F460519

General Info

Members Datasets Scaffolds Average Seq Length
534 205 1068 384

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100088585|Ga0070695_1000885851
Length 435
Sequence LIASIQSPTVFESPDSKSGMSTSEQQHGLVLGPQASPPAVLPTQKLDFNGAGEDACGPSNKVHRNPKILGVQKFFEGESVAVRVVRAIEESHHLTAKLVRLYNWILTNRQHWMKYFYWCVNHIRPETREFFHRRCVGYVAGLFERWCPHVVVSVHPLTQHIFGRVLKELNLADRVPLISVVTDPCYGFWKGWACDAVSLYLVASDEARRQLIDYGVAPERIKISGMPVHPKFAYPGEDAAKAARAALGLDPEKFTVFVNAGWAGGGNIPQIFKELIRGELDVQAIFLAGRNEDLRAAAESLALDAPFPIKVIGYSDEIEKLMSAANVMISKLGGLTTFEALACRVPIIADVTTEPMPQEAGTANLIAERGAGVMLRRTSDVVPAVRRMLEDEGHYSRLRAATVGVAIPNATRQIVEEIAALIPQPENAAFGEVSA

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
182 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 1.31
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100088585 3300005545 Unclassified 2061
2 JGI24751J29686_10000157 3300002459 Bacteria 32511
3 JGI25406J46586_10017102 3300003203 Bacteria 3005
4 Ga0065714_10064469 3300005288 Bacteria 61986
5 Ga0065704_10139663 3300005289 Bacteria 1531
6 Ga0065712_10000127 3300005290 Bacteria 117106
7 Ga0065712_10004385 3300005290 Bacteria 3435
8 Ga0065712_10127414 3300005290 Bacteria 1574
9 Ga0065715_10007115 3300005293 Bacteria 3401
10 Ga0065715_10009135 3300005293 Bacteria 2981
11 Ga0065715_10010924 3300005293 Bacteria 3839
12 Ga0065715_10089776 3300005293 Bacteria 8552
13 Ga0065715_10090317 3300005293 Bacteria 7231
14 Ga0065707_10001352 3300005295 Bacteria 12799
15 Ga0065707_10123193 3300005295 Bacteria 2017
16 Ga0070676_10055178 3300005328 Unclassified 2344
17 Ga0070690_100001545 3300005330 Bacteria 12078
18 Ga0070690_100019946 3300005330 Bacteria 4079
19 Ga0070690_100036269 3300005330 Bacteria 3098
20 Ga0070670_100000866 3300005331 Bacteria 23779
21 Ga0070670_100001218 3300005331 Bacteria 20468
22 Ga0070670_100015870 3300005331 Bacteria 6463
23 Ga0070670_100071358 3300005331 Bacteria 2982
24 Ga0070666_10040645 3300005335 Bacteria 3104
25 Ga0070680_100054693 3300005336 Bacteria 3260
26 Ga0070682_100000214 3300005337 Bacteria 42673
27 Ga0070682_100017615 3300005337 Bacteria 4167
28 Ga0068868_100055979 3300005338 Bacteria 3113
29 Ga0068868_100072536 3300005338 Bacteria 2747
30 Ga0070660_100029496 3300005339 Bacteria 4112
31 Ga0070689_100000131 3300005340 Bacteria 43315
32 Ga0070689_100021796 3300005340 Unclassified 4775
33 Ga0070687_100009929 3300005343 Bacteria 4094
34 Ga0070687_100015186 3300005343 Bacteria 3474
35 Ga0070692_10012868 3300005345 Bacteria 3886
36 Ga0070692_10035185 3300005345 Bacteria 2534
37 Ga0070669_100009255 3300005353 Bacteria 7018
38 Ga0070669_100047789 3300005353 Unclassified 3122
39 Ga0070675_100040851 3300005354 Bacteria 3788
40 Ga0070671_100004845 3300005355 Bacteria 10700
41 Ga0070671_100022671 3300005355 Bacteria 5129
42 Ga0070674_100093845 3300005356 Bacteria 2172
43 Ga0070659_100012022 3300005366 Bacteria 6408
44 Ga0070659_100093844 3300005366 Bacteria 2409
45 Ga0070667_100058512 3300005367 Bacteria 3259
46 Ga0070703_10015070 3300005406 Bacteria 2210
47 Ga0070705_100016034 3300005440 Bacteria 3885
48 Ga0070705_100017485 3300005440 Unclassified 3744
49 Ga0070705_100021192 3300005440 Bacteria 3453
50 Ga0070705_100040653 3300005440 Bacteria 2645
51 Ga0070700_100000155 3300005441 Bacteria 39898
52 Ga0070700_100007701 3300005441 Bacteria 5832
53 Ga0070700_100013081 3300005441 Unclassified 4654
54 Ga0070700_100036928 3300005441 Bacteria 2967
55 Ga0070700_100084518 3300005441 Unclassified 2057
56 Ga0070700_100100038 3300005441 Bacteria 1908
57 Ga0070694_100004711 3300005444 Bacteria 8214
58 Ga0070694_100005003 3300005444 Bacteria 7994
59 Ga0070694_100010574 3300005444 Bacteria 5698
60 Ga0070694_100014974 3300005444 Unclassified 4860
61 Ga0070694_100019623 3300005444 Bacteria 4302
62 Ga0070694_100027441 3300005444 Bacteria 3697
63 Ga0070694_100038223 3300005444 Bacteria 3188
64 Ga0070694_100087625 3300005444 Unclassified 2178
65 Ga0070694_100092233 3300005444 Bacteria 2128
66 Ga0070708_100004376 3300005445 Bacteria 11095
67 Ga0070678_100024713 3300005456 Bacteria 4027
68 Ga0070662_100134141 3300005457 Bacteria 1913
69 Ga0070681_10003289 3300005458 Bacteria 15081
70 Ga0070681_10031696 3300005458 Bacteria 5307
71 Ga0070681_10061154 3300005458 Bacteria 3742
72 Ga0070681_10386929 3300005458 Bacteria 1309
73 Ga0070706_100000068 3300005467 Bacteria 119756
74 Ga0070706_100006544 3300005467 Bacteria 10994
75 Ga0070706_100115761 3300005467 Bacteria 2496
76 Ga0070706_100119325 3300005467 Unclassified 2458
77 Ga0070707_100000142 3300005468 Bacteria 67685
78 Ga0070707_100053552 3300005468 Unclassified 3869
79 Ga0070707_100252123 3300005468 Bacteria 1718
80 Ga0070698_100000509 3300005471 Bacteria 41389
81 Ga0070698_100001973 3300005471 Bacteria 22816
82 Ga0070698_100018819 3300005471 Bacteria 7266
83 Ga0070698_100034767 3300005471 Bacteria 5214
84 Ga0070698_100035132 3300005471 Bacteria 5184
85 Ga0070698_100064525 3300005471 Bacteria 3689
86 Ga0070699_100000284 3300005518 Bacteria 48451
87 Ga0070699_100001511 3300005518 Bacteria 21274
88 Ga0070699_100012177 3300005518 Bacteria 7423
89 Ga0070699_100201577 3300005518 Bacteria 1769
90 Ga0070679_100010043 3300005530 Bacteria 8966
