 Bacteria 6802
78 Ga0070717_10061387 3300006028 Bacteria 3115
79 Ga0070717_10106073 3300006028 Bacteria 2392
80 Ga0070717_10115432 3300006028 Bacteria 2295
81 Ga0070717_10354550 3300006028 Unclassified 1312
82 Ga0070717_11155596 3300006028 Bacteria 705
83 Ga0070716_100211692 3300006173 Unclassified 1296
84 Ga0070716_100519301 3300006173 Unclassified 882
85 Ga0070712_100108295 3300006175 Bacteria 2069
86 Ga0068871_100197101 3300006358 Bacteria 1737
87 Ga0068871_100854759 3300006358 Bacteria 841
88 Ga0068871_101222157 3300006358 Unclassified 705
89 Ga0075430_100216469 3300006846 Bacteria 1589
90 Ga0075431_100026121 3300006847 Bacteria 5989
91 Ga0075433_10913899 3300006852 Unclassified 765
92 Ga0075434_100304940 3300006871 Bacteria 1613
93 Ga0075429_100101806 3300006880 Bacteria 2508
94 Ga0075429_101337278 3300006880 Unclassified 624
95 Ga0075436_100001836 3300006914 Bacteria 14551
96 Ga0097620_100207084 3300006931 Bacteria 2047
97 Ga0075435_100974233 3300007076 Unclassified 740
98 Ga0105240_10000499 3300009093 Bacteria 72315
99 Ga0105240_10009391 3300009093 Bacteria 13853
100 Ga0105240_10032238 3300009093 Bacteria 6786
101 Ga0105240_10133752 3300009093 Bacteria 2971
102 Ga0105240_10138023 3300009093 Bacteria 2918
103 Ga0105240_10399281 3300009093 Bacteria 1549
104 Ga0105240_10546798 3300009093 Bacteria 1282
105 Ga0111539_10466327 3300009094 Bacteria 1471
106 Ga0111539_11689040 3300009094 Unclassified 734
107 Ga0105245_10067212 3300009098 Bacteria 3246
108 Ga0114129_10141327 3300009147 Bacteria 3300
109 Ga0105242_10053718 3300009176 Bacteria 3291
110 Ga0105242_10565202 3300009176 Bacteria 1093
111 Ga0105242_12085250 3300009176 Bacteria 611
112 Ga0105248_10045011 3300009177 Bacteria 4949
113 Ga0105248_10342378 3300009177 Bacteria 1683
114 Ga0105248_10379397 3300009177 Bacteria 1592
115 Ga0105248_10422838 3300009177 Bacteria 1501
116 Ga0105248_10574436 3300009177 Bacteria 1272
117 Ga0105248_11567200 3300009177 Bacteria 746
118 Ga0105237_10007763 3300009545 Bacteria 11701
119 Ga0105237_10019899 3300009545 Bacteria 6928
120 Ga0105237_10088653 3300009545 Bacteria 3083
121 Ga0105237_10095003 3300009545 Bacteria 2970
122 Ga0105237_11191625 3300009545 Bacteria 768
123 Ga0105237_11434137 3300009545 Unclassified 697
124 Ga0105237_11998215 3300009545 Bacteria 588
125 Ga0105238_10030482 3300009551 Bacteria 5491
126 Ga0105238_11217019 3300009551 Bacteria 778
127 Ga0105239_10061221 3300010375 Bacteria 4131
128 Ga0105239_10323674 3300010375 Bacteria 1739
129 Ga0105239_11977338 3300010375 Bacteria 677
130 Ga0105246_10161702 3300011119 Bacteria 1706
131 Ga0105246_10460600 3300011119 Bacteria 1071
132 Ga0157373_10452447 3300013100 Bacteria 924
133 Ga0157370_10008076 3300013104 Bacteria 11391
134 Ga0157369_10002875 3300013105 Bacteria 20565
135 Ga0157369_10157491 3300013105 Bacteria 2398
136 Ga0157369_10712294 3300013105 Bacteria 1033
137 Ga0157369_10827416 3300013105 Unclassified 951
138 Ga0157374_11185111 3300013296 Bacteria 785
139 Ga0157374_11724103 3300013296 Bacteria 651
140 Ga0157378_10284390 3300013297 Bacteria 1595
141 Ga0163162_10066137 3300013306 Bacteria 3664
142 Ga0163162_10438647 3300013306 Bacteria 1438
143 Ga0163162_10477560 3300013306 Bacteria 1378
144 Ga0163162_10744808 3300013306 Bacteria 1099
145 Ga0163162_10865905 3300013306 Bacteria 1018
146 Ga0163162_11115176 3300013306 Bacteria 894
147 Ga0157372_10019888 3300013307 Bacteria 7236
148 Ga0157372_10100619 3300013307 Bacteria 3299
149 Ga0157372_11136826 3300013307 Bacteria 903
150 Ga0157375_10346607 3300013308 Bacteria 1651
151 Ga0157375_10412605 3300013308 Bacteria 1517
152 Ga0157375_10506514 3300013308 Bacteria 1371
153 Ga0157375_11022666 3300013308 Bacteria 965
154 Ga0163163_10288332 3300014325 Bacteria 1693
155 Ga0163163_10522282 3300014325 Bacteria 1250
156 Ga0157380_10064720 3300014326 Bacteria 2936
157 Ga0157379_10285393 3300014968 Bacteria 1502
158 Ga0157379_10441832 3300014968 Bacteria 1200
159 Ga0157379_10484987 3300014968 Bacteria 1144
160 Ga0157379_10841355 3300014968 Bacteria 868
161 Ga0157379_11150345 3300014968 Unclassified 745
162 Ga0157376_11324938 3300014969 Bacteria 750
163 Ga0157376_12144970 3300014969 Bacteria 597
164 Ga0197907_10217174 3300020069 Bacteria 985
165 Ga0206356_11863614 3300020070 Bacteria 1387
166 Ga0206355_1190759 3300020076 Bacteria 2005
167 Ga0206352_10974344 3300020078 Bacteria 3115
168 Ga0206353_11713924 3300020082 Bacteria 2000
169 Ga0213873_10018493 3300021358 Bacteria 1603
