F460477

General Info

Members Datasets Scaffolds Average Seq Length
533 291 516 79

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_945481_c1|nmdc:mga08y16_945481_c1_504_779
Length 91
Sequence MAIRLHLDRVLLERRMTLTELAERVGITIANLSILKTNKAKAIRFSTLDALCRVLDCQPKDLLERVEGEDAPIDDEDEDASGKALVASRGG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
4 2643221583 Caulobacter sp. Root655 Isolate Unclassified
5 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
6 2643221640 Caulobacter sp. Root342 Isolate Unclassified
7 2643221642 Caulobacter sp. Root343 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
10 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
11 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
12 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
13 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
14 2851153111 Caulobacter radicis 736 Isolate Unclassified
15 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
16 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
259 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
287 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
290 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
291 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 0.19
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.64
Nodule 0
Rhizoplane 3
Rhizosphere 68.48
Stem 0
Stem Tuber 0
Unclassified 7.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1024890 3300002741 Bacteria 700
2 JGI25153J46596_10064298 3300003215 Bacteria 980
3 JGI25153J46596_10096101 3300003215 Bacteria 705
4 rootH1_10013055 3300003316 Bacteria 4588
5 Ga0055526_1033927 3300003771 Bacteria 1405
6 Ga0055526_1071185 3300003771 Bacteria 704
7 Ga0055537_1001045 3300003773 Bacteria 12416
8 Ga0055524_1008150 3300003775 Bacteria 4378
9 Ga0055536_1000251 3300003781 Bacteria 42530
10 Ga0055536_1000815 3300003781 Bacteria 20611
11 Ga0055536_1000953 3300003781 Bacteria 18523
12 Ga0055528_1036338 3300003790 Bacteria 1178
13 Ga0055530_10001790 3300003791 Bacteria 14930
14 Ga0055540_1084968 3300003792 Bacteria 603
15 Ga0055531_10000541 3300003794 Bacteria 33459
16 Ga0055531_10001885 3300003794 Bacteria 14679
17 Ga0055531_10006083 3300003794 Bacteria 6910
18 Ga0055531_10035697 3300003794 Bacteria 1550
19 Ga0055531_10100001 3300003794 Bacteria 597
20 Ga0065165_1001044 3300005262 Bacteria 33434
21 Ga0065165_1001092 3300005262 Bacteria 32262
22 Ga0065165_1007051 3300005262 Bacteria 5654
23 Ga0070658_10053138 3300005327 Bacteria 3287
24 Ga0070658_10378644 3300005327 Bacteria 1214
25 Ga0070658_10733975 3300005327 Bacteria 858
26 Ga0070658_10793886 3300005327 Bacteria 822
27 Ga0070658_10799549 3300005327 Bacteria 819
28 Ga0070658_11692136 3300005327 Bacteria 548
29 Ga0070683_101623281 3300005329 Bacteria 622
30 Ga0070670_102154267 3300005331 Bacteria 514
31 Ga0068869_100056322 3300005334 Bacteria 2867
32 Ga0068869_101177912 3300005334 Bacteria 673
33 Ga0070680_100038033 3300005336 Bacteria 3890
34 Ga0068868_101306108 3300005338 Bacteria 674
35 Ga0070660_100072343 3300005339 Bacteria 2694
36 Ga0070660_100233029 3300005339 Bacteria 1498
37 Ga0070660_100283553 3300005339 Bacteria 1356
38 Ga0070689_100432816 3300005340 Bacteria 1117
39 Ga0070691_10006066 3300005341 Bacteria 5516
40 Ga0070661_100864505 3300005344 Bacteria 745
41 Ga0070661_101357772 3300005344 Bacteria 597
42 Ga0070669_101619193 3300005353 Bacteria 564
43 Ga0070671_100054034 3300005355 Bacteria 3338
44 Ga0070659_100000194 3300005366 Bacteria 46646
45 Ga0070659_100032719 3300005366 Bacteria 4035
46 Ga0070713_101275693 3300005436 Bacteria 712
47 Ga0070663_101215042 3300005455 Bacteria 663
48 Ga0070663_101741556 3300005455 Bacteria 558
49 Ga0070678_101424909 3300005456 Bacteria 647
50 Ga0070681_10059209 3300005458 Bacteria 3809
51 Ga0070681_10059441 3300005458 Bacteria 3802
52 Ga0068867_100520199 3300005459 Bacteria 1026
53 Ga0070685_10941751 3300005466 Bacteria 645
54 Ga0070706_101432950 3300005467 Bacteria 632
55 Ga0070679_100096921 3300005530 Bacteria 2937
56 Ga0070679_100211985 3300005530 Bacteria 1900
57 Ga0070684_101225650 3300005535 Bacteria 706
58 Ga0070684_101339394 3300005535 Bacteria 674
59 Ga0068853_100032141 3300005539 Bacteria 4444
60 Ga0068853_100048356 3300005539 Bacteria 3653
61 Ga0068853_100056100 3300005539 Bacteria 3396
62 Ga0068853_100062463 3300005539 Bacteria 3224
63 Ga0068853_100506930 3300005539 Bacteria 1140
64 Ga0068853_101171813 3300005539 Bacteria 742
65 Ga0068853_101269176 3300005539 Bacteria 712
66 Ga0070665_100002063 3300005548 Bacteria 22556
67 Ga0070665_100907510 3300005548 Bacteria 894
68 Ga0068855_100042938 3300005563 Bacteria 5357
69 Ga0068855_100060640 3300005563 Bacteria 4423
70 Ga0068855_100145212 3300005563 Bacteria 2701
71 Ga0068855_100146004 3300005563 Bacteria 2693
72 Ga0068855_100687767 3300005563 Bacteria 1096
73 Ga0070664_100219279 3300005564 Bacteria 1702
74 Ga0070664_100761822 3300005564 Bacteria 904
75 Ga0068857_100550636 3300005577 Bacteria 1087
76 Ga0068857_101666256 3300005577 Bacteria 623
77 Ga0068854_100829462 3300005578 Bacteria 808
78 Ga0068856_100269610 3300005614 Bacteria 1718
79 Ga0068856_102303605 3300005614 Bacteria 547
80 Ga0068852_100642958 3300005616 Bacteria 1068
81 Ga0068864_102473513 3300005618 Bacteria 525