91 Ga0070679_100024160 3300005530 Bacteria 5954
92 Ga0070679_100031890 3300005530 Bacteria 5210
93 Ga0070679_100213829 3300005530 Bacteria 1891
94 Ga0070684_100278851 3300005535 Bacteria 1531
95 Ga0070697_100000292 3300005536 Bacteria 40131
96 Ga0070697_100000395 3300005536 Bacteria 33783
97 Ga0070697_100003145 3300005536 Bacteria 12689
98 Ga0070697_100148440 3300005536 Bacteria 1975
99 Ga0068853_100001570 3300005539 Bacteria 16646
100 Ga0068853_100020327 3300005539 Bacteria 5520
101 Ga0068853_100024416 3300005539 Bacteria 5068
102 Ga0068853_100085464 3300005539 Bacteria 2766
103 Ga0068853_100091203 3300005539 Bacteria 2679
104 Ga0070672_100011380 3300005543 Bacteria 6204
105 Ga0070672_100060373 3300005543 Bacteria 2985
106 Ga0070672_100075499 3300005543 Bacteria 2691
107 Ga0070686_100005172 3300005544 Bacteria 7204
108 Ga0070686_100005605 3300005544 Bacteria 6956
109 Ga0070695_100024056 3300005545 Bacteria 3750
110 Ga0070695_100053869 3300005545 Bacteria 2587
111 Ga0070695_100063664 3300005545 Bacteria 2397
112 Ga0070696_100006921 3300005546 Bacteria 7568
113 Ga0070696_100112312 3300005546 Bacteria 1963
114 Ga0070696_100163778 3300005546 Bacteria 1640
115 Ga0070696_100171559 3300005546 Bacteria 1604
116 Ga0070693_100061138 3300005547 Bacteria 2189
117 Ga0070693_100062124 3300005547 Unclassified 2174
118 Ga0070665_100065196 3300005548 Bacteria 3654
119 Ga0070704_100034379 3300005549 Unclassified 3437
120 Ga0070704_100061417 3300005549 Bacteria 2689
121 Ga0070664_100002337 3300005564 Bacteria 15234
122 Ga0070664_100080747 3300005564 Unclassified 2801
123 Ga0070664_100281706 3300005564 Bacteria 1499
124 Ga0068857_100008533 3300005577 Bacteria 8861
125 Ga0068857_100014427 3300005577 Bacteria 6892
126 Ga0068857_100127721 3300005577 Unclassified 2291
127 Ga0068857_100130236 3300005577 Bacteria 2269
128 Ga0068857_100286964 3300005577 Bacteria 1515
129 Ga0068854_100057788 3300005578 Bacteria 2799
130 Ga0068854_100103735 3300005578 Bacteria 2135
131 Ga0070702_100038380 3300005615 Bacteria 2667
132 Ga0070702_100041647 3300005615 Bacteria 2577
133 Ga0068859_100007805 3300005617 Bacteria 10862
134 Ga0068859_100031689 3300005617 Bacteria 5309
135 Ga0068859_100035099 3300005617 Bacteria 5031
136 Ga0068859_100048616 3300005617 Bacteria 4260
137 Ga0068859_100049075 3300005617 Unclassified 4239
138 Ga0068859_100056257 3300005617 Bacteria 3958
139 Ga0068859_100060250 3300005617 Bacteria 3824
140 Ga0068859_100065696 3300005617 Bacteria 3661
141 Ga0068859_100097032 3300005617 Unclassified 3000
142 Ga0068859_100126866 3300005617 Bacteria 2621
143 Ga0068859_100279363 3300005617 Unclassified 1762
144 Ga0068859_100455257 3300005617 Unclassified 1376
145 Ga0068864_100002539 3300005618 Bacteria 15074
146 Ga0068864_100005067 3300005618 Bacteria 10791
147 Ga0068864_100043112 3300005618 Bacteria 3862
148 Ga0068864_100136701 3300005618 Unclassified 2207
149 Ga0068864_100167824 3300005618 Unclassified 1999
150 Ga0068864_100341132 3300005618 Bacteria 1412
151 Ga0068866_10004036 3300005718 Bacteria 6035
152 Ga0068861_100001753 3300005719 Bacteria 13940
153 Ga0068861_100055985 3300005719 Bacteria 3009
154 Ga0068870_10004856 3300005840 Bacteria 5814
155 Ga0068870_10167826 3300005840 Bacteria 1307
156 Ga0068863_100005561 3300005841 Bacteria 12390
157 Ga0068863_100049614 3300005841 Unclassified 3980
158 Ga0068863_100061985 3300005841 Unclassified 3536
159 Ga0068863_100069357 3300005841 Bacteria 3334
160 Ga0068863_100140175 3300005841 Unclassified 2311
161 Ga0068863_100265742 3300005841 Unclassified 1659
162 Ga0068858_100012701 3300005842 Bacteria 7935
163 Ga0068858_100094658 3300005842 Bacteria 2783
164 Ga0068858_100095058 3300005842 Unclassified 2776
165 Ga0068858_100173412 3300005842 Bacteria 2035
166 Ga0068860_100008793 3300005843 Bacteria 10062
167 Ga0068860_100022264 3300005843 Bacteria 6133
168 Ga0068860_100066506 3300005843 Unclassified 3424
169 Ga0068860_100068294 3300005843 Unclassified 3377
170 Ga0068862_100028052 3300005844 Unclassified 4741
171 Ga0068862_100031337 3300005844 Bacteria 4488
172 Ga0068862_100059022 3300005844 Bacteria 3293
173 Ga0068862_100079214 3300005844 Unclassified 2848
174 Ga0081455_10008698 3300005937 Bacteria 10514
175 Ga0081539_10000476 3300005985 Bacteria 84955
176 Ga0081539_10000519 3300005985 Bacteria 80316
177 Ga0081539_10001446 3300005985 Bacteria 40634
178 Ga0081539_10003679 3300005985 Bacteria 18369
179 Ga0081539_10006027 3300005985 Bacteria 11889
180 Ga0070715_10000035 3300006163 Bacteria 78855
181 Ga0070716_100000011 3300006173 Bacteria 143884
182 Ga0070716_100016793 3300006173 Unclassified 3785
183 Ga0097621_100004848 3300006237 Bacteria 9424
184 Ga0097621_100008314 3300006237 Bacteria 7467
185 Ga0097621_100199690 3300006237 Bacteria 1736
186 Ga0068871_100008375 3300006358 Bacteria 7435
187 Ga0068871_100173088 3300006358 Bacteria 1852
188 Ga0068871_100267606 3300006358 Bacteria 1492
189 Ga0075428_100158241 3300006844 Bacteria 2459
190 Ga0075430_100017813 3300006846 Bacteria 6047
191 Ga0075430_100158560 3300006846 Bacteria 1884
192 Ga0075431_100100360 3300006847 Bacteria 2986
193 Ga0075431_100123586 3300006847 Bacteria 2670