170 Ga0213872_10001460 3300021361 Bacteria 15372
171 Ga0213874_10038454 3300021377 Unclassified 1420
172 Ga0213874_10041251 3300021377 Bacteria 1382
173 Ga0213876_10004016 3300021384 Bacteria 8279
174 Ga0213876_10022410 3300021384 Bacteria 3340
175 Ga0213876_10132314 3300021384 Unclassified 1326
176 Ga0213875_10000015 3300021388 Bacteria 280499
177 Ga0213875_10003963 3300021388 Bacteria 8257
178 Ga0213875_10005759 3300021388 Bacteria 6598
179 Ga0213875_10006316 3300021388 Bacteria 6237
180 Ga0213875_10010561 3300021388 Bacteria 4619
181 Ga0213875_10020844 3300021388 Bacteria 3143
182 Ga0213875_10082774 3300021388 Bacteria 1498
183 Ga0213875_10361851 3300021388 Bacteria 690
184 Ga0213875_10368952 3300021388 Bacteria 683
185 Ga0213875_10386005 3300021388 Unclassified 667
186 Ga0207653_10057079 3300025885 Unclassified 1310
187 Ga0207692_10068716 3300025898 Bacteria 1859
188 Ga0207699_10037573 3300025906 Bacteria 2769
189 Ga0207699_10115290 3300025906 Bacteria 1729
190 Ga0207699_10719937 3300025906 Bacteria 731
191 Ga0207699_10764686 3300025906 Unclassified 709
192 Ga0207705_10832414 3300025909 Bacteria 716
193 Ga0207684_10274982 3300025910 Unclassified 1453
194 Ga0207684_10903251 3300025910 Unclassified 742
195 Ga0207707_10006377 3300025912 Bacteria 10297
196 Ga0207707_10302960 3300025912 Bacteria 1382
197 Ga0207695_10008431 3300025913 Bacteria 12906
198 Ga0207695_10078461 3300025913 Bacteria 3350
199 Ga0207695_11435992 3300025913 Unclassified 570
200 Ga0207671_10017757 3300025914 Bacteria 5476
201 Ga0207671_10906563 3300025914 Unclassified 697
202 Ga0207693_10032561 3300025915 Bacteria 4113
203 Ga0207663_10013741 3300025916 Bacteria 4411
204 Ga0207663_10341681 3300025916 Bacteria 1131
205 Ga0207660_10060379 3300025917 Bacteria 2725
206 Ga0207660_10222223 3300025917 Bacteria 1483
207 Ga0207662_10256731 3300025918 Bacteria 1149
208 Ga0207652_10222470 3300025921 Bacteria 1701
209 Ga0207681_10259412 3300025923 Bacteria 1360
210 Ga0207694_10009425 3300025924 Bacteria 7360
211 Ga0207694_10072876 3300025924 Bacteria 2686
212 Ga0207694_10682970 3300025924 Unclassified 866
213 Ga0207659_10075820 3300025926 Bacteria 2469
214 Ga0207659_11274858 3300025926 Bacteria 631
215 Ga0207700_10036251 3300025928 Bacteria 3560
216 Ga0207700_10069403 3300025928 Bacteria 2705
217 Ga0207700_10233245 3300025928 Bacteria 1566
218 Ga0207700_10380966 3300025928 Bacteria 1234
219 Ga0207700_10982554 3300025928 Unclassified 756
220 Ga0207664_10000909 3300025929 Bacteria 19988
221 Ga0207644_10000319 3300025931 Bacteria 31445
222 Ga0207644_10340760 3300025931 Bacteria 1216
223 Ga0207686_10199579 3300025934 Bacteria 1432
224 Ga0207686_10273065 3300025934 Bacteria 1245
225 Ga0207670_10184204 3300025936 Bacteria 1575
226 Ga0207669_10538847 3300025937 Unclassified 940
227 Ga0207704_10681403 3300025938 Bacteria 849
228 Ga0207691_10152559 3300025940 Bacteria 2031
229 Ga0207711_10071486 3300025941 Bacteria 3010
230 Ga0207711_10255038 3300025941 Bacteria 1611
231 Ga0207711_10273104 3300025941 Bacteria 1556
232 Ga0207711_10296581 3300025941 Bacteria 1491
233 Ga0207689_10340808 3300025942 Bacteria 1245
234 Ga0207689_11066426 3300025942 Bacteria 681
235 Ga0207661_10000023 3300025944 Bacteria 197512
236 Ga0207661_10215305 3300025944 Bacteria 1695
237 Ga0207661_10588737 3300025944 Unclassified 1021
238 Ga0207661_10897735 3300025944 Bacteria 816
239 Ga0207661_10926096 3300025944 Bacteria 803
240 Ga0207667_10078657 3300025949 Bacteria 3418
241 Ga0207667_10387108 3300025949 Bacteria 1424
242 Ga0207651_10036009 3300025960 Bacteria 3226
243 Ga0207712_10893354 3300025961 Bacteria 785
244 Ga0207658_10389298 3300025986 Bacteria 1223
245 Ga0207677_10054726 3300026023 Bacteria 2725
246 Ga0207677_10184050 3300026023 Bacteria 1646
247 Ga0207677_10361439 3300026023 Bacteria 1220
248 Ga0207677_10616017 3300026023 Bacteria 954
249 Ga0207677_11024005 3300026023 Bacteria 750
250 Ga0207703_10178874 3300026035 Bacteria 1871
251 Ga0207703_10309598 3300026035 Bacteria 1443
252 Ga0207703_10814071 3300026035 Unclassified 892
253 Ga0207708_10069723 3300026075 Bacteria 2692
254 Ga0207702_10448284 3300026078 Bacteria 1252
255 Ga0207702_10801348 3300026078 Unclassified 931
256 Ga0207641_10151262 3300026088 Bacteria 2102
257 Ga0207676_10214675 3300026095 Bacteria 1709
258 Ga0207676_10354585 3300026095 Bacteria 1358
259 Ga0207683_10280183 3300026121 Bacteria 1523
260 Ga0207698_10011700 3300026142 Bacteria 5702