82 Ga0068861_101180464 3300005719 Bacteria 739
83 Ga0068858_100834011 3300005842 Bacteria 900
84 Ga0068860_100590148 3300005843 Bacteria 1116
85 Ga0068862_100116994 3300005844 Bacteria 2346
86 Ga0075365_11013137 3300006038 Bacteria 585
87 Ga0075363_100305763 3300006048 Bacteria 923
88 Ga0075363_100347410 3300006048 Bacteria 866
89 Ga0075364_10004307 3300006051 Bacteria 8167
90 Ga0075362_10094624 3300006177 Bacteria 1390
91 Ga0075367_10009900 3300006178 Bacteria 4993
92 Ga0075367_10916221 3300006178 Bacteria 559
93 Ga0075369_10001212 3300006186 Bacteria 8746
94 Ga0075366_10020867 3300006195 Bacteria 3805
95 Ga0075366_10033211 3300006195 Bacteria 3039
96 Ga0075366_10045389 3300006195 Bacteria 2604
97 Ga0097621_102352995 3300006237 Bacteria 510
98 Ga0075370_10080534 3300006353 Bacteria 1871
99 Ga0075370_10333441 3300006353 Bacteria 905
100 Ga0075370_10979776 3300006353 Bacteria 518
101 Ga0075428_100573098 3300006844 Unclassified 1206
102 Ga0075433_11391549 3300006852 Bacteria 607
103 Ga0097620_100199603 3300006931 Bacteria 2085
104 Ga0105240_10000428 3300009093 Bacteria 77995
105 Ga0105240_10145877 3300009093 Bacteria 2824
106 Ga0105240_10368547 3300009093 Bacteria 1625
107 Ga0105240_10572717 3300009093 Bacteria 1247
108 Ga0105240_11279787 3300009093 Bacteria 774
109 Ga0105240_12688895 3300009093 Bacteria 513
110 Ga0105240_12748459 3300009093 Bacteria 507
111 Ga0105245_11019500 3300009098 Bacteria 872
112 Ga0114129_13346022 3300009147 Bacteria 517
113 Ga0105243_11250635 3300009148 Bacteria 758
114 Ga0105243_12421989 3300009148 Bacteria 563
115 Ga0105241_10846526 3300009174 Bacteria 846
116 Ga0105241_11187202 3300009174 Bacteria 722
117 Ga0105242_10829404 3300009176 Bacteria 918
118 Ga0105248_10069725 3300009177 Bacteria 3948
119 Ga0105238_10026580 3300009551 Bacteria 5901
120 Ga0105238_10340545 3300009551 Bacteria 1488
121 Ga0105238_10558448 3300009551 Bacteria 1150
122 Ga0105238_10722664 3300009551 Bacteria 1009
123 Ga0105238_10970347 3300009551 Bacteria 870
124 Ga0105238_11753142 3300009551 Bacteria 652
125 Ga0105238_11809870 3300009551 Bacteria 643
126 Ga0105238_12335893 3300009551 Bacteria 570
127 Ga0105249_10283738 3300009553 Bacteria 1655
128 Ga0105249_10373222 3300009553 Bacteria 1451
129 Ga0105249_10414507 3300009553 Bacteria 1380
130 Ga0105249_10680527 3300009553 Bacteria 1088
131 Ga0105239_10254380 3300010375 Bacteria 1973
132 Ga0105239_12952528 3300010375 Bacteria 554
133 Ga0105239_12970933 3300010375 Bacteria 553
134 Ga0105246_11775007 3300011119 Bacteria 589
135 Ga0157327_1067875 3300012512 Bacteria 547
136 Ga0157373_10000756 3300013100 Bacteria 25102
137 Ga0157373_10000769 3300013100 Bacteria 24730
138 Ga0157370_10022429 3300013104 Bacteria 6281
139 Ga0157370_10288805 3300013104 Bacteria 1515
140 Ga0157370_10302797 3300013104 Bacteria 1475
141 Ga0157369_10030310 3300013105 Bacteria 5966
142 Ga0157369_11270304 3300013105 Bacteria 751
143 Ga0157378_12447330 3300013297 Bacteria 574
144 Ga0163162_10380349 3300013306 Bacteria 1545
145 Ga0163162_10532111 3300013306 Bacteria 1304
146 Ga0163162_11535507 3300013306 Bacteria 759
147 Ga0157372_10764189 3300013307 Bacteria 1123
148 Ga0157372_11813750 3300013307 Bacteria 701
149 Ga0157375_12088204 3300013308 Bacteria 674
150 Ga0157375_13509827 3300013308 Bacteria 522
151 Ga0163163_10039963 3300014325 Bacteria 4580
152 Ga0163163_10310256 3300014325 Bacteria 1630
153 Ga0163163_11706918 3300014325 Bacteria 690
154 Ga0163163_13308693 3300014325 Bacteria 502
155 Ga0182008_10037576 3300014497 Bacteria 2423
156 Ga0182008_10382859 3300014497 Bacteria 752
157 Ga0157376_11354677 3300014969 Bacteria 742
158 Ga0157376_11686266 3300014969 Bacteria 669
159 Ga0163161_11371235 3300017792 Bacteria 617
160 Ga0163161_11819394 3300017792 Bacteria 542
161 Ga0213872_10005118 3300021361 Bacteria 6804
162 Ga0213872_10008379 3300021361 Bacteria 5007
163 Ga0213872_10130761 3300021361 Bacteria 1106
164 Ga0213876_10214927 3300021384 Bacteria 1022
165 Ga0209026_1001360 3300025250 Bacteria 10913
166 Ga0209026_1030874 3300025250 Bacteria 795
167 Ga0209148_1031715 3300025254 Bacteria 783
168 Ga0209565_1000798 3300025263 Bacteria 18129
169 Ga0209455_1028122 3300025272 Bacteria 987
170 Ga0209673_1005598 3300025273 Bacteria 6277
171 Ga0209673_1052705 3300025273 Bacteria 1066
172 Ga0209675_1015100 3300025291 Bacteria 2312
173 Ga0209675_1076884 3300025291 Bacteria 625
174 Ga0209676_1000038 3300025292 Bacteria 449305
175 Ga0209676_1000169 3300025292 Bacteria 155600
176 Ga0209676_1000319 3300025292 Bacteria 93542
177 Ga0209676_1095142 3300025292 Bacteria 646
178 Ga0209564_1007084 3300025295 Bacteria 5866
179 Ga0209564_1018803 3300025295 Bacteria 2613
180 Ga0209564_1033664 3300025295 Bacteria 1518
181 Ga0209758_1000852 3300025297 Bacteria 42442
182 Ga0209758_1005712 3300025297 Bacteria 9388
183 Ga0209758_1011442 3300025297 Bacteria 5139
184 Ga0209050_1000053 3300025298 Bacteria 349521
185 Ga0209050_1000281 3300025298 Bacteria 108751
186 Ga0209050_1000722 3300025298 Bacteria 48344
187 Ga0209050_1031075 3300025298 Bacteria 1672
188 Ga0209256_1003409 3300025299 Bacteria 11199
189 Ga0209256_1006386 3300025299 Bacteria 6273
190 Ga0209256_1014428 3300025299 Bacteria 2843
191 Ga0209051_1001156 3300025303 Bacteria 23987