194 Ga0075433_10017809 3300006852 Bacteria 5893
195 Ga0075433_10022584 3300006852 Bacteria 5283
196 Ga0075433_10039432 3300006852 Bacteria 4084
197 Ga0075433_10102923 3300006852 Bacteria 2529
198 Ga0075433_10106527 3300006852 Bacteria 2485
199 Ga0075433_10131352 3300006852 Unclassified 2225
200 Ga0075433_10139981 3300006852 Bacteria 2151
201 Ga0075434_100012037 3300006871 Bacteria 8187
202 Ga0075434_100022320 3300006871 Bacteria 6165
203 Ga0075434_100039748 3300006871 Unclassified 4659
204 Ga0097620_100007805 3300006931 Bacteria 10862
205 Ga0097620_100031691 3300006931 Bacteria 5309
206 Ga0097620_100035102 3300006931 Bacteria 5031
207 Ga0097620_100048619 3300006931 Bacteria 4260
208 Ga0097620_100049071 3300006931 Unclassified 4239
209 Ga0097620_100056251 3300006931 Bacteria 3958
210 Ga0097620_100060249 3300006931 Bacteria 3824
211 Ga0097620_100065692 3300006931 Bacteria 3661
212 Ga0097620_100097033 3300006931 Unclassified 3000
213 Ga0097620_100126864 3300006931 Bacteria 2621
214 Ga0097620_100279361 3300006931 Unclassified 1762
215 Ga0097620_100455279 3300006931 Unclassified 1376
216 Ga0111539_10003591 3300009094 Bacteria 20440
217 Ga0111539_10005710 3300009094 Bacteria 16090
218 Ga0111539_10039166 3300009094 Bacteria 5714
219 Ga0111539_10151277 3300009094 Bacteria 2716
220 Ga0111539_10511403 3300009094 Bacteria 1399
221 Ga0105245_10013019 3300009098 Bacteria 7249
222 Ga0105247_10004270 3300009101 Bacteria 9149
223 Ga0105247_10132178 3300009101 Bacteria 1628
224 Ga0114129_10050438 3300009147 Bacteria 5846
225 Ga0114129_10054527 3300009147 Bacteria 5605
226 Ga0114129_10087498 3300009147 Bacteria 4320
227 Ga0114129_10091471 3300009147 Bacteria 4215
228 Ga0114129_10216593 3300009147 Bacteria 2586
229 Ga0114129_10412953 3300009147 Bacteria 1777
230 Ga0105243_10001740 3300009148 Bacteria 18743
231 Ga0105243_10013375 3300009148 Bacteria 6207
232 Ga0105243_10069171 3300009148 Bacteria 2847
233 Ga0105241_10013106 3300009174 Bacteria 6081
234 Ga0105241_10019995 3300009174 Unclassified 4943
235 Ga0105241_10037528 3300009174 Bacteria 3651
236 Ga0105241_10289991 3300009174 Bacteria 1401
237 Ga0105242_10002535 3300009176 Bacteria 14337
238 Ga0105242_10092005 3300009176 Bacteria 2554
239 Ga0105242_10127300 3300009176 Bacteria 2194
240 Ga0105242_10305102 3300009176 Bacteria 1454
241 Ga0105248_10004098 3300009177 Bacteria 16117
242 Ga0105248_10004353 3300009177 Bacteria 15660
243 Ga0105248_10015647 3300009177 Bacteria 8361
244 Ga0105248_10065796 3300009177 Bacteria 4070
245 Ga0105248_10075127 3300009177 Bacteria 3798
246 Ga0105248_10095391 3300009177 Unclassified 3349
247 Ga0105237_10009706 3300009545 Bacteria 10297
248 Ga0105237_10020874 3300009545 Bacteria 6743
249 Ga0105238_10002454 3300009551 Bacteria 18580
250 Ga0105238_10021363 3300009551 Bacteria 6595
251 Ga0105249_10000216 3300009553 Bacteria 65660
252 Ga0105249_10002421 3300009553 Bacteria 16198
253 Ga0105249_10005542 3300009553 Bacteria 10910
254 Ga0105249_10020012 3300009553 Bacteria 5976
255 Ga0105249_10026050 3300009553 Bacteria 5266
256 Ga0105249_10035253 3300009553 Bacteria 4537
257 Ga0105249_10039197 3300009553 Bacteria 4301
258 Ga0105249_10341421 3300009553 Bacteria 1514
259 Ga0105239_10141845 3300010375 Bacteria 2678
260 Ga0105239_10162293 3300010375 Bacteria 2497
261 Ga0105246_10245896 3300011119 Bacteria 1417
262 Ga0157373_10014676 3300013100 Bacteria 5741
263 Ga0157373_10019490 3300013100 Bacteria 4937
264 Ga0157369_10425159 3300013105 Unclassified 1377
265 Ga0157374_10082008 3300013296 Bacteria 3061
266 Ga0157378_10007641 3300013297 Bacteria 9437
267 Ga0157378_10022849 3300013297 Bacteria 5504
268 Ga0157378_10032270 3300013297 Bacteria 4627
269 Ga0157378_10242298 3300013297 Unclassified 1723
270 Ga0163162_10000045 3300013306 Bacteria 127819
271 Ga0163162_10000611 3300013306 Bacteria 33150
272 Ga0163162_10007395 3300013306 Bacteria 10679
273 Ga0163162_10011454 3300013306 Bacteria 8649
274 Ga0163162_10029245 3300013306 Bacteria 5453
275 Ga0163162_10080550 3300013306 Bacteria 3324
276 Ga0157372_10055915 3300013307 Bacteria 4408
277 Ga0157372_10154489 3300013307 Unclassified 2650
278 Ga0157375_10007920 3300013308 Bacteria 9302
279 Ga0157375_10022619 3300013308 Bacteria 5788
280 Ga0157375_10025107 3300013308 Bacteria 5529
281 Ga0157375_10053414 3300013308 Bacteria 3975
282 Ga0157375_10131849 3300013308 Bacteria 2619
283 Ga0157375_10157384 3300013308 Bacteria 2411
284 Ga0157375_10217911 3300013308 Unclassified 2067
285 Ga0163163_10000671 3300014325 Bacteria 29279
286 Ga0163163_10000674 3300014325 Bacteria 29178
287 Ga0163163_10012626 3300014325 Bacteria 7701
288 Ga0163163_10047180 3300014325 Bacteria 4233
289 Ga0163163_10052169 3300014325 Bacteria 4034
290 Ga0163163_10179898 3300014325 Unclassified 2162
291 Ga0157380_10014035 3300014326 Bacteria 5853
292 Ga0157380_10017161 3300014326 Bacteria 5353
293 Ga0157380_10031518 3300014326 Bacteria 4070
294 Ga0157380_10056888 3300014326 Bacteria 3112
295 Ga0157380_10230594 3300014326 Bacteria 1663
296 Ga0157377_10017272 3300014745 Bacteria 3728
297 Ga0157377_10020203 3300014745 Bacteria 3486
298 Ga0157376_10005490 3300014969 Bacteria 8865
299 Ga0163161_10011381 3300017792 Bacteria 6169