261 Ga0207698_10414590 3300026142 Bacteria 1291
262 Ga0207428_10236844 3300027907 Bacteria 1365
263 Ga0268266_10047774 3300028379 Bacteria 3668
264 Ga0268266_10049480 3300028379 Bacteria 3605
265 Ga0268266_10213702 3300028379 Bacteria 1770
266 Ga0268265_11050240 3300028380 Bacteria 807
267 Ga0268264_10313474 3300028381 Bacteria 1481
268 Ga0268264_11263776 3300028381 Bacteria 748
269 Ga0268264_11305337 3300028381 Bacteria 736
270 Ga0265323_10000551 3300028653 Bacteria 20743
271 Ga0265336_10031156 3300028666 Bacteria 1658
272 Ga0265336_10157942 3300028666 Unclassified 674
273 Ga0265338_10345061 3300028800 Bacteria 1072
274 Ga0265324_10011911 3300029957 Bacteria 3301
275 Ga0265760_10229283 3300031090 Unclassified 636
276 Ga0265332_10028663 3300031238 Bacteria 2436
277 Ga0265328_10290787 3300031239 Bacteria 630
278 Ga0265320_10012074 3300031240 Bacteria 5050
279 Ga0265329_10030844 3300031242 Bacteria 1744
280 Ga0265329_10083001 3300031242 Bacteria 1015
281 Ga0265339_10050972 3300031249 Bacteria 2261
282 Ga0265316_10025962 3300031344 Bacteria 4881
283 Ga0265316_10027029 3300031344 Bacteria 4761
284 Ga0265316_10030135 3300031344 Bacteria 4452
285 Ga0265316_10195918 3300031344 Bacteria 1499
286 Ga0265316_10200296 3300031344 Bacteria 1480
287 Ga0265316_10212661 3300031344 Bacteria 1429
288 Ga0265316_10265519 3300031344 Bacteria 1257
289 Ga0265316_10347320 3300031344 Bacteria 1074
290 Ga0265316_10635108 3300031344 Unclassified 756
291 Ga0265316_10770300 3300031344 Unclassified 676
292 Ga0265313_10056644 3300031595 Bacteria 1853
293 Ga0265314_10005858 3300031711 Bacteria 11002
294 Ga0265314_10027102 3300031711 Bacteria 4294
295 Ga0265314_10260191 3300031711 Unclassified 991
296 Ga0265342_10028839 3300031712 Bacteria 3452
297 Ga0265342_10035262 3300031712 Bacteria 3064
298 Ga0265342_10094541 3300031712 Bacteria 1710
299 Ga0265342_10098294 3300031712 Bacteria 1671
300 Ga0373926_0040513 3300035083 Bacteria 1663
301 Ga0373934_0034548 3300035086 Bacteria 1987
302 Ga0373934_0046696 3300035086 Bacteria 1713
303 Ga0373923_0049744 3300035111 Bacteria 1754
304 Ga0373923_0062171 3300035111 Bacteria 1588
305 Ga0373923_0450442 3300035111 Unclassified 624
306 Ga0373932_0152005 3300035112 Bacteria 795
307 Ga0373945_0010101 3300035116 Bacteria 3104
308 Ga0373945_0028073 3300035116 Bacteria 1969
309 Ga0373945_0201219 3300035116 Bacteria 827
310 Ga0373954_0013236 3300035118 Bacteria 3675
311 Ga0373954_0038807 3300035118 Bacteria 2216
312 Ga0373954_0071936 3300035118 Bacteria 1644
313 Ga0373956_0019695 3300035119 Bacteria 2864
314 Ga0373956_0084194 3300035119 Bacteria 1462
315 Ga0373956_0393369 3300035119 Bacteria 661
316 Ga0373946_0266801 3300035171 Unclassified 839
317 Ga0373955_0022818 3300035172 Bacteria 3180
318 Ga0373955_0189650 3300035172 Unclassified 1222
319 Ga0373924_0223751 3300035410 Bacteria 831
320 Ga0373924_0375066 3300035410 Unclassified 635
321 Ga0373935_0062429 3300035692 Bacteria 2387
322 Ga0373935_0070950 3300035692 Bacteria 2247
323 Ga0373935_0176157 3300035692 Bacteria 1466
324 Ga0373935_0208864 3300035692 Bacteria 1352
325 Ga0373935_0402605 3300035692 Unclassified 983
326 Ga0373927_0002498 3300035695 Bacteria 13419
327 Ga0373927_0005209 3300035695 Bacteria 8992
328 Ga0373927_0050637 3300035695 Bacteria 2686
329 Ga0373927_0057048 3300035695 Bacteria 2525
330 Ga0373927_0274787 3300035695 Bacteria 1108
331 Ga0373927_0369326 3300035695 Unclassified 946
332 Ga0373927_0618461 3300035695 Bacteria 716
333 Ga0373927_0830389 3300035695 Bacteria 610
334 Ga0373933_0100069 3300035724 Bacteria 1798
335 Ga0373933_0149189 3300035724 Bacteria 1480
336 Ga0373933_0311819 3300035724 Bacteria 1019
337 Ga0373933_0473283 3300035724 Unclassified 820
338 Ga0373947_0002143 3300035725 Bacteria 11994
339 Ga0373947_0013403 3300035725 Bacteria 4698
340 Ga0373947_0039848 3300035725 Bacteria 2797
341 Ga0373947_0159656 3300035725 Bacteria 1457
342 Ga0373947_0245966 3300035725 Bacteria 1181
343 Ga0373947_0325633 3300035725 Bacteria 1028
344 Ga0373947_0540144 3300035725 Bacteria 793
345 Ga0373937_0002194 3300036401 Bacteria 16322
346 Ga0373937_0056266 3300036401 Bacteria 3612
347 Ga0373937_0116801 3300036401 Bacteria 2485
348 Ga0373937_0196733 3300036401 Bacteria 1895
349 Ga0373937_0364726 3300036401 Bacteria 1369
350 Ga0373937_0411538 3300036401 Bacteria 1283
351 Ga0373937_1246386 3300036401 Unclassified 692
352 Ga0373925_0004149 3300037068 Bacteria 10988
353 Ga0373925_0007421 3300037068 Bacteria 8000