192 Ga0209257_1000036 3300025304 Bacteria 616006
193 Ga0209257_1000289 3300025304 Bacteria 110882
194 Ga0209257_1000433 3300025304 Bacteria 80612
195 Ga0209257_1000845 3300025304 Bacteria 43868
196 Ga0209257_1003375 3300025304 Bacteria 13790
197 Ga0207705_10003058 3300025909 Bacteria 12757
198 Ga0207705_10116372 3300025909 Bacteria 1979
199 Ga0207705_10319527 3300025909 Bacteria 1193
200 Ga0207705_10697700 3300025909 Unclassified 789
201 Ga0207705_10882586 3300025909 Bacteria 693
202 Ga0207684_10276041 3300025910 Bacteria 1450
203 Ga0207707_10103685 3300025912 Bacteria 2486
204 Ga0207707_10158906 3300025912 Bacteria 1976
205 Ga0207695_10001559 3300025913 Bacteria 37604
206 Ga0207695_10006445 3300025913 Bacteria 15243
207 Ga0207695_10116653 3300025913 Bacteria 2643
208 Ga0207695_10216015 3300025913 Bacteria 1826
209 Ga0207695_10398000 3300025913 Bacteria 1262
210 Ga0207695_10597703 3300025913 Bacteria 984
211 Ga0207695_10719232 3300025913 Bacteria 879
212 Ga0207660_10006424 3300025917 Bacteria 7620
213 Ga0207660_10579556 3300025917 Bacteria 913
214 Ga0207657_10023711 3300025919 Bacteria 5707
215 Ga0207657_10034910 3300025919 Bacteria 4514
216 Ga0207657_10164152 3300025919 Bacteria 1802
217 Ga0207649_10314858 3300025920 Bacteria 1148
218 Ga0207649_10703776 3300025920 Bacteria 784
219 Ga0207652_10007533 3300025921 Bacteria 8765
220 Ga0207652_10029023 3300025921 Bacteria 4620
221 Ga0207694_10071756 3300025924 Bacteria 2706
222 Ga0207694_10129299 3300025924 Bacteria 2023
223 Ga0207694_10132397 3300025924 Bacteria 1999
224 Ga0207694_10741958 3300025924 Bacteria 829
225 Ga0207694_10949787 3300025924 Bacteria 727
226 Ga0207694_11001330 3300025924 Bacteria 707
227 Ga0207694_11162989 3300025924 Bacteria 653
228 Ga0207687_11165078 3300025927 Bacteria 662
229 Ga0207700_10142818 3300025928 Bacteria 1969
230 Ga0207700_10760866 3300025928 Bacteria 866
231 Ga0207644_10119824 3300025931 Bacteria 2002
232 Ga0207690_10000142 3300025932 Bacteria 57187
233 Ga0207690_10042276 3300025932 Bacteria 2992
234 Ga0207686_10106673 3300025934 Bacteria 1881
235 Ga0207709_10229421 3300025935 Bacteria 1344
236 Ga0207669_10888909 3300025937 Bacteria 744
237 Ga0207711_10106003 3300025941 Bacteria 2493
238 Ga0207689_10070978 3300025942 Bacteria 2861
239 Ga0207679_10126789 3300025945 Bacteria 2041
240 Ga0207679_10876398 3300025945 Bacteria 820
241 Ga0207667_10024848 3300025949 Bacteria 6569
242 Ga0207667_10041397 3300025949 Bacteria 4899
243 Ga0207667_10484978 3300025949 Bacteria 1255
244 Ga0207667_10970506 3300025949 Bacteria 838
245 Ga0207712_10378106 3300025961 Bacteria 1184
246 Ga0207712_10553083 3300025961 Bacteria 990
247 Ga0207640_11230432 3300025981 Bacteria 667
248 Ga0207658_10304699 3300025986 Bacteria 1374
249 Ga0207677_11242109 3300026023 Bacteria 683
250 Ga0207703_10969328 3300026035 Bacteria 815
251 Ga0207639_10032995 3300026041 Bacteria 3816
252 Ga0207639_10041338 3300026041 Bacteria 3448
253 Ga0207639_10116089 3300026041 Bacteria 2191
254 Ga0207639_10137598 3300026041 Bacteria 2031
255 Ga0207639_10374588 3300026041 Bacteria 1277
256 Ga0207639_10937771 3300026041 Bacteria 810
257 Ga0207639_11252188 3300026041 Bacteria 696
258 Ga0207678_10400338 3300026067 Bacteria 1189
259 Ga0207678_10754573 3300026067 Bacteria 858
260 Ga0207702_10490471 3300026078 Bacteria 1197
261 Ga0207702_10538332 3300026078 Bacteria 1141
262 Ga0207702_10558739 3300026078 Bacteria 1120
263 Ga0207641_10624052 3300026088 Bacteria 1057
264 Ga0207648_10900386 3300026089 Bacteria 826
265 Ga0207676_10870312 3300026095 Bacteria 882
266 Ga0207674_11463402 3300026116 Bacteria 652
267 Ga0207683_10343114 3300026121 Bacteria 1370
268 Ga0207698_10604318 3300026142 Bacteria 1082
269 Ga0209813_10139309 3300027866 Bacteria 860
270 Ga0268266_10000003 3300028379 Bacteria 1701703
271 Ga0268266_10637065 3300028379 Bacteria 1025
272 Ga0268265_10350263 3300028380 Bacteria 1348
273 Ga0268265_12615466 3300028380 Bacteria 510
274 Ga0268264_10768591 3300028381 Bacteria 961
275 Ga0268264_11922177 3300028381 Bacteria 601
276 Ga0268264_11935062 3300028381 Bacteria 599
277 Ga0265337_1024371 3300028556 Bacteria 1851
278 Ga0265337_1167597 3300028556 Bacteria 595
279 Ga0307517_10063633 3300028786 Bacteria 3446
280 Ga0307517_10356145 3300028786 Bacteria 792
281 Ga0307515_10011325 3300028794 Bacteria 16927
282 Ga0265338_10039064 3300028800 Bacteria 4485
283 Ga0307511_10012287 3300030521 Bacteria 8408
284 Ga0307512_10370032 3300030522 Bacteria 619
285 Ga0265770_1055653 3300030878 Bacteria 725
286 Ga0265327_10000442 3300031251 Bacteria 75162
287 Ga0265327_10001057 3300031251 Bacteria 38486
288 Ga0307513_10000045 3300031456 Bacteria 158626
289 Ga0307513_10000649 3300031456 Bacteria 50063
290 Ga0307513_10031552 3300031456 Bacteria 5997
291 Ga0307513_10050286 3300031456 Bacteria 4507
292 Ga0307513_10280783 3300031456 Bacteria 1443
293 Ga0307513_10281522 3300031456 Bacteria 1440
294 Ga0307408_101434894 3300031548 Bacteria 651
295 Ga0265314_10183612 3300031711 Bacteria 1251
296 Ga0307413_10078837 3300031824 Bacteria 2103
297 Ga0307410_11518408 3300031852 Bacteria 590
298 Ga0307406_10018011 3300031901 Bacteria 4120
299 Ga0307412_10039666 3300031911 Bacteria 3042
300 Ga0307416_102100574 3300032002 Bacteria 667