300 Ga0163161_10035778 3300017792 Bacteria 3555
301 Ga0213876_10000159 3300021384 Bacteria 70556
302 Ga0213876_10001798 3300021384 Bacteria 12996
303 Ga0207653_10031272 3300025885 Bacteria 1719
304 Ga0207710_10000653 3300025900 Bacteria 19615
305 Ga0207680_10148576 3300025903 Bacteria 1560
306 Ga0207647_10020298 3300025904 Bacteria 4456
307 Ga0207685_10000019 3300025905 Bacteria 145568
308 Ga0207643_10010172 3300025908 Bacteria 5058
309 Ga0207705_10021183 3300025909 Unclassified 4636
310 Ga0207684_10000297 3300025910 Bacteria 71105
311 Ga0207684_10075729 3300025910 Bacteria 2860
312 Ga0207684_10191509 3300025910 Bacteria 1764
313 Ga0207654_10037327 3300025911 Bacteria 2719
314 Ga0207654_10061449 3300025911 Bacteria 2198
315 Ga0207707_10000080 3300025912 Bacteria 96693
316 Ga0207707_10003592 3300025912 Bacteria 13752
317 Ga0207707_10020795 3300025912 Bacteria 5732
318 Ga0207707_10118891 3300025912 Bacteria 2310
319 Ga0207707_10241207 3300025912 Bacteria 1571
320 Ga0207671_10167152 3300025914 Bacteria 1706
321 Ga0207662_10001559 3300025918 Bacteria 11199
322 Ga0207662_10018032 3300025918 Bacteria 3999
323 Ga0207657_10084826 3300025919 Bacteria 2654
324 Ga0207657_10092752 3300025919 Bacteria 2516
325 Ga0207649_10150138 3300025920 Bacteria 1604
326 Ga0207652_10000234 3300025921 Bacteria 58103
327 Ga0207652_10022179 3300025921 Bacteria 5248
328 Ga0207646_10000047 3300025922 Bacteria 172446
329 Ga0207646_10024325 3300025922 Bacteria 5548
330 Ga0207646_10043739 3300025922 Unclassified 4021
331 Ga0207681_10002996 3300025923 Bacteria 10615
332 Ga0207681_10040862 3300025923 Unclassified 3088
333 Ga0207694_10009725 3300025924 Bacteria 7254
334 Ga0207694_10280967 3300025924 Bacteria 1367
335 Ga0207650_10000041 3300025925 Bacteria 197115
336 Ga0207650_10000801 3300025925 Bacteria 24145
337 Ga0207650_10015049 3300025925 Bacteria 5381
338 Ga0207650_10015951 3300025925 Bacteria 5241
339 Ga0207687_10024873 3300025927 Bacteria 4004
340 Ga0207644_10003490 3300025931 Bacteria 10170
341 Ga0207644_10067001 3300025931 Unclassified 2616
342 Ga0207690_10012915 3300025932 Bacteria 5005
343 Ga0207686_10040565 3300025934 Bacteria 2831
344 Ga0207709_10096324 3300025935 Bacteria 1946
345 Ga0207670_10000422 3300025936 Bacteria 23849
346 Ga0207669_10021439 3300025937 Bacteria 3412
347 Ga0207704_10005212 3300025938 Bacteria 5984
348 Ga0207665_10000057 3300025939 Bacteria 73138
349 Ga0207691_10004209 3300025940 Bacteria 13973
350 Ga0207711_10002724 3300025941 Bacteria 15581
351 Ga0207711_10012430 3300025941 Bacteria 7077
352 Ga0207711_10037138 3300025941 Bacteria 4136
353 Ga0207711_10233131 3300025941 Bacteria 1686
354 Ga0207689_10002280 3300025942 Bacteria 17952
355 Ga0207689_10091964 3300025942 Bacteria 2492
356 Ga0207689_10129807 3300025942 Bacteria 2074
357 Ga0207679_10108227 3300025945 Bacteria 2188
358 Ga0207679_10124344 3300025945 Bacteria 2059
359 Ga0207679_10266936 3300025945 Bacteria 1462
360 Ga0207651_10098973 3300025960 Bacteria 2158
361 Ga0207712_10000418 3300025961 Bacteria 36399
362 Ga0207712_10002017 3300025961 Bacteria 13320
363 Ga0207712_10032018 3300025961 Bacteria 3546
364 Ga0207712_10076952 3300025961 Bacteria 2417
365 Ga0207712_10084078 3300025961 Unclassified 2324
366 Ga0207640_10088299 3300025981 Bacteria 2140
367 Ga0207677_10064872 3300026023 Bacteria 2545
368 Ga0207703_10043487 3300026035 Unclassified 3605
369 Ga0207703_10104690 3300026035 Bacteria 2404
370 Ga0207639_10001798 3300026041 Bacteria 14430
371 Ga0207639_10101240 3300026041 Bacteria 2329
372 Ga0207639_10185721 3300026041 Bacteria 1772
373 Ga0207708_10000188 3300026075 Bacteria 48769
374 Ga0207708_10002196 3300026075 Bacteria 14411
375 Ga0207708_10019198 3300026075 Bacteria 5149
376 Ga0207708_10065134 3300026075 Bacteria 2785
377 Ga0207708_10231725 3300026075 Archaea 1483
378 Ga0207641_10012788 3300026088 Bacteria 6880
379 Ga0207641_10028010 3300026088 Bacteria 4654
380 Ga0207641_10046201 3300026088 Unclassified 3670
381 Ga0207641_10049300 3300026088 Bacteria 3558
382 Ga0207641_10168512 3300026088 Bacteria 1997
383 Ga0207641_10263727 3300026088 Bacteria 1614
384 Ga0207648_10044032 3300026089 Bacteria 3917
385 Ga0207648_10089360 3300026089 Bacteria 2691
386 Ga0207648_10111616 3300026089 Bacteria 2400
387 Ga0207676_10004700 3300026095 Bacteria 9674
388 Ga0207676_10028776 3300026095 Bacteria 4154
389 Ga0207676_10056130 3300026095 Bacteria 3095
390 Ga0207676_10065756 3300026095 Unclassified 2888
391 Ga0207676_10109967 3300026095 Unclassified 2304
392 Ga0207674_10000098 3300026116 Bacteria 98523
393 Ga0207674_10084134 3300026116 Bacteria 3180
394 Ga0207674_10156288 3300026116 Bacteria 2236
395 Ga0207674_10171743 3300026116 Unclassified 2121
396 Ga0207674_10377546 3300026116 Bacteria 1370
397 Ga0207675_100004108 3300026118 Bacteria 14091
398 Ga0207675_100015794 3300026118 Bacteria 7041
399 Ga0207675_100029126 3300026118 Bacteria 5146
400 Ga0207675_100195598 3300026118 Bacteria 1941
401 Ga0207683_10036800 3300026121 Unclassified 4262
402 Ga0207683_10118717 3300026121 Bacteria 2373
403 Ga0207698_10056685 3300026142 Bacteria 3027
404 Ga0207698_10091661 3300026142 Unclassified 2488