354 Ga0373925_0032010 3300037068 Bacteria 3869
355 Ga0373925_0167284 3300037068 Bacteria 1734
356 Ga0373925_0188470 3300037068 Bacteria 1636
357 Ga0373925_0425905 3300037068 Bacteria 1085
358 Ga0373925_1068220 3300037068 Bacteria 664
359 Ga0395900_0152198 3300037418 Bacteria 2363
360 Ga0395898_0031033 3300037466 Bacteria 5345
361 Ga0395898_1811532 3300037466 Unclassified 531
362 Ga0395905_0126042 3300037471 Bacteria 2408
363 Ga0436364_0232225 3300037853 Bacteria 3027
364 Ga0436364_0240413 3300037853 Bacteria 9540
365 Ga0436364_0525531 3300037853 Bacteria 644
366 Ga0436364_0795966 3300037853 Bacteria 2302
367 Ga0436364_0875117 3300037853 Unclassified 2284
368 Ga0436364_0958994 3300037853 Unclassified 947
369 Ga0436364_1054367 3300037853 Bacteria 18076
370 Ga0436364_1058247 3300037853 Bacteria 8845
371 Ga0436364_1113127 3300037853 Bacteria 158393
372 Ga0436364_1168163 3300037853 Bacteria 3423
373 Ga0436364_1180625 3300037853 Bacteria 3163
374 Ga0436364_1304040 3300037853 Bacteria 1645
375 Ga0436364_1546209 3300037853 Bacteria 11305
376 Ga0436365_0449960 3300039437 Bacteria 2249
377 Ga0436365_0621936 3300039437 Bacteria 2638
378 Ga0436365_0746654 3300039437 Unclassified 1248
379 Ga0436365_0890233 3300039437 Bacteria 9662
380 Ga0436360_0222243 3300039438 Bacteria 17184
381 Ga0436360_0521178 3300039438 Bacteria 2502
382 Ga0436361_0754359 3300039447 Bacteria 78520
383 Ga0436363_0148707 3300039450 Unclassified 576
384 Ga0436363_0721465 3300039450 Bacteria 777
385 Ga0436363_1072308 3300039450 Bacteria 1254
386 Ga0436363_1367345 3300039450 Bacteria 1373
387 Ga0436363_1489992 3300039450 Bacteria 646
388 Ga0436363_1684757 3300039450 Bacteria 16063
389 Ga0436362_0217122 3300039453 Bacteria 897
390 Ga0436362_0262211 3300039453 Bacteria 2397
391 Ga0436362_0459212 3300039453 Unclassified 680
392 Ga0436362_0711094 3300039453 Bacteria 680
393 Ga0439448_0060225 3300042005 Bacteria 1254
394 Ga0451577_0310757 3300042876 Bacteria 1429
395 Ga0451577_0687573 3300042876 Bacteria 927
396 Ga0451577_1255923 3300042876 Bacteria 660
397 Ga0466961_0338854 3300044693 Unclassified 916
398 Ga0466963_0657129 3300044694 Bacteria 740
399 Ga0453684_1790514 3300044712 Bacteria 625
400 Ga0466957_0348951 3300044842 Bacteria 1004
401 Ga0451576_0176092 3300045051 Bacteria 2233
402 Ga0451576_0207021 3300045051 Bacteria 2048
403 Ga0495592_0021125 3300046454 Bacteria 4950
404 Ga0495629_0143882 3300046459 Bacteria 1659
405 Ga0495651_0004949 3300046462 Bacteria 10181
406 Ga0495653_0120909 3300046463 Bacteria 1867
407 Ga0495653_0651669 3300046463 Unclassified 643
408 Ga0495580_0003198 3300046472 Bacteria 14027
409 Ga0495580_0003953 3300046472 Bacteria 12504
410 Ga0495580_0030911 3300046472 Bacteria 3874
411 Ga0495580_0035122 3300046472 Bacteria 3605
412 Ga0495580_0093271 3300046472 Bacteria 2095
413 Ga0495580_0094230 3300046472 Bacteria 2083
414 Ga0495580_0181060 3300046472 Bacteria 1455
415 Ga0495580_0261334 3300046472 Bacteria 1184
416 Ga0495582_0030970 3300046473 Bacteria 2939
417 Ga0495582_0326016 3300046473 Bacteria 884
418 Ga0495639_0164858 3300046475 Bacteria 1074
419 Ga0495662_0006310 3300046476 Bacteria 5927
420 Ga0495662_0207455 3300046476 Bacteria 966
421 Ga0495664_0005462 3300046477 Bacteria 6981
422 Ga0495594_0044335 3300046499 Bacteria 2439
423 Ga0495628_0017579 3300046516 Bacteria 5948
424 Ga0495630_0018223 3300046517 Bacteria 5156
425 Ga0495630_0138611 3300046517 Bacteria 1849
426 Ga0495630_0253088 3300046517 Bacteria 1346
427 Ga0495630_0741247 3300046517 Unclassified 751
428 Ga0495630_0866125 3300046517 Bacteria 689
429 Ga0495666_0074983 3300046526 Bacteria 1604
430 Ga0495642_0071903 3300046528 Bacteria 1448
431 Ga0495642_0179298 3300046528 Bacteria 922
432 Ga0495652_0199929 3300046529 Bacteria 1517
433 Ga0495652_0324229 3300046529 Bacteria 1112
434 Ga0495652_0345725 3300046529 Bacteria 1067
435 Ga0495665_0077503 3300046531 Bacteria 1749
436 Ga0495665_0098396 3300046531 Bacteria 1536
437 Ga0495640_0030115 3300046533 Bacteria 3889
438 Ga0495640_0033574 3300046533 Bacteria 3644
439 Ga0495640_0258360 3300046533 Bacteria 1089
440 Ga0495587_0126528 3300046536 Bacteria 1462
441 Ga0495621_0253221 3300046539 Bacteria 720
442 Ga0495645_0012959 3300046543 Bacteria 5884
443 Ga0495667_0056110 3300046559 Bacteria 2590
444 Ga0495667_0523642 3300046559 Bacteria 742
445 Ga0495667_0597484 3300046559 Unclassified 688
446 Ga0495634_0110074 3300046642 Bacteria 1772
447 Ga0495634_0294209 3300046642 Bacteria 983