301 Ga0307414_10014394 3300032004 Bacteria 4742
302 Ga0307414_10170011 3300032004 Bacteria 1741
303 Ga0307414_10186348 3300032004 Bacteria 1674
304 Ga0307414_10248688 3300032004 Bacteria 1476
305 Ga0307414_10292105 3300032004 Bacteria 1374
306 Ga0307414_10315513 3300032004 Bacteria 1328
307 Ga0307414_10405971 3300032004 Bacteria 1184
308 Ga0307414_10464012 3300032004 Bacteria 1113
309 Ga0307414_10562745 3300032004 Bacteria 1017
310 Ga0307411_11950826 3300032005 Bacteria 547
311 Ga0307510_10003321 3300033180 Bacteria 18743
312 Ga0307510_10020409 3300033180 Bacteria 7742
313 Ga0373944_0027524 3300035089 Bacteria 1686
314 Ga0373945_0270158 3300035116 Bacteria 722
315 Ga0373956_0612160 3300035119 Bacteria 520
316 Ga0373943_0089776 3300035170 Bacteria 1590
317 Ga0373943_0285502 3300035170 Bacteria 934
318 Ga0373946_0376866 3300035171 Bacteria 713
319 Ga0373931_0425236 3300035691 Bacteria 845
320 Ga0373947_0409026 3300035725 Bacteria 916
321 Ga0373925_0000199 3300037068 Bacteria 65400
322 Ga0373925_0475872 3300037068 Bacteria 1024
323 Ga0395899_0000991 3300037312 Bacteria 26130
324 Ga0395900_0000002 3300037418 Bacteria 671103
325 Ga0395898_0013424 3300037466 Bacteria 8437
326 Ga0395905_0353551 3300037471 Bacteria 1361
327 Ga0395905_0992285 3300037471 Bacteria 743
328 Ga0436364_1078406 3300037853 Bacteria 545
329 Ga0395901_0000021 3300038443 Bacteria 307734
330 Ga0395901_1439020 3300038443 Bacteria 647
331 Ga0436365_1373116 3300039437 Bacteria 3294
332 Ga0436360_1137802 3300039438 Bacteria 653
333 Ga0436361_0030985 3300039447 Bacteria 20368
334 Ga0436361_0249034 3300039447 Bacteria 500
335 Ga0436361_0503454 3300039447 Bacteria 5147
336 Ga0436361_1086913 3300039447 Bacteria 566
337 Ga0451791_1146831 3300041451 Bacteria 514
338 Ga0451793_0618349 3300041452 Bacteria 544
339 Ga0451793_1875585 3300041452 Bacteria 745
340 Ga0451798_0079263 3300041458 Bacteria 516
341 Ga0451800_1434722 3300041459 Bacteria 536
342 Ga0451839_0234978 3300041496 Bacteria 1075
343 Ga0451841_0673893 3300041498 Bacteria 505
344 Ga0451855_1752724 3300041511 Bacteria 533
345 Ga0451853_0376336 3300041512 Bacteria 796
346 Ga0439445_0135033 3300042004 Bacteria 713
347 Ga0450890_029171 3300042127 Bacteria 779
348 Ga0439446_0003888 3300042156 Bacteria 3750
349 Ga0439459_0034174 3300042438 Bacteria 1050
350 Ga0466966_0493769 3300044684 Unclassified 736
351 Ga0466961_0090099 3300044693 Bacteria 1937
352 Ga0466964_0246123 3300044706 Bacteria 879
353 Ga0466957_1179847 3300044842 Bacteria 553
354 Ga0466960_0424193 3300044901 Bacteria 769
355 Ga0495617_259478 3300046452 Bacteria 534
356 Ga0495627_000508 3300046453 Bacteria 32410
357 Ga0495638_0000403 3300046460 Bacteria 52881
358 Ga0495638_0001416 3300046460 Bacteria 21777
359 Ga0495638_0008799 3300046460 Bacteria 7129
360 Ga0495638_0047592 3300046460 Bacteria 2688
361 Ga0495638_0097790 3300046460 Bacteria 1759
362 Ga0495638_0149775 3300046460 Bacteria 1354
363 Ga0495650_0028332 3300046471 Bacteria 2574
364 Ga0495650_0149542 3300046471 Bacteria 839
365 Ga0495580_0737783 3300046472 Bacteria 642
366 Ga0495585_0047761 3300046492 Bacteria 2383
367 Ga0495583_0000025 3300046506 Bacteria 263775
368 Ga0495583_0029134 3300046506 Bacteria 2705
369 Ga0495583_0253466 3300046506 Bacteria 705
370 Ga0495606_0014729 3300046507 Bacteria 6080
371 Ga0495606_0092696 3300046507 Bacteria 1855
372 Ga0495606_0135610 3300046507 Bacteria 1458
373 Ga0495606_0453655 3300046507 Bacteria 656
374 Ga0495610_0000507 3300046512 Bacteria 39719
375 Ga0495610_0004190 3300046512 Bacteria 10769
376 Ga0495616_0000458 3300046513 Bacteria 31083
377 Ga0495632_0004692 3300046519 Bacteria 9233
378 Ga0495637_0008261 3300046520 Bacteria 5118
379 Ga0495637_0099495 3300046520 Bacteria 1138
380 Ga0495637_0271778 3300046520 Bacteria 606
381 Ga0495643_0184483 3300046522 Bacteria 1011
382 Ga0495643_0507059 3300046522 Bacteria 518
383 Ga0495648_0173912 3300046524 Bacteria 1101
384 Ga0495663_0023356 3300046525 Bacteria 1790
385 Ga0495642_0006049 3300046528 Bacteria 4647
386 Ga0495642_0149417 3300046528 Bacteria 1010
387 Ga0495642_0353393 3300046528 Bacteria 646
388 Ga0495654_0070729 3300046530 Bacteria 1654
389 Ga0495665_0344269 3300046531 Bacteria 760
390 Ga0495597_0071402 3300046542 Bacteria 1495
391 Ga0495597_0137316 3300046542 Bacteria 1010
392 Ga0495597_0238523 3300046542 Bacteria 718
393 Ga0495597_0248927 3300046542 Bacteria 699
394 Ga0495645_0655876 3300046543 Bacteria 641
395 Ga0495633_0438718 3300046558 Bacteria 590
396 Ga0495668_0040226 3300046616 Bacteria 2608
397 Ga0495668_0047393 3300046616 Bacteria 2386
398 Ga0495668_0098733 3300046616 Bacteria 1598
399 Ga0495668_0303492 3300046616 Bacteria 875
400 Ga0495611_0269497 3300046648 Bacteria 787
401 Ga0495625_0000043 3300046660 Bacteria 205715
402 Ga0495625_0002221 3300046660 Bacteria 21452
403 Ga0495625_0017877 3300046660 Bacteria 5542
404 Ga0495625_0061106 3300046660 Bacteria 2667
405 Ga0495625_0065064 3300046660 Bacteria 2571
406 Ga0495625_0077380 3300046660 Bacteria 2324
407 Ga0495625_0079917 3300046660 Bacteria 2278
408 Ga0495625_0152098 3300046660 Bacteria 1555
409 Ga0495625_0495580 3300046660 Bacteria 748
410 Ga0495669_0000014 3300046684 Bacteria 140832
411 Ga0495669_0000222 3300046684 Bacteria 34149