405 Ga0207428_10006264 3300027907 Bacteria 10994
406 Ga0207428_10037458 3300027907 Bacteria 3945
407 Ga0207428_10057555 3300027907 Bacteria 3086
408 Ga0268265_10011304 3300028380 Bacteria 6036
409 Ga0268265_10033048 3300028380 Bacteria 3757
410 Ga0268264_10118374 3300028381 Unclassified 2331
411 Ga0268264_10198843 3300028381 Bacteria 1832
412 Ga0268264_10203863 3300028381 Unclassified 1811
413 Ga0268264_10301791 3300028381 Bacteria 1508
414 Ga0307513_10010751 3300031456 Bacteria 11439
415 Ga0307408_100023500 3300031548 Bacteria 4200
416 Ga0307408_100070259 3300031548 Bacteria 2585
417 Ga0307408_100152173 3300031548 Bacteria 1827
418 Ga0307405_10016318 3300031731 Bacteria 4048
419 Ga0307405_10051352 3300031731 Bacteria 2558
420 Ga0307405_10058707 3300031731 Bacteria 2422
421 Ga0307413_10000730 3300031824 Bacteria 11314
422 Ga0307413_10002824 3300031824 Bacteria 7156
423 Ga0307413_10020584 3300031824 Bacteria 3513
424 Ga0307413_10064996 3300031824 Bacteria 2269
425 Ga0307410_10007192 3300031852 Bacteria 6073
426 Ga0307410_10013676 3300031852 Unclassified 4745
427 Ga0307410_10034170 3300031852 Bacteria 3290
428 Ga0307410_10055654 3300031852 Bacteria 2686
429 Ga0307410_10103919 3300031852 Bacteria 2041
430 Ga0307406_10004714 3300031901 Bacteria 7432
431 Ga0307406_10015350 3300031901 Bacteria 4430
432 Ga0307406_10019896 3300031901 Bacteria 3945
433 Ga0307406_10030080 3300031901 Bacteria 3293
434 Ga0307406_10045665 3300031901 Bacteria 2752
435 Ga0307406_10093169 3300031901 Bacteria 2033
436 Ga0307406_10212264 3300031901 Unclassified 1433
437 Ga0307406_10229784 3300031901 Unclassified 1385
438 Ga0307407_10015821 3300031903 Unclassified 3741
439 Ga0307407_10022411 3300031903 Unclassified 3277
440 Ga0307407_10056014 3300031903 Bacteria 2280
441 Ga0307407_10164672 3300031903 Unclassified 1454
442 Ga0307412_10020779 3300031911 Bacteria 4001
443 Ga0307412_10050270 3300031911 Bacteria 2750
444 Ga0307409_100008141 3300031995 Bacteria 6334
445 Ga0307409_100038527 3300031995 Unclassified 3537
446 Ga0307416_100035123 3300032002 Bacteria 3824
447 Ga0307416_100041075 3300032002 Unclassified 3600
448 Ga0307416_100048150 3300032002 Bacteria 3379
449 Ga0307416_100155922 3300032002 Unclassified 2102
450 Ga0307414_10001348 3300032004 Bacteria 12703
451 Ga0307414_10025774 3300032004 Bacteria 3772
452 Ga0307414_10058141 3300032004 Unclassified 2723
453 Ga0307414_10107079 3300032004 Bacteria 2118
454 Ga0307414_10136448 3300032004 Bacteria 1913
455 Ga0307411_10004263 3300032005 Bacteria 6815
456 Ga0307411_10010843 3300032005 Unclassified 4883
457 Ga0307411_10015365 3300032005 Bacteria 4297
458 Ga0307411_10022344 3300032005 Bacteria 3722
459 Ga0307411_10033791 3300032005 Bacteria 3175
460 Ga0307411_10199042 3300032005 Unclassified 1537
461 Ga0307415_100003819 3300032126 Bacteria 7724
462 Ga0307415_100036498 3300032126 Bacteria 3221
463 Ga0307415_100064584 3300032126 Bacteria 2547
464 Ga0307415_100150821 3300032126 Unclassified 1789
465 Ga0307415_100241606 3300032126 Bacteria 1461
466 Ga0373940_0010518 3300035088 Bacteria 2177
467 Ga0373941_0043807 3300035115 Bacteria 1394
468 Ga0373961_0045816 3300035241 Bacteria 1280
469 Ga0395898_0056487 3300037466 Bacteria 3826
470 Ga0395905_0004297 3300037471 Bacteria 14858
471 Ga0395901_0094888 3300038443 Bacteria 3126
472 Ga0395901_0326896 3300038443 Bacteria 1586
473 Ga0436365_0067166 3300039437 Bacteria 157821
474 Ga0436365_0915988 3300039437 Bacteria 51495
475 Ga0439458_0002281 3300042157 Bacteria 4710
476 Ga0495632_0035313 3300046519 Bacteria 2552
477 Ga0495663_0000068 3300046525 Bacteria 47393
478 Ga0495598_0000188 3300046537 Bacteria 10820
479 Ga0495621_0000385 3300046539 Bacteria 10820
480 Ga0495621_0016755 3300046539 Bacteria 2358
481 Ga0495668_0004983 3300046616 Bacteria 9189
482 Ga0495658_0026791 3300046683 Bacteria 3094
483 Ga0496102_0059882 3300048905 Bacteria 3483
484 Ga0496106_0088041 3300048909 Bacteria 2393
485 Ga0496107_0033228 3300048910 Unclassified 3691
486 Ga0496107_0124725 3300048910 Bacteria 1899
487 Ga0496108_0028149 3300048911 Bacteria 4649
488 Ga0496109_0000772 3300048912 Bacteria 26616
489 Ga0496113_0055194 3300048916 Bacteria 2977
490 Ga0501291_001653 3300049514 Bacteria 2599
491 Ga0501296_007258 3300049519 Unclassified 1269
492 Ga0501299_000398 3300049522 Bacteria 5130
493 Ga0501077_0121742 3300049593 Bacteria 1654
494 Ga0501202_001929 3300049652 Bacteria 3415
495 Ga0501202_009358 3300049652 Bacteria 1800
496 Ga0501209_020421 3300049656 Bacteria 1561
497 Ga0501216_006353 3300049660 Unclassified 1810
498 Ga0501224_001761 3300049664 Bacteria 2908
499 Ga0501233_005230 3300049668 Bacteria 2404
500 Ga0501233_006110 3300049668 Unclassified 2253
501 Ga0501235_002062 3300049669 Unclassified 4319
502 Ga0501235_008914 3300049669 Unclassified 2188
503 Ga0501247_001533 3300049677 Bacteria 2257
504 Ga0501249_007851 3300049679 Bacteria 2213
505 Ga0501261_003239 3300049690 Bacteria 2000
506 Ga0501225_0001667 3300049705 Bacteria 6940
507 Ga0501226_001091 3300049853 Bacteria 3508
508 nmdc:mga05p37_122972_c1 3300050507 Bacteria 3188
509 nmdc:mga05p37_206658_c1 3300050507 Bacteria 2375
510 nmdc:mga05p37_24697_c1 3300050507 Bacteria 7305