448 Ga0495635_0009673 3300046663 Bacteria 6742
449 Ga0495657_0246283 3300046675 Unclassified 1077
450 Ga0495599_0013530 3300046678 Bacteria 5040
451 Ga0495599_0279898 3300046678 Bacteria 1011
452 Ga0495599_0498053 3300046678 Unclassified 717
453 Ga0495623_0038881 3300046679 Bacteria 3042
454 Ga0495623_0153314 3300046679 Bacteria 1360
455 Ga0495658_0392120 3300046683 Bacteria 885
456 Ga0495613_0178718 3300046689 Bacteria 1503
457 Ga0495613_0409962 3300046689 Bacteria 923
458 Ga0495624_0342306 3300046690 Bacteria 900
459 Ga0495624_0601342 3300046690 Bacteria 655
460 Ga0495600_0147250 3300046809 Bacteria 1526
461 Ga0495604_0024738 3300047317 Bacteria 4791
462 Ga0495604_0038849 3300047317 Bacteria 3745
463 Ga0495604_0348872 3300047317 Unclassified 984
464 Ga0495604_0785295 3300047317 Bacteria 600
465 Ga0495674_0006604 3300047319 Bacteria 11123
466 Ga0495674_0111197 3300047319 Bacteria 2322
467 Ga0495674_0345730 3300047319 Bacteria 1208
468 Ga0495674_0617233 3300047319 Unclassified 858
469 Ga0495680_0035015 3300047322 Bacteria 4048
470 Ga0495675_0091462 3300047444 Bacteria 1910
471 Ga0495684_0035016 3300047471 Bacteria 3851
472 Ga0495684_0071245 3300047471 Bacteria 2641
473 Ga0495684_0088500 3300047471 Bacteria 2347
474 Ga0495684_0352787 3300047471 Bacteria 1044
475 Ga0495602_0066823 3300048088 Bacteria 3096
476 Ga0496101_0203342 3300048904 Bacteria 1532
477 Ga0496108_0232351 3300048911 Bacteria 1604
478 Ga0496110_0404010 3300048913 Bacteria 1245
479 Ga0496112_0218988 3300048915 Bacteria 1860
480 Ga0496112_0596512 3300048915 Unclassified 1037
481 Ga0496114_0117466 3300048917 Bacteria 2285
482 Ga0496115_0085288 3300048918 Bacteria 2576
483 Ga0496126_0040801 3300048929 Bacteria 4301
484 Ga0501031_0138279 3300049568 Bacteria 1591
485 Ga0501034_0005315 3300049571 Bacteria 14116
486 Ga0501036_0000166 3300049572 Bacteria 43443
487 Ga0501037_0000725 3300049573 Bacteria 24969
488 Ga0501038_0001071 3300049574 Bacteria 24706
489 Ga0501039_0181810 3300049575 Bacteria 1653
490 Ga0501043_0002427 3300049579 Bacteria 15777
491 Ga0501046_0004643 3300049580 Bacteria 12408
492 Ga0501047_0030986 3300049581 Bacteria 5157
493 Ga0501047_0037706 3300049581 Bacteria 4674
494 Ga0501047_0122984 3300049581 Bacteria 2476
495 Ga0501048_0004510 3300049582 Bacteria 10606
496 Ga0501067_0002275 3300049583 Bacteria 10597
497 Ga0501068_0001612 3300049584 Bacteria 12016
498 Ga0501068_0203619 3300049584 Bacteria 1255
499 Ga0501069_0000541 3300049585 Bacteria 17301
500 Ga0501072_0001111 3300049588 Bacteria 20026
501 Ga0501072_0212126 3300049588 Bacteria 1543
502 Ga0501073_0001369 3300049589 Bacteria 18006
503 Ga0501073_0068171 3300049589 Bacteria 2480
504 Ga0501074_0959627 3300049590 Unclassified 601
505 Ga0501075_0251930 3300049591 Unclassified 1346
506 Ga0501076_0038791 3300049592 Bacteria 3739
507 Ga0501077_0044935 3300049593 Bacteria 2805
508 Ga0501079_0011298 3300049741 Bacteria 6810
509 Ga0501080_0001872 3300049742 Bacteria 18101
510 Ga0501081_0374866 3300049743 Bacteria 1051
511 Ga0501081_0411331 3300049743 Bacteria 1002
512 Ga0501081_0813058 3300049743 Unclassified 704
513 Ga0501083_0203583 3300049744 Bacteria 1291
514 Ga0501035_0157586 3300049822 Bacteria 1967
515 Ga0501044_0002703 3300049823 Bacteria 20155
516 Ga0501044_0003143 3300049823 Bacteria 18681
517 Ga0501044_0023886 3300049823 Bacteria 6497
518 Ga0501045_0166945 3300049824 Bacteria 1639
519 Ga0501045_0168732 3300049824 Bacteria 1630
520 nmdc:mga05p37_41937_c1 3300050507 Bacteria 5621
521 nmdc:mga05p37_428626_c1 3300050507 Bacteria 1537
522 nmdc:mga05p37_539278_c1 3300050507 Bacteria 1330
523 nmdc:mga09592_76201_c1 3300050508 Bacteria 2852
524 nmdc:mga06r32_19096_c1 3300050510 Bacteria 6287
525 nmdc:mga08y16_30856_c1 3300050511 Bacteria 5637
526 nmdc:mga08y16_996279_c1 3300050511 Bacteria 818
527 nmdc:mga0n895_2117298_c1 3300050512 Unclassified 519
528 nmdc:mga0n895_408546_c1 3300050512 Bacteria 1373
529 nmdc:mga08x19_876_c1 3300050514 Bacteria 19129
530 Ga0495619_0107965 3300053085 Bacteria 1899
531 Ga0501084_0002720 3300054114 Bacteria 14253
532 Ga0501082_0000322 3300060353 Bacteria 42523
533 Ga0501082_0042923 3300060353 Bacteria 3897
534 Ga0501082_0561104 3300060353 Bacteria 999
535 Ga0070716_100239668
536 Ga0058863_11307950
537 Ga0058863_11698189
538 Ga0070658_10253597
539 Ga0070658_10381052
540 Ga0070683_101110485
541 Ga0070683_101763082
542 Ga0070690_100108522
543 Ga0068869_101282194
544 Ga0070680_100003385
545 Ga0070680_100085128