412 Ga0495669_0062880 3300046684 Bacteria 1683
413 Ga0495669_0149432 3300046684 Bacteria 1105
414 Ga0495670_0312747 3300046691 Bacteria 843
415 Ga0495589_0008147 3300046794 Bacteria 5479
416 Ga0495660_0123446 3300046810 Bacteria 1307
417 Ga0495660_0228295 3300046810 Bacteria 874
418 Ga0495660_0411753 3300046810 Bacteria 590
419 Ga0495636_0078544 3300047318 Bacteria 1418
420 Ga0495672_0001670 3300047320 Bacteria 21514
421 Ga0495672_0420897 3300047320 Bacteria 607
422 Ga0495683_0108043 3300047323 Bacteria 1331
423 Ga0495677_0017610 3300047445 Bacteria 2590
424 Ga0495677_0021804 3300047445 Bacteria 2321
425 Ga0495677_0112364 3300047445 Bacteria 1036
426 Ga0495679_060102 3300047446 Bacteria 1116
427 Ga0495673_0000340 3300047469 Bacteria 59502
428 Ga0495673_0001397 3300047469 Bacteria 19412
429 Ga0495681_0088711 3300047470 Bacteria 1369
430 Ga0495681_0229434 3300047470 Bacteria 741
431 Ga0495686_0025616 3300047472 Bacteria 3865
432 Ga0495686_0035838 3300047472 Bacteria 3186
433 Ga0495686_0037836 3300047472 Bacteria 3089
434 Ga0495686_0056568 3300047472 Bacteria 2450
435 Ga0495686_0138920 3300047472 Bacteria 1435
436 Ga0495686_0332668 3300047472 Bacteria 830
437 Ga0495686_0502693 3300047472 Bacteria 638
438 Ga0496100_0629196 3300048903 Bacteria 835
439 Ga0496101_1623555 3300048904 Bacteria 502
440 Ga0496106_0451977 3300048909 Bacteria 1032
441 Ga0496107_0118635 3300048910 Bacteria 1948
442 Ga0496112_0966166 3300048915 Bacteria 772
443 Ga0496115_0001700 3300048918 Bacteria 15774
444 Ga0496115_0036869 3300048918 Bacteria 3872
445 Ga0496115_0037132 3300048918 Bacteria 3860
446 Ga0496115_0104288 3300048918 Bacteria 2327
447 Ga0496115_0126491 3300048918 Bacteria 2105
448 Ga0496115_0404674 3300048918 Bacteria 1107
449 Ga0496121_0551066 3300048924 Bacteria 721
450 Ga0496123_0149296 3300048926 Bacteria 1264
451 Ga0496124_0006743 3300048927 Bacteria 12418
452 Ga0496124_0896786 3300048927 Bacteria 538
453 Ga0496126_0045491 3300048929 Bacteria 4033
454 Ga0496126_0071919 3300048929 Bacteria 3078
455 Ga0495678_101481 3300049459 Bacteria 996
456 Ga0501032_1045571 3300049569 Bacteria 512
457 Ga0501033_1194895 3300049570 Bacteria 504
458 Ga0501033_1206272 3300049570 Bacteria 501
459 Ga0501034_0431139 3300049571 Bacteria 1238
460 Ga0501034_0555471 3300049571 Bacteria 1057
461 Ga0501036_1012812 3300049572 Bacteria 680
462 Ga0501047_0508400 3300049581 Bacteria 1031
463 Ga0501047_0575207 3300049581 Bacteria 950
464 Ga0501067_0129971 3300049583 Bacteria 1402
465 Ga0501238_000791 3300049671 Bacteria 3584
466 Ga0501238_000834 3300049671 Bacteria 3503
467 Ga0501273_096557 3300049770 Bacteria 508
468 nmdc:mga03683_140170_c1 3300050489 Bacteria 1087
469 nmdc:mga03n38_28417_c1 3300050490 Bacteria 2331
470 nmdc:mga03n38_297937_c1 3300050490 Bacteria 865
471 nmdc:mga00v17_3414_c1 3300050491 Bacteria 8209
472 nmdc:mga0k408_15526_c1 3300050493 Bacteria 4211
473 nmdc:mga0k408_24716_c1 3300050493 Bacteria 3398
474 nmdc:mga0k408_58044_c1 3300050493 Bacteria 2248
475 nmdc:mga06z11_51432_c1 3300050494 Bacteria 2110
476 nmdc:mga04h51_5466_c1 3300050495 Bacteria 3241
477 nmdc:mga07m45_32653_c1 3300050496 Bacteria 2887
478 nmdc:mga07m45_457877_c1 3300050496 Bacteria 740
479 nmdc:mga07m45_884302_c1 3300050496 Bacteria 511
480 nmdc:mga05p37_1675952_c1 3300050507 Bacteria 621
481 nmdc:mga08y16_945481_c1 3300050511 Bacteria 845
482 nmdc:mga0sz30_2263_c1 3300050516 Bacteria 6886
483 nmdc:mga0sz30_73368_c1 3300050516 Bacteria 1475
484 Ga0495612_0138594 3300053078 Bacteria 1054
485 Ga0500643_063744 3300053087 Bacteria 1031
486 Ga0500641_0109535 3300053096 Bacteria 1188
487 Ga0500650_0049221 3300053098 Bacteria 1956
488 Ga0500650_0284190 3300053098 Bacteria 735
489 Ga0500554_003848 3300053102 Bacteria 3114
490 Ga0500556_0002669 3300053104 Bacteria 5559
491 Ga0500562_000558 3300053108 Bacteria 8992
492 Ga0500562_047245 3300053108 Bacteria 1148
493 Ga0500595_018188 3300053119 Bacteria 2575
494 Ga0500595_051890 3300053119 Bacteria 1268
495 Ga0500595_169538 3300053119 Bacteria 607
496 Ga0500608_000105 3300053122 Bacteria 34366
497 Ga0500608_097725 3300053122 Bacteria 1364
498 Ga0500614_006173 3300053123 Bacteria 2517
499 Ga0500618_000022 3300053125 Bacteria 157907
500 Ga0500642_0034007 3300053130 Bacteria 2153
501 Ga0500642_0169671 3300053130 Bacteria 1021
502 Ga0500655_030393 3300053133 Bacteria 1039
503 Ga0500658_0089400 3300053134 Bacteria 1329
504 Ga0500559_0000806 3300053136 Bacteria 20467
505 Ga0500559_0002565 3300053136 Bacteria 9318
506 Ga0500559_0021623 3300053136 Bacteria 2727
507 Ga0500573_0334719 3300053140 Bacteria 742
508 Ga0500573_0496584 3300053140 Bacteria 552
509 Ga0500577_0302181 3300053142 Bacteria 698
510 Ga0500622_0010724 3300053156 Bacteria 5015
511 Ga0500622_0015383 3300053156 Bacteria 4097
512 Ga0500645_006258 3300053730 Bacteria 4270
513 Ga0500645_206546 3300053730 Bacteria 528
514 Ga0500609_001881 3300053731 Bacteria 3044
515 Ga0500656_014429 3300053732 Bacteria 915
516 Ga0590077_088360 3300059426 Bacteria 718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10037576 Ga0182008_100375762 70
2 3300005344 Ga0070661_101357772 Ga0070661_1013577722 72
3 3300006852 Ga0075433_11391549 Ga0075433_113915492 72
4 3300013104 Ga0157370_10022429 Ga0157370_100224294 72