511 nmdc:mga05p37_497746_c1 3300050507 Unclassified 1400
512 nmdc:mga09592_42085_c1 3300050508 Unclassified 3842
513 nmdc:mga09592_78895_c1 3300050508 Bacteria 2802
514 nmdc:mga0qj67_65133_c1 3300050509 Unclassified 2901
515 nmdc:mga06r32_210802_c1 3300050510 Bacteria 1930
516 nmdc:mga06r32_26746_c1 3300050510 Bacteria 5383
517 nmdc:mga08y16_26839_c1 3300050511 Bacteria 6069
518 nmdc:mga08y16_4459_c1 3300050511 Bacteria 14637
519 nmdc:mga08y16_55364_c1 3300050511 Bacteria 4145
520 nmdc:mga08y16_82418_c1 3300050511 Bacteria 3353
521 nmdc:mga0n895_201048_c1 3300050512 Bacteria 2023
522 nmdc:mga0n895_20899_c1 3300050512 Bacteria 6115
523 nmdc:mga0n895_480238_c1 3300050512 Bacteria 1253
524 nmdc:mga0n895_93121_c1 3300050512 Bacteria 3017
525 nmdc:mga0rr50_9724_c1 3300050513 Bacteria 6065
526 nmdc:mga0a205_10058_c1 3300050515 Bacteria 8679
527 nmdc:mga0a205_127722_c1 3300050515 Unclassified 2442
528 nmdc:mga0a205_146580_c1 3300050515 Bacteria 2261
529 nmdc:mga0a205_28354_c1 3300050515 Bacteria 5353
530 nmdc:mga0a205_56343_c1 3300050515 Bacteria 3795
531 nmdc:mga0a205_60024_c1 3300050515 Bacteria 3673
532 nmdc:mga0a205_93633_c1 3300050515 Bacteria 2902
533 Ga0500616_0000478 3300053153 Bacteria 51881
534 Ga0501084_0242814 3300054114 Bacteria 1520
535 Ga0070695_100088585
536 JGI24751J29686_10000157
537 JGI25406J46586_10017102
538 Ga0065714_10064469
539 Ga0065704_10139663
540 Ga0065712_10000127
541 Ga0065712_10004385
542 Ga0065712_10127414
543 Ga0065715_10007115
544 Ga0065715_10009135
545 Ga0065715_10010924
546 Ga0065715_10089776
547 Ga0065715_10090317
548 Ga0065707_10001352
549 Ga0065707_10123193
550 Ga0070676_10055178
551 Ga0070690_100001545
552 Ga0070690_100019946
553 Ga0070690_100036269
554 Ga0070670_100000866
555 Ga0070670_100001218
556 Ga0070670_100015870
557 Ga0070670_100071358
558 Ga0070666_10040645
559 Ga0070680_100054693
560 Ga0070682_100000214
561 Ga0070682_100017615
562 Ga0068868_100055979
563 Ga0068868_100072536
564 Ga0070660_100029496
565 Ga0070689_100000131
566 Ga0070689_100021796
567 Ga0070687_100009929
568 Ga0070687_100015186
569 Ga0070692_10012868
570 Ga0070692_10035185
571 Ga0070669_100009255
572 Ga0070669_100047789
573 Ga0070675_100040851
574 Ga0070671_100004845
575 Ga0070671_100022671
576 Ga0070674_100093845
577 Ga0070659_100012022
578 Ga0070659_100093844
579 Ga0070667_100058512
580 Ga0070703_10015070
581 Ga0070705_100016034
582 Ga0070705_100017485
583 Ga0070705_100021192
584 Ga0070705_100040653
585 Ga0070700_100000155
586 Ga0070700_100007701
587 Ga0070700_100013081
588 Ga0070700_100036928
589 Ga0070700_100084518
590 Ga0070700_100100038
591 Ga0070694_100004711
592 Ga0070694_100005003
593 Ga0070694_100010574
594 Ga0070694_100014974
595 Ga0070694_100019623
596 Ga0070694_100027441
597 Ga0070694_100038223
598 Ga0070694_100087625
599 Ga0070694_100092233
600 Ga0070708_100004376
601 Ga0070678_100024713
602 Ga0070662_100134141
603 Ga0070681_10003289
604 Ga0070681_10031696
605 Ga0070681_10061154
606 Ga0070681_10386929
607 Ga0070706_100000068
608 Ga0070706_100006544
609 Ga0070706_100115761
610 Ga0070706_100119325
611 Ga0070707_100000142
612 Ga0070707_100053552
613 Ga0070707_100252123
614 Ga0070698_100000509
615 Ga0070698_100001973
616 Ga0070698_100018819
617 Ga0070698_100034767
618 Ga0070698_100035132
619 Ga0070698_100064525
620 Ga0070699_100000284
621 Ga0070699_100001511
622 Ga0070699_100012177
623 Ga0070699_100201577
624 Ga0070679_100010043
625 Ga0070679_100024160
626 Ga0070679_100031890
627 Ga0070679_100213829
628 Ga0070684_100278851
629 Ga0070697_100000292
630 Ga0070697_100000395
631 Ga0070697_100003145
632 Ga0070697_100148440
633 Ga0068853_100001570
634 Ga0068853_100020327
635 Ga0068853_100024416
636 Ga0068853_100085464
637 Ga0068853_100091203
638 Ga0070672_100011380
639 Ga0070672_100060373
640 Ga0070672_100075499
641 Ga0070686_100005172
642 Ga0070686_100005605
643 Ga0070695_100024056
644 Ga0070695_100053869
645 Ga0070695_100063664
646 Ga0070696_100006921
647 Ga0070696_100112312
648 Ga0070696_100163778
649 Ga0070696_100171559
650 Ga0070693_100061138
651 Ga0070693_100062124
652 Ga0070665_100065196
653 Ga0070704_100034379
654 Ga0070704_100061417
655 Ga0070664_100002337
656 Ga0070664_100080747
657 Ga0070664_100281706
658 Ga0068857_100008533
659 Ga0068857_100014427
660 Ga0068857_100127721
661 Ga0068857_100130236
662 Ga0068857_100286964
663 Ga0068854_100057788
664 Ga0068854_100103735
665 Ga0070702_100038380
666 Ga0070702_100041647
667 Ga0068859_100007805
668 Ga0068859_100031689
669 Ga0068859_100035099
670 Ga0068859_100048616
671 Ga0068859_100049075
672 Ga0068859_100056257
673 Ga0068859_100060250
674 Ga0068859_100065696
675 Ga0068859_100097032
676 Ga0068859_100126866
677 Ga0068859_100279363
678 Ga0068859_100455257
679 Ga0068864_100002539
680 Ga0068864_100005067
681 Ga0068864_100043112
682 Ga0068864_100136701
683 Ga0068864_100167824
684 Ga0068864_100341132
685 Ga0068866_10004036
686 Ga0068861_100001753
687 Ga0068861_100055985
688 Ga0068870_10004856
689 Ga0068870_10167826
690 Ga0068863_100005561
691 Ga0068863_100049614
692 Ga0068863_100061985
693 Ga0068863_100069357
694 Ga0068863_100140175
695 Ga0068863_100265742
696 Ga0068858_100012701