546 Ga0070680_100422512
547 Ga0068868_100146981
548 Ga0070689_100081141
549 Ga0070689_100284218
550 Ga0070669_100207488
551 Ga0070669_100308774
552 Ga0070675_100528993
553 Ga0070671_100001915
554 Ga0070671_100168494
555 Ga0070674_100293671
556 Ga0070688_100172936
557 Ga0070688_100228848
558 Ga0070667_100577066
559 Ga0070709_10438206
560 Ga0070714_100011348
561 Ga0070714_100063187
562 Ga0070714_100410392
563 Ga0070713_100001320
564 Ga0070713_100068731
565 Ga0070713_100964237
566 Ga0070713_101119388
567 Ga0070711_100009101
568 Ga0070711_100091433
569 Ga0070711_100672241
570 Ga0070711_101126573
571 Ga0070705_100230039
572 Ga0070705_100290456
573 Ga0070694_100031462
574 Ga0070708_100894492
575 Ga0070663_100307096
576 Ga0070678_100173124
577 Ga0070678_100233852
578 Ga0070681_10126011
579 Ga0070681_11456968
580 Ga0068867_101134919
581 Ga0070685_10125837
582 Ga0070685_10477270
583 Ga0070706_100317826
584 Ga0070699_100090023
585 Ga0070699_100304427
586 Ga0070699_100323636
587 Ga0070679_100101926
588 Ga0070684_100020620
589 Ga0070684_100347560
590 Ga0070697_100855695
591 Ga0068853_100603873
592 Ga0068853_100762163
593 Ga0070695_101245126
594 Ga0070696_100001670
595 Ga0070693_100382234
596 Ga0070665_100151417
597 Ga0070704_101754188
598 Ga0068855_100005394
599 Ga0068855_100084716
600 Ga0068854_100282890
601 Ga0068856_100080273
602 Ga0068852_100009021
603 Ga0068852_100234995
604 Ga0068859_100207083
605 Ga0068864_101298747
606 Ga0068858_100101333
607 Ga0068858_100409861
608 Ga0068860_100358866
609 Ga0068862_100152179
610 Ga0068862_101180580
611 Ga0081455_10017775
612 Ga0070717_10061387
613 Ga0070717_10106073
614 Ga0070717_10115432
615 Ga0070717_10354550
616 Ga0070717_11155596
617 Ga0070716_100211692
618 Ga0070716_100519301
619 Ga0070712_100108295
620 Ga0068871_100197101
621 Ga0068871_100854759
622 Ga0068871_101222157
623 Ga0075430_100216469
624 Ga0075431_100026121
625 Ga0075433_10913899
626 Ga0075434_100304940
627 Ga0075429_100101806
628 Ga0075429_101337278
629 Ga0075436_100001836
630 Ga0097620_100207084
631 Ga0075435_100974233
632 Ga0105240_10000499
633 Ga0105240_10009391
634 Ga0105240_10032238
635 Ga0105240_10133752
636 Ga0105240_10138023
637 Ga0105240_10399281
638 Ga0105240_10546798
639 Ga0111539_10466327
640 Ga0111539_11689040
641 Ga0105245_10067212
642 Ga0114129_10141327
643 Ga0105242_10053718
644 Ga0105242_10565202
645 Ga0105242_12085250
646 Ga0105248_10045011
647 Ga0105248_10342378
648 Ga0105248_10379397
649 Ga0105248_10422838
650 Ga0105248_10574436
651 Ga0105248_11567200
652 Ga0105237_10007763
653 Ga0105237_10019899
654 Ga0105237_10088653
655 Ga0105237_10095003
656 Ga0105237_11191625
657 Ga0105237_11434137
658 Ga0105237_11998215
659 Ga0105238_10030482
660 Ga0105238_11217019
661 Ga0105239_10061221
662 Ga0105239_10323674
663 Ga0105239_11977338
664 Ga0105246_10161702
665 Ga0105246_10460600
666 Ga0157373_10452447
667 Ga0157370_10008076
668 Ga0157369_10002875
669 Ga0157369_10157491
670 Ga0157369_10712294
671 Ga0157369_10827416
672 Ga0157374_11185111
673 Ga0157374_11724103
674 Ga0157378_10284390
675 Ga0163162_10066137
676 Ga0163162_10438647
677 Ga0163162_10477560
678 Ga0163162_10744808
679 Ga0163162_10865905
680 Ga0163162_11115176
681 Ga0157372_10019888
682 Ga0157372_10100619
683 Ga0157372_11136826
684 Ga0157375_10346607
685 Ga0157375_10412605
686 Ga0157375_10506514
687 Ga0157375_11022666
688 Ga0163163_10288332
689 Ga0163163_10522282
690 Ga0157380_10064720
691 Ga0157379_10285393
692 Ga0157379_10441832
693 Ga0157379_10484987
694 Ga0157379_10841355
695 Ga0157379_11150345
696 Ga0157376_11324938
697 Ga0157376_12144970
698 Ga0197907_10217174
699 Ga0206356_11863614
700 Ga0206355_1190759
701 Ga0206352_10974344
702 Ga0206353_11713924
703 Ga0213873_10018493
704 Ga0213872_10001460
705 Ga0213874_10038454
706 Ga0213874_10041251
707 Ga0213876_10004016
708 Ga0213876_10022410
709 Ga0213876_10132314
710 Ga0213875_10000015
711 Ga0213875_10003963
712 Ga0213875_10005759
713 Ga0213875_10006316
714 Ga0213875_10010561
715 Ga0213875_10020844
716 Ga0213875_10082774
717 Ga0213875_10361851
718 Ga0213875_10368952
719 Ga0213875_10386005
720 Ga0207653_10057079
721 Ga0207692_10068716
722 Ga0207699_10037573
723 Ga0207699_10115290
724 Ga0207699_10719937
725 Ga0207699_10764686
726 Ga0207705_10832414
727 Ga0207684_10274982
728 Ga0207684_10903251
729 Ga0207707_10006377
730 Ga0207707_10302960
731 Ga0207695_10008431
732 Ga0207695_10078461
733 Ga0207695_11435992
734 Ga0207671_10017757
735 Ga0207671_10906563