5 3300013105 Ga0157369_10030310 Ga0157369_100303104 72
6 iso_pu_bacteria 2510917020 2511122821 73
7 iso_pu_bacteria 2643221583 2643922674 73
8 iso_pu_bacteria 2928531327 2928531940 73
9 3300009147 Ga0114129_13346022 Ga0114129_133460222 74
10 3300037853 Ga0436364_1078406 Ga0436364_1078406_155_400 74
11 3300044842 Ga0466957_1179847 Ga0466957_1179847_156_380 74
12 3300049571 Ga0501034_0555471 Ga0501034_0555471_576_821 74
13 3300049581 Ga0501047_0508400 Ga0501047_0508400_509_754 74
14 3300050496 nmdc:mga07m45_884302_c1 nmdc:mga07m45_884302_c1_271_501 74
15 3300050507 nmdc:mga05p37_1675952_c1 nmdc:mga05p37_1675952_c1_142_369 74
16 iso_pu_bacteria 2585428106 2587919800 74
17 iso_pu_bacteria 2643221614 2644087511 74
18 iso_pu_bacteria 2643221640 2644223573 74
19 iso_pu_bacteria 2643221642 2644236337 74
20 iso_pu_bacteria 2643221661 2644344445 74
21 iso_pu_bacteria 2643221666 2644366871 74
22 iso_pu_bacteria 2791355048 2792459283 74
23 iso_pu_bacteria 2843744320 2843744794 74
24 iso_pu_bacteria 2851153111 2851156839 74
25 iso_pu_bacteria 2898329390 2898330587 74
26 3300005329 Ga0070683_101623281 Ga0070683_1016232812 75
27 3300005466 Ga0070685_10941751 Ga0070685_109417512 75
28 3300006931 Ga0097620_100199603 Ga0097620_1001996034 75
29 3300009098 Ga0105245_11019500 Ga0105245_110195002 75
30 3300021361 Ga0213872_10008379 Ga0213872_100083794 75
31 3300021361 Ga0213872_10130761 Ga0213872_101307611 75
32 3300025927 Ga0207687_11165078 Ga0207687_111650782 75
33 3300028380 Ga0268265_12615466 Ga0268265_126154661 75
34 3300028556 Ga0265337_1167597 Ga0265337_11675971 75
35 3300030878 Ga0265770_1055653 Ga0265770_10556531 75
36 3300039447 Ga0436361_0249034 Ga0436361_0249034_41_268 75
37 3300039447 Ga0436361_0503454 Ga0436361_0503454_1532_1759 75
38 3300039447 Ga0436361_1086913 Ga0436361_1086913_122_349 75
39 3300041452 Ga0451793_1875585 Ga0451793_1875585_80_316 75
40 3300044706 Ga0466964_0246123 Ga0466964_0246123_411_638 75
41 3300044901 Ga0466960_0424193 Ga0466960_0424193_369_596 75
42 3300046460 Ga0495638_0008799 Ga0495638_0008799_1627_1860 75
43 3300046542 Ga0495597_0248927 Ga0495597_0248927_104_331 75
44 3300053108 Ga0500562_000558 Ga0500562_000558_4062_4289 75
45 iso_pu_bacteria 2643221574 2643884621 75
46 iso_pu_bacteria 2643221663 2644351461 75
47 iso_pu_bacteria 2643221699 2644548990 75
48 iso_pu_bacteria 2643221699 2644553278 75
49 3300003215 JGI25153J46596_10064298 JGI25153J46596_100642982 76
50 3300003215 JGI25153J46596_10096101 JGI25153J46596_100961012 76
51 3300003316 rootH1_10013055 rootH1_100130556 76
52 3300003771 Ga0055526_1033927 Ga0055526_10339272 76
53 3300003771 Ga0055526_1071185 Ga0055526_10711852 76
54 3300003773 Ga0055537_1001045 Ga0055537_10010454 76
55 3300003775 Ga0055524_1008150 Ga0055524_10081504 76
56 3300003790 Ga0055528_1036338 Ga0055528_10363382 76
57 3300003794 Ga0055531_10001885 Ga0055531_100018859 76
58 3300005262 Ga0065165_1001092 Ga0065165_10010927 76
59 3300005327 Ga0070658_10733975 Ga0070658_107339752 76
60 3300005455 Ga0070663_101741556 Ga0070663_1017415562 76
61 3300006195 Ga0075366_10045389 Ga0075366_100453895 76
62 3300009093 Ga0105240_12688895 Ga0105240_126888951 76
63 3300009093 Ga0105240_12748459 Ga0105240_127484591 76
64 3300009551 Ga0105238_12335893 Ga0105238_123358931 76
65 3300009553 Ga0105249_10283738 Ga0105249_102837381 76
66 3300012512 Ga0157327_1067875 Ga0157327_10678752 76
67 3300013306 Ga0163162_10532111 Ga0163162_105321111 76
68 3300014497 Ga0182008_10382859 Ga0182008_103828592 76
69 3300017792 Ga0163161_11819394 Ga0163161_118193941 76
70 3300021384 Ga0213876_10214927 Ga0213876_102149272 76
71 3300025263 Ga0209565_1000798 Ga0209565_100079815 76
72 3300025273 Ga0209673_1005598 Ga0209673_10055987 76
73 3300025273 Ga0209673_1052705 Ga0209673_10527052 76
74 3300025291 Ga0209675_1015100 Ga0209675_10151004 76
75 3300025291 Ga0209675_1076884 Ga0209675_10768842 76
76 3300025295 Ga0209564_1007084 Ga0209564_10070849 76
77 3300025295 Ga0209564_1033664 Ga0209564_10336642 76
78 3300025297 Ga0209758_1005712 Ga0209758_10057122 76
79 3300025297 Ga0209758_1011442 Ga0209758_10114422 76
80 3300025298 Ga0209050_1031075 Ga0209050_10310754 76
81 3300025299 Ga0209256_1003409 Ga0209256_100340912 76
82 3300025299 Ga0209256_1006386 Ga0209256_10063865 76
83 3300025304 Ga0209257_1000036 Ga0209257_100003635 76
84 3300025909 Ga0207705_10882586 Ga0207705_108825861 76
85 3300025924 Ga0207694_10741958 Ga0207694_107419582 76
86 3300026067 Ga0207678_10754573 Ga0207678_107545732 76
87 3300028794 Ga0307515_10011325 Ga0307515_100113257 76
88 3300028800 Ga0265338_10039064 Ga0265338_100390641 76
89 3300030522 Ga0307512_10370032 Ga0307512_103700322 76
90 3300039437 Ga0436365_1373116 Ga0436365_1373116_2205_2462 76
91 3300041498 Ga0451841_0673893 Ga0451841_0673893_23_253 76
92 3300042127 Ga0450890_029171 Ga0450890_029171_60_290 76
93 3300042438 Ga0439459_0034174 Ga0439459_0034174_765_995 76
94 3300046452 Ga0495617_259478 Ga0495617_259478_135_365 76
95 3300046460 Ga0495638_0000403 Ga0495638_0000403_40002_40232 76
96 3300046460 Ga0495638_0001416 Ga0495638_0001416_99_329 76
97 3300046460 Ga0495638_0097790 Ga0495638_0097790_803_1033 76
98 3300046471 Ga0495650_0028332 Ga0495650_0028332_25_255 76
99 3300046492 Ga0495585_0047761 Ga0495585_0047761_782_1012 76