697 Ga0068858_100094658
698 Ga0068858_100095058
699 Ga0068858_100173412
700 Ga0068860_100008793
701 Ga0068860_100022264
702 Ga0068860_100066506
703 Ga0068860_100068294
704 Ga0068862_100028052
705 Ga0068862_100031337
706 Ga0068862_100059022
707 Ga0068862_100079214
708 Ga0081455_10008698
709 Ga0081539_10000476
710 Ga0081539_10000519
711 Ga0081539_10001446
712 Ga0081539_10003679
713 Ga0081539_10006027
714 Ga0070715_10000035
715 Ga0070716_100000011
716 Ga0070716_100016793
717 Ga0097621_100004848
718 Ga0097621_100008314
719 Ga0097621_100199690
720 Ga0068871_100008375
721 Ga0068871_100173088
722 Ga0068871_100267606
723 Ga0075428_100158241
724 Ga0075430_100017813
725 Ga0075430_100158560
726 Ga0075431_100100360
727 Ga0075431_100123586
728 Ga0075433_10017809
729 Ga0075433_10022584
730 Ga0075433_10039432
731 Ga0075433_10102923
732 Ga0075433_10106527
733 Ga0075433_10131352
734 Ga0075433_10139981
735 Ga0075434_100012037
736 Ga0075434_100022320
737 Ga0075434_100039748
738 Ga0097620_100007805
739 Ga0097620_100031691
740 Ga0097620_100035102
741 Ga0097620_100048619
742 Ga0097620_100049071
743 Ga0097620_100056251
744 Ga0097620_100060249
745 Ga0097620_100065692
746 Ga0097620_100097033
747 Ga0097620_100126864
748 Ga0097620_100279361
749 Ga0097620_100455279
750 Ga0111539_10003591
751 Ga0111539_10005710
752 Ga0111539_10039166
753 Ga0111539_10151277
754 Ga0111539_10511403
755 Ga0105245_10013019
756 Ga0105247_10004270
757 Ga0105247_10132178
758 Ga0114129_10050438
759 Ga0114129_10054527
760 Ga0114129_10087498
761 Ga0114129_10091471
762 Ga0114129_10216593
763 Ga0114129_10412953
764 Ga0105243_10001740
765 Ga0105243_10013375
766 Ga0105243_10069171
767 Ga0105241_10013106
768 Ga0105241_10019995
769 Ga0105241_10037528
770 Ga0105241_10289991
771 Ga0105242_10002535
772 Ga0105242_10092005
773 Ga0105242_10127300
774 Ga0105242_10305102
775 Ga0105248_10004098
776 Ga0105248_10004353
777 Ga0105248_10015647
778 Ga0105248_10065796
779 Ga0105248_10075127
780 Ga0105248_10095391
781 Ga0105237_10009706
782 Ga0105237_10020874
783 Ga0105238_10002454
784 Ga0105238_10021363
785 Ga0105249_10000216
786 Ga0105249_10002421
787 Ga0105249_10005542
788 Ga0105249_10020012
789 Ga0105249_10026050
790 Ga0105249_10035253
791 Ga0105249_10039197
792 Ga0105249_10341421
793 Ga0105239_10141845
794 Ga0105239_10162293
795 Ga0105246_10245896
796 Ga0157373_10014676
797 Ga0157373_10019490
798 Ga0157369_10425159
799 Ga0157374_10082008
800 Ga0157378_10007641
801 Ga0157378_10022849
802 Ga0157378_10032270
803 Ga0157378_10242298
804 Ga0163162_10000045
805 Ga0163162_10000611
806 Ga0163162_10007395
807 Ga0163162_10011454
808 Ga0163162_10029245
809 Ga0163162_10080550
810 Ga0157372_10055915
811 Ga0157372_10154489
812 Ga0157375_10007920
813 Ga0157375_10022619
814 Ga0157375_10025107
815 Ga0157375_10053414
816 Ga0157375_10131849
817 Ga0157375_10157384
818 Ga0157375_10217911
819 Ga0163163_10000671
820 Ga0163163_10000674
821 Ga0163163_10012626
822 Ga0163163_10047180
823 Ga0163163_10052169
824 Ga0163163_10179898
825 Ga0157380_10014035
826 Ga0157380_10017161
827 Ga0157380_10031518
828 Ga0157380_10056888
829 Ga0157380_10230594
830 Ga0157377_10017272
831 Ga0157377_10020203
832 Ga0157376_10005490
833 Ga0163161_10011381
834 Ga0163161_10035778
835 Ga0213876_10000159
836 Ga0213876_10001798
837 Ga0207653_10031272
838 Ga0207710_10000653
839 Ga0207680_10148576
840 Ga0207647_10020298
841 Ga0207685_10000019
842 Ga0207643_10010172
843 Ga0207705_10021183
844 Ga0207684_10000297
845 Ga0207684_10075729
846 Ga0207684_10191509
847 Ga0207654_10037327
848 Ga0207654_10061449
849 Ga0207707_10000080
850 Ga0207707_10003592
851 Ga0207707_10020795
852 Ga0207707_10118891
853 Ga0207707_10241207
854 Ga0207671_10167152
855 Ga0207662_10001559
856 Ga0207662_10018032
857 Ga0207657_10084826
858 Ga0207657_10092752
859 Ga0207649_10150138
860 Ga0207652_10000234
861 Ga0207652_10022179
862 Ga0207646_10000047
863 Ga0207646_10024325
864 Ga0207646_10043739
865 Ga0207681_10002996
866 Ga0207681_10040862
867 Ga0207694_10009725
868 Ga0207694_10280967
869 Ga0207650_10000041
870 Ga0207650_10000801
871 Ga0207650_10015049
872 Ga0207650_10015951
873 Ga0207687_10024873
874 Ga0207644_10003490
875 Ga0207644_10067001
876 Ga0207690_10012915
877 Ga0207686_10040565
878 Ga0207709_10096324
879 Ga0207670_10000422
880 Ga0207669_10021439
881 Ga0207704_10005212
882 Ga0207665_10000057
883 Ga0207691_10004209
884 Ga0207711_10002724
885 Ga0207711_10012430
886 Ga0207711_10037138
887 Ga0207711_10233131
888 Ga0207689_10002280
889 Ga0207689_10091964
890 Ga0207689_10129807
891 Ga0207679_10108227
892 Ga0207679_10124344
893 Ga0207679_10266936
894 Ga0207651_10098973
895 Ga0207712_10000418
896 Ga0207712_10002017
897 Ga0207712_10032018
898 Ga0207712_10076952
899 Ga0207712_10084078
900 Ga0207640_10088299
901 Ga0207677_10064872
902 Ga0207703_10043487
903 Ga0207703_10104690
904 Ga0207639_10001798
905 Ga0207639_10101240
906 Ga0207639_10185721
907 Ga0207708_10000188
908 Ga0207708_10002196
909 Ga0207708_10019198
910 Ga0207708_10065134
911 Ga0207708_10231725
912 Ga0207641_10012788
913 Ga0207641_10028010
914 Ga0207641_10046201
915 Ga0207641_10049300
916 Ga0207641_10168512
917 Ga0207641_10263727
918 Ga0207648_10044032