736 Ga0207693_10032561
737 Ga0207663_10013741
738 Ga0207663_10341681
739 Ga0207660_10060379
740 Ga0207660_10222223
741 Ga0207662_10256731
742 Ga0207652_10222470
743 Ga0207681_10259412
744 Ga0207694_10009425
745 Ga0207694_10072876
746 Ga0207694_10682970
747 Ga0207659_10075820
748 Ga0207659_11274858
749 Ga0207700_10036251
750 Ga0207700_10069403
751 Ga0207700_10233245
752 Ga0207700_10380966
753 Ga0207700_10982554
754 Ga0207664_10000909
755 Ga0207644_10000319
756 Ga0207644_10340760
757 Ga0207686_10199579
758 Ga0207686_10273065
759 Ga0207670_10184204
760 Ga0207669_10538847
761 Ga0207704_10681403
762 Ga0207691_10152559
763 Ga0207711_10071486
764 Ga0207711_10255038
765 Ga0207711_10273104
766 Ga0207711_10296581
767 Ga0207689_10340808
768 Ga0207689_11066426
769 Ga0207661_10000023
770 Ga0207661_10215305
771 Ga0207661_10588737
772 Ga0207661_10897735
773 Ga0207661_10926096
774 Ga0207667_10078657
775 Ga0207667_10387108
776 Ga0207651_10036009
777 Ga0207712_10893354
778 Ga0207658_10389298
779 Ga0207677_10054726
780 Ga0207677_10184050
781 Ga0207677_10361439
782 Ga0207677_10616017
783 Ga0207677_11024005
784 Ga0207703_10178874
785 Ga0207703_10309598
786 Ga0207703_10814071
787 Ga0207708_10069723
788 Ga0207702_10448284
789 Ga0207702_10801348
790 Ga0207641_10151262
791 Ga0207676_10214675
792 Ga0207676_10354585
793 Ga0207683_10280183
794 Ga0207698_10011700
795 Ga0207698_10414590
796 Ga0207428_10236844
797 Ga0268266_10047774
798 Ga0268266_10049480
799 Ga0268266_10213702
800 Ga0268265_11050240
801 Ga0268264_10313474
802 Ga0268264_11263776
803 Ga0268264_11305337
804 Ga0265323_10000551
805 Ga0265336_10031156
806 Ga0265336_10157942
807 Ga0265338_10345061
808 Ga0265324_10011911
809 Ga0265760_10229283
810 Ga0265332_10028663
811 Ga0265328_10290787
812 Ga0265320_10012074
813 Ga0265329_10030844
814 Ga0265329_10083001
815 Ga0265339_10050972
816 Ga0265316_10025962
817 Ga0265316_10027029
818 Ga0265316_10030135
819 Ga0265316_10195918
820 Ga0265316_10200296
821 Ga0265316_10212661
822 Ga0265316_10265519
823 Ga0265316_10347320
824 Ga0265316_10635108
825 Ga0265316_10770300
826 Ga0265313_10056644
827 Ga0265314_10005858
828 Ga0265314_10027102
829 Ga0265314_10260191
830 Ga0265342_10028839
831 Ga0265342_10035262
832 Ga0265342_10094541
833 Ga0265342_10098294
834 Ga0373926_0040513
835 Ga0373934_0034548
836 Ga0373934_0046696
837 Ga0373923_0049744
838 Ga0373923_0062171
839 Ga0373923_0450442
840 Ga0373932_0152005
841 Ga0373945_0010101
842 Ga0373945_0028073
843 Ga0373945_0201219
844 Ga0373954_0013236
845 Ga0373954_0038807
846 Ga0373954_0071936
847 Ga0373956_0019695
848 Ga0373956_0084194
849 Ga0373956_0393369
850 Ga0373946_0266801
851 Ga0373955_0022818
852 Ga0373955_0189650
853 Ga0373924_0223751
854 Ga0373924_0375066
855 Ga0373935_0062429
856 Ga0373935_0070950
857 Ga0373935_0176157
858 Ga0373935_0208864
859 Ga0373935_0402605
860 Ga0373927_0002498
861 Ga0373927_0005209
862 Ga0373927_0050637
863 Ga0373927_0057048
864 Ga0373927_0274787
865 Ga0373927_0369326
866 Ga0373927_0618461
867 Ga0373927_0830389
868 Ga0373933_0100069
869 Ga0373933_0149189
870 Ga0373933_0311819
871 Ga0373933_0473283
872 Ga0373947_0002143
873 Ga0373947_0013403
874 Ga0373947_0039848
875 Ga0373947_0159656
876 Ga0373947_0245966
877 Ga0373947_0325633
878 Ga0373947_0540144
879 Ga0373937_0002194
880 Ga0373937_0056266
881 Ga0373937_0116801
882 Ga0373937_0196733
883 Ga0373937_0364726
884 Ga0373937_0411538
885 Ga0373937_1246386
886 Ga0373925_0004149
887 Ga0373925_0007421
888 Ga0373925_0032010
889 Ga0373925_0167284
890 Ga0373925_0188470
891 Ga0373925_0425905
892 Ga0373925_1068220
893 Ga0395900_0152198
894 Ga0395898_0031033
895 Ga0395898_1811532
896 Ga0395905_0126042
897 Ga0436364_0232225
898 Ga0436364_0240413
899 Ga0436364_0525531
900 Ga0436364_0795966
901 Ga0436364_0875117
902 Ga0436364_0958994
903 Ga0436364_1054367
904 Ga0436364_1058247
905 Ga0436364_1113127
906 Ga0436364_1168163
907 Ga0436364_1180625
908 Ga0436364_1304040
909 Ga0436364_1546209
910 Ga0436365_0449960
911 Ga0436365_0621936
912 Ga0436365_0746654
913 Ga0436365_0890233
914 Ga0436360_0222243
915 Ga0436360_0521178
916 Ga0436361_0754359
917 Ga0436363_0148707
918 Ga0436363_0721465
919 Ga0436363_1072308
920 Ga0436363_1367345
921 Ga0436363_1489992
922 Ga0436363_1684757
923 Ga0436362_0217122
924 Ga0436362_0262211
925 Ga0436362_0459212
926 Ga0436362_0711094
927 Ga0439448_0060225
928 Ga0451577_0310757
929 Ga0451577_0687573
930 Ga0451577_1255923
931 Ga0466961_0338854
932 Ga0466963_0657129