100 3300046506 Ga0495583_0000025 Ga0495583_0000025_183272_183502 76
101 3300046507 Ga0495606_0014729 Ga0495606_0014729_4297_4527 76
102 3300046507 Ga0495606_0453655 Ga0495606_0453655_200_430 76
103 3300046512 Ga0495610_0000507 Ga0495610_0000507_29313_29543 76
104 3300046513 Ga0495616_0000458 Ga0495616_0000458_21617_21847 76
105 3300046519 Ga0495632_0004692 Ga0495632_0004692_472_702 76
106 3300046520 Ga0495637_0008261 Ga0495637_0008261_3932_4162 76
107 3300046520 Ga0495637_0271778 Ga0495637_0271778_261_491 76
108 3300046522 Ga0495643_0184483 Ga0495643_0184483_639_869 76
109 3300046522 Ga0495643_0507059 Ga0495643_0507059_270_500 76
110 3300046524 Ga0495648_0173912 Ga0495648_0173912_349_579 76
111 3300046525 Ga0495663_0023356 Ga0495663_0023356_336_566 76
112 3300046660 Ga0495625_0000043 Ga0495625_0000043_121180_121410 76
113 3300046660 Ga0495625_0002221 Ga0495625_0002221_19340_19570 76
114 3300046660 Ga0495625_0079917 Ga0495625_0079917_1865_2095 76
115 3300046810 Ga0495660_0123446 Ga0495660_0123446_166_396 76
116 3300046810 Ga0495660_0411753 Ga0495660_0411753_318_548 76
117 3300047320 Ga0495672_0001670 Ga0495672_0001670_13243_13473 76
118 3300047323 Ga0495683_0108043 Ga0495683_0108043_194_424 76
119 3300047446 Ga0495679_060102 Ga0495679_060102_410_640 76
120 3300047469 Ga0495673_0001397 Ga0495673_0001397_9774_10004 76
121 3300047470 Ga0495681_0229434 Ga0495681_0229434_334_564 76
122 3300047472 Ga0495686_0025616 Ga0495686_0025616_3070_3300 76
123 3300048918 Ga0496115_0001700 Ga0496115_0001700_5457_5687 76
124 3300048927 Ga0496124_0896786 Ga0496124_0896786_30_260 76
125 3300048929 Ga0496126_0045491 Ga0496126_0045491_2046_2276 76
126 3300048929 Ga0496126_0071919 Ga0496126_0071919_1175_1405 76
127 3300049459 Ga0495678_101481 Ga0495678_101481_438_668 76
128 3300049569 Ga0501032_1045571 Ga0501032_1045571_130_363 76
129 3300049570 Ga0501033_1194895 Ga0501033_1194895_20_253 76
130 3300049571 Ga0501034_0431139 Ga0501034_0431139_897_1130 76
131 3300049572 Ga0501036_1012812 Ga0501036_1012812_364_597 76
132 3300049581 Ga0501047_0575207 Ga0501047_0575207_220_450 76
133 3300049671 Ga0501238_000791 Ga0501238_000791_638_868 76
134 3300049671 Ga0501238_000834 Ga0501238_000834_1917_2147 76
135 3300050493 nmdc:mga0k408_15526_c1 nmdc:mga0k408_15526_c1_1320_1550 76
136 3300053087 Ga0500643_063744 Ga0500643_063744_61_291 76
137 3300053098 Ga0500650_0049221 Ga0500650_0049221_1645_1881 76
138 3300053102 Ga0500554_003848 Ga0500554_003848_2731_2961 76
139 3300053104 Ga0500556_0002669 Ga0500556_0002669_5228_5458 76
140 3300053122 Ga0500608_000105 Ga0500608_000105_31819_32049 76
141 3300053122 Ga0500608_097725 Ga0500608_097725_1087_1317 76
142 3300053123 Ga0500614_006173 Ga0500614_006173_165_395 76
143 3300053125 Ga0500618_000022 Ga0500618_000022_95080_95310 76
144 3300053134 Ga0500658_0089400 Ga0500658_0089400_82_312 76
145 3300053136 Ga0500559_0000806 Ga0500559_0000806_10705_10935 76
146 3300053136 Ga0500559_0002565 Ga0500559_0002565_6988_7218 76
147 3300053136 Ga0500559_0021623 Ga0500559_0021623_2219_2449 76
148 3300053730 Ga0500645_206546 Ga0500645_206546_169_399 76
149 3300053731 Ga0500609_001881 Ga0500609_001881_844_1074 76
150 3300059426 Ga0590077_088360 Ga0590077_088360_172_432 76
151 3300005327 Ga0070658_11692136 Ga0070658_116921362 77
152 3300005334 Ga0068869_100056322 Ga0068869_1000563225 77
153 3300005338 Ga0068868_101306108 Ga0068868_1013061081 77
154 3300005455 Ga0070663_101215042 Ga0070663_1012150421 77
155 3300005535 Ga0070684_101225650 Ga0070684_1012256502 77
156 3300005539 Ga0068853_101269176 Ga0068853_1012691762 77
157 3300005563 Ga0068855_100145212 Ga0068855_1001452122 77
158 3300006186 Ga0075369_10001212 Ga0075369_100012128 77
159 3300009093 Ga0105240_10000428 Ga0105240_1000042844 77
160 3300009174 Ga0105241_10846526 Ga0105241_108465262 77
161 3300009551 Ga0105238_10340545 Ga0105238_103405451 77
162 3300009551 Ga0105238_10558448 Ga0105238_105584482 77
163 3300025913 Ga0207695_10001559 Ga0207695_1000155931 77
164 3300025913 Ga0207695_10597703 Ga0207695_105977032 77
165 3300025920 Ga0207649_10703776 Ga0207649_107037762 77
166 3300025928 Ga0207700_10142818 Ga0207700_101428182 77
167 3300025934 Ga0207686_10106673 Ga0207686_101066731 77
168 3300025942 Ga0207689_10070978 Ga0207689_100709783 77
169 3300025949 Ga0207667_10484978 Ga0207667_104849782 77
170 3300026023 Ga0207677_11242109 Ga0207677_112421091 77
171 3300026041 Ga0207639_10937771 Ga0207639_109377712 77
172 3300031711 Ga0265314_10183612 Ga0265314_101836121 77
173 3300031911 Ga0307412_10039666 Ga0307412_100396664 77
174 3300032004 Ga0307414_10315513 Ga0307414_103155133 77
175 3300035119 Ga0373956_0612160 Ga0373956_0612160_242_490 77
176 3300039438 Ga0436360_1137802 Ga0436360_1137802_369_602 77
177 3300041458 Ga0451798_0079263 Ga0451798_0079263_185_418 77
178 3300041496 Ga0451839_0234978 Ga0451839_0234978_62_301 77
179 3300042004 Ga0439445_0135033 Ga0439445_0135033_457_690 77
180 3300042156 Ga0439446_0003888 Ga0439446_0003888_857_1090 77
181 3300046453 Ga0495627_000508 Ga0495627_000508_22479_22712 77
182 3300046460 Ga0495638_0047592 Ga0495638_0047592_873_1106 77
183 3300046507 Ga0495606_0135610 Ga0495606_0135610_86_325 77
184 3300046512 Ga0495610_0004190 Ga0495610_0004190_7990_8223 77