919 Ga0207648_10089360
920 Ga0207648_10111616
921 Ga0207676_10004700
922 Ga0207676_10028776
923 Ga0207676_10056130
924 Ga0207676_10065756
925 Ga0207676_10109967
926 Ga0207674_10000098
927 Ga0207674_10084134
928 Ga0207674_10156288
929 Ga0207674_10171743
930 Ga0207674_10377546
931 Ga0207675_100004108
932 Ga0207675_100015794
933 Ga0207675_100029126
934 Ga0207675_100195598
935 Ga0207683_10036800
936 Ga0207683_10118717
937 Ga0207698_10056685
938 Ga0207698_10091661
939 Ga0207428_10006264
940 Ga0207428_10037458
941 Ga0207428_10057555
942 Ga0268265_10011304
943 Ga0268265_10033048
944 Ga0268264_10118374
945 Ga0268264_10198843
946 Ga0268264_10203863
947 Ga0268264_10301791
948 Ga0307513_10010751
949 Ga0307408_100023500
950 Ga0307408_100070259
951 Ga0307408_100152173
952 Ga0307405_10016318
953 Ga0307405_10051352
954 Ga0307405_10058707
955 Ga0307413_10000730
956 Ga0307413_10002824
957 Ga0307413_10020584
958 Ga0307413_10064996
959 Ga0307410_10007192
960 Ga0307410_10013676
961 Ga0307410_10034170
962 Ga0307410_10055654
963 Ga0307410_10103919
964 Ga0307406_10004714
965 Ga0307406_10015350
966 Ga0307406_10019896
967 Ga0307406_10030080
968 Ga0307406_10045665
969 Ga0307406_10093169
970 Ga0307406_10212264
971 Ga0307406_10229784
972 Ga0307407_10015821
973 Ga0307407_10022411
974 Ga0307407_10056014
975 Ga0307407_10164672
976 Ga0307412_10020779
977 Ga0307412_10050270
978 Ga0307409_100008141
979 Ga0307409_100038527
980 Ga0307416_100035123
981 Ga0307416_100041075
982 Ga0307416_100048150
983 Ga0307416_100155922
984 Ga0307414_10001348
985 Ga0307414_10025774
986 Ga0307414_10058141
987 Ga0307414_10107079
988 Ga0307414_10136448
989 Ga0307411_10004263
990 Ga0307411_10010843
991 Ga0307411_10015365
992 Ga0307411_10022344
993 Ga0307411_10033791
994 Ga0307411_10199042
995 Ga0307415_100003819
996 Ga0307415_100036498
997 Ga0307415_100064584
998 Ga0307415_100150821
999 Ga0307415_100241606
1000 Ga0373940_0010518
1001 Ga0373941_0043807
1002 Ga0373961_0045816
1003 Ga0395898_0056487
1004 Ga0395905_0004297
1005 Ga0395901_0094888
1006 Ga0395901_0326896
1007 Ga0436365_0067166
1008 Ga0436365_0915988
1009 Ga0439458_0002281
1010 Ga0495632_0035313
1011 Ga0495663_0000068
1012 Ga0495598_0000188
1013 Ga0495621_0000385
1014 Ga0495621_0016755
1015 Ga0495668_0004983
1016 Ga0495658_0026791
1017 Ga0496102_0059882
1018 Ga0496106_0088041
1019 Ga0496107_0033228
1020 Ga0496107_0124725
1021 Ga0496108_0028149
1022 Ga0496109_0000772
1023 Ga0496113_0055194
1024 Ga0501291_001653
1025 Ga0501296_007258
1026 Ga0501299_000398
1027 Ga0501077_0121742
1028 Ga0501202_001929
1029 Ga0501202_009358
1030 Ga0501209_020421
1031 Ga0501216_006353
1032 Ga0501224_001761
1033 Ga0501233_005230
1034 Ga0501233_006110
1035 Ga0501235_002062
1036 Ga0501235_008914
1037 Ga0501247_001533
1038 Ga0501249_007851
1039 Ga0501261_003239
1040 Ga0501225_0001667
1041 Ga0501226_001091
1042 nmdc:mga05p37_122972_c1
1043 nmdc:mga05p37_206658_c1
1044 nmdc:mga05p37_24697_c1
1045 nmdc:mga05p37_497746_c1
1046 nmdc:mga09592_42085_c1
1047 nmdc:mga09592_78895_c1
1048 nmdc:mga0qj67_65133_c1
1049 nmdc:mga06r32_210802_c1
1050 nmdc:mga06r32_26746_c1
1051 nmdc:mga08y16_26839_c1
1052 nmdc:mga08y16_4459_c1
1053 nmdc:mga08y16_55364_c1
1054 nmdc:mga08y16_82418_c1
1055 nmdc:mga0n895_201048_c1
1056 nmdc:mga0n895_20899_c1
1057 nmdc:mga0n895_480238_c1
1058 nmdc:mga0n895_93121_c1
1059 nmdc:mga0rr50_9724_c1
1060 nmdc:mga0a205_10058_c1
1061 nmdc:mga0a205_127722_c1
1062 nmdc:mga0a205_146580_c1
1063 nmdc:mga0a205_28354_c1
1064 nmdc:mga0a205_56343_c1
1065 nmdc:mga0a205_60024_c1
1066 nmdc:mga0a205_93633_c1
1067 Ga0500616_0000478
1068 Ga0501084_0242814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06925

MGDG_synth

Monogalactosyldiacylglycerol (MGDG) synthase

70

228

0.88

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

267

390

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.8697 77 363
4x1t-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp 0.8201 74 363
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.7975 75 362
1nlm-assembly1.cif.gz_B crystal structure of murg:glcnac complex 0.7607 75 365
7d1i-assembly1.cif.gz_A-2 crystal structure of acinetobacter baumannii murg 0.7527 76 361
ID Description Score Start End Superfamily
af_B4FBN5_333_500_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9056 185 347 3.40.50.2000
af_Q2FZP7_194_351_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8854 187 343 3.40.50.2000
af_B4FBN5_333_500_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8748 185 347 3.40.50.2000
af_Q2FZP7_194_351_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8646 187 343 3.40.50.2000
af_A0A1D6KIM9_167_280_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7909 70 169 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7Y2DUW2-F1-model_v4 Glycosyltransferase 0.9424 174 377 GO:0016757
AF-A0A2V8Q6K0-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9402 227 375 GO:0016758
AF-A0A7Y2DUW2-F1-model_v4 Glycosyltransferase 0.9245 174 377 GO:0016757
AF-A0A497AQV9-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.923 163 363 GO:0016758
AF-A0A2V7G6F5-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9229 184 361 GO:0016758

Map