933 Ga0453684_1790514
934 Ga0466957_0348951
935 Ga0451576_0176092
936 Ga0451576_0207021
937 Ga0495592_0021125
938 Ga0495629_0143882
939 Ga0495651_0004949
940 Ga0495653_0120909
941 Ga0495653_0651669
942 Ga0495580_0003198
943 Ga0495580_0003953
944 Ga0495580_0030911
945 Ga0495580_0035122
946 Ga0495580_0093271
947 Ga0495580_0094230
948 Ga0495580_0181060
949 Ga0495580_0261334
950 Ga0495582_0030970
951 Ga0495582_0326016
952 Ga0495639_0164858
953 Ga0495662_0006310
954 Ga0495662_0207455
955 Ga0495664_0005462
956 Ga0495594_0044335
957 Ga0495628_0017579
958 Ga0495630_0018223
959 Ga0495630_0138611
960 Ga0495630_0253088
961 Ga0495630_0741247
962 Ga0495630_0866125
963 Ga0495666_0074983
964 Ga0495642_0071903
965 Ga0495642_0179298
966 Ga0495652_0199929
967 Ga0495652_0324229
968 Ga0495652_0345725
969 Ga0495665_0077503
970 Ga0495665_0098396
971 Ga0495640_0030115
972 Ga0495640_0033574
973 Ga0495640_0258360
974 Ga0495587_0126528
975 Ga0495621_0253221
976 Ga0495645_0012959
977 Ga0495667_0056110
978 Ga0495667_0523642
979 Ga0495667_0597484
980 Ga0495634_0110074
981 Ga0495634_0294209
982 Ga0495635_0009673
983 Ga0495657_0246283
984 Ga0495599_0013530
985 Ga0495599_0279898
986 Ga0495599_0498053
987 Ga0495623_0038881
988 Ga0495623_0153314
989 Ga0495658_0392120
990 Ga0495613_0178718
991 Ga0495613_0409962
992 Ga0495624_0342306
993 Ga0495624_0601342
994 Ga0495600_0147250
995 Ga0495604_0024738
996 Ga0495604_0038849
997 Ga0495604_0348872
998 Ga0495604_0785295
999 Ga0495674_0006604
1000 Ga0495674_0111197
1001 Ga0495674_0345730
1002 Ga0495674_0617233
1003 Ga0495680_0035015
1004 Ga0495675_0091462
1005 Ga0495684_0035016
1006 Ga0495684_0071245
1007 Ga0495684_0088500
1008 Ga0495684_0352787
1009 Ga0495602_0066823
1010 Ga0496101_0203342
1011 Ga0496108_0232351
1012 Ga0496110_0404010
1013 Ga0496112_0218988
1014 Ga0496112_0596512
1015 Ga0496114_0117466
1016 Ga0496115_0085288
1017 Ga0496126_0040801
1018 Ga0501031_0138279
1019 Ga0501034_0005315
1020 Ga0501036_0000166
1021 Ga0501037_0000725
1022 Ga0501038_0001071
1023 Ga0501039_0181810
1024 Ga0501043_0002427
1025 Ga0501046_0004643
1026 Ga0501047_0030986
1027 Ga0501047_0037706
1028 Ga0501047_0122984
1029 Ga0501048_0004510
1030 Ga0501067_0002275
1031 Ga0501068_0001612
1032 Ga0501068_0203619
1033 Ga0501069_0000541
1034 Ga0501072_0001111
1035 Ga0501072_0212126
1036 Ga0501073_0001369
1037 Ga0501073_0068171
1038 Ga0501074_0959627
1039 Ga0501075_0251930
1040 Ga0501076_0038791
1041 Ga0501077_0044935
1042 Ga0501079_0011298
1043 Ga0501080_0001872
1044 Ga0501081_0374866
1045 Ga0501081_0411331
1046 Ga0501081_0813058
1047 Ga0501083_0203583
1048 Ga0501035_0157586
1049 Ga0501044_0002703
1050 Ga0501044_0003143
1051 Ga0501044_0023886
1052 Ga0501045_0166945
1053 Ga0501045_0168732
1054 nmdc:mga05p37_41937_c1
1055 nmdc:mga05p37_428626_c1
1056 nmdc:mga05p37_539278_c1
1057 nmdc:mga09592_76201_c1
1058 nmdc:mga06r32_19096_c1
1059 nmdc:mga08y16_30856_c1
1060 nmdc:mga08y16_996279_c1
1061 nmdc:mga0n895_2117298_c1
1062 nmdc:mga0n895_408546_c1
1063 nmdc:mga08x19_876_c1
1064 Ga0495619_0107965
1065 Ga0501084_0002720
1066 Ga0501082_0000322
1067 Ga0501082_0042923
1068 Ga0501082_0561104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

100

175

0.97

PF00347

Ribosomal_L6

Ribosomal protein L6

24

92

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.9349 39 147
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.9269 39 147
7pit-assembly1.cif.gz_e 70s ribosome with ef-g, a/p- and p/e-site trnas in pseudouridimycin-treated mycoplasma pneumoniae cells 0.9029 3 154
6yef-assembly1.cif.gz_H 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.8956 11 149
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.8931 11 150
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9743 63 149 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9646 63 150 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9543 63 144 3.90.930.12
1vw4F02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9447 63 149 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9396 63 148 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A830BRH5-F1-model_v4 60S ribosomal protein l6 mitochondrial 0.9857 63 144 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2J6L7U4-F1-model_v4 deleted 0.9854 62 144
AF-A0A1V4GKA1-F1-model_v4 deleted 0.9834 56 126
AF-A0A2J1D431-F1-model_v4 deleted 0.9833 53 148
AF-A0A3D0SRG5-F1-model_v4 50S ribosomal protein L6 0.9833 71 149 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map