185 3300046520 Ga0495637_0099495 Ga0495637_0099495_786_1019 77
186 3300046794 Ga0495589_0008147 Ga0495589_0008147_1964_2197 77
187 3300046810 Ga0495660_0228295 Ga0495660_0228295_22_255 77
188 3300047469 Ga0495673_0000340 Ga0495673_0000340_59088_59321 77
189 3300047472 Ga0495686_0056568 Ga0495686_0056568_1677_1910 77
190 3300048910 Ga0496107_0118635 Ga0496107_0118635_725_958 77
191 3300048918 Ga0496115_0126491 Ga0496115_0126491_1525_1758 77
192 3300048926 Ga0496123_0149296 Ga0496123_0149296_650_883 77
193 3300048927 Ga0496124_0006743 Ga0496124_0006743_7043_7276 77
194 3300050516 nmdc:mga0sz30_2263_c1 nmdc:mga0sz30_2263_c1_1661_1894 77
195 3300053130 Ga0500642_0034007 Ga0500642_0034007_169_402 77
196 3300053142 Ga0500577_0302181 Ga0500577_0302181_402_635 77
197 3300003781 Ga0055536_1000251 Ga0055536_100025131 78
198 3300003781 Ga0055536_1000815 Ga0055536_10008155 78
199 3300003781 Ga0055536_1000953 Ga0055536_10009535 78
200 3300003791 Ga0055530_10001790 Ga0055530_100017905 78
201 3300003792 Ga0055540_1084968 Ga0055540_10849682 78
202 3300003794 Ga0055531_10000541 Ga0055531_1000054118 78
203 3300003794 Ga0055531_10035697 Ga0055531_100356973 78
204 3300005327 Ga0070658_10378644 Ga0070658_103786442 78
205 3300005331 Ga0070670_102154267 Ga0070670_1021542672 78
206 3300005334 Ga0068869_101177912 Ga0068869_1011779122 78
207 3300005340 Ga0070689_100432816 Ga0070689_1004328162 78
208 3300005353 Ga0070669_101619193 Ga0070669_1016191932 78
209 3300005355 Ga0070671_100054034 Ga0070671_1000540345 78
210 3300005436 Ga0070713_101275693 Ga0070713_1012756931 78
211 3300005459 Ga0068867_100520199 Ga0068867_1005201992 78
212 3300005467 Ga0070706_101432950 Ga0070706_1014329501 78
213 3300005539 Ga0068853_100062463 Ga0068853_1000624633 78
214 3300005563 Ga0068855_100146004 Ga0068855_1001460045 78
215 3300005564 Ga0070664_100761822 Ga0070664_1007618221 78
216 3300005577 Ga0068857_100550636 Ga0068857_1005506363 78
217 3300005578 Ga0068854_100829462 Ga0068854_1008294622 78
218 3300005614 Ga0068856_100269610 Ga0068856_1002696104 78
219 3300005842 Ga0068858_100834011 Ga0068858_1008340112 78
220 3300006051 Ga0075364_10004307 Ga0075364_100043079 78
221 3300006178 Ga0075367_10009900 Ga0075367_100099005 78
222 3300006195 Ga0075366_10020867 Ga0075366_100208672 78
223 3300006195 Ga0075366_10033211 Ga0075366_100332113 78
224 3300006353 Ga0075370_10080534 Ga0075370_100805344 78
225 3300006353 Ga0075370_10333441 Ga0075370_103334412 78
226 3300006353 Ga0075370_10979776 Ga0075370_109797761 78
227 3300009093 Ga0105240_10368547 Ga0105240_103685472 78
228 3300009093 Ga0105240_11279787 Ga0105240_112797872 78
229 3300009148 Ga0105243_11250635 Ga0105243_112506352 78
230 3300009176 Ga0105242_10829404 Ga0105242_108294041 78
231 3300009177 Ga0105248_10069725 Ga0105248_100697253 78
232 3300009551 Ga0105238_10026580 Ga0105238_100265806 78
233 3300009553 Ga0105249_10414507 Ga0105249_104145072 78
234 3300010375 Ga0105239_12970933 Ga0105239_129709332 78
235 3300011119 Ga0105246_11775007 Ga0105246_117750071 78
236 3300013306 Ga0163162_11535507 Ga0163162_115355072 78
237 3300013307 Ga0157372_10764189 Ga0157372_107641892 78
238 3300014325 Ga0163163_10310256 Ga0163163_103102561 78
239 3300014325 Ga0163163_13308693 Ga0163163_133086932 78
240 3300017792 Ga0163161_11371235 Ga0163161_113712351 78
241 3300025292 Ga0209676_1000038 Ga0209676_1000038149 78
242 3300025292 Ga0209676_1000169 Ga0209676_1000169113 78
243 3300025292 Ga0209676_1000319 Ga0209676_100031969 78
244 3300025292 Ga0209676_1095142 Ga0209676_10951422 78
245 3300025295 Ga0209564_1018803 Ga0209564_10188034 78
246 3300025298 Ga0209050_1000281 Ga0209050_100028189 78
247 3300025298 Ga0209050_1000722 Ga0209050_100072231 78
248 3300025299 Ga0209256_1014428 Ga0209256_10144284 78
249 3300025303 Ga0209051_1001156 Ga0209051_100115613 78
250 3300025304 Ga0209257_1000433 Ga0209257_100043379 78
251 3300025304 Ga0209257_1000845 Ga0209257_100084523 78
252 3300025910 Ga0207684_10276041 Ga0207684_102760412 78
253 3300025913 Ga0207695_10216015 Ga0207695_102160153 78
254 3300025913 Ga0207695_10719232 Ga0207695_107192322 78
255 3300025924 Ga0207694_10071756 Ga0207694_100717565 78
256 3300025928 Ga0207700_10760866 Ga0207700_107608662 78
257 3300025931 Ga0207644_10119824 Ga0207644_101198244 78
258 3300025937 Ga0207669_10888909 Ga0207669_108889092 78
259 3300025941 Ga0207711_10106003 Ga0207711_101060033 78
260 3300025945 Ga0207679_10876398 Ga0207679_108763982 78
261 3300025949 Ga0207667_10970506 Ga0207667_109705062 78
262 3300025961 Ga0207712_10378106 Ga0207712_103781062 78
263 3300025981 Ga0207640_11230432 Ga0207640_112304321 78
264 3300025986 Ga0207658_10304699 Ga0207658_103046992 78
265 3300026035 Ga0207703_10969328 Ga0207703_109693282 78
266 3300026041 Ga0207639_10137598 Ga0207639_101375983 78
267 3300026041 Ga0207639_10374588 Ga0207639_103745881 78
268 3300026078 Ga0207702_10558739 Ga0207702_105587392 78
269 3300026088 Ga0207641_10624052 Ga0207641_106240522 78
270 3300026089 Ga0207648_10900386 Ga0207648_109003862 78
271 3300026095 Ga0207676_10870312 Ga0207676_108703122 78
272 3300027866 Ga0209813_10139309 Ga0209813_101393092 78
273 3300028786 Ga0307517_10356145 Ga0307517_103561452 78
274 3300030521 Ga0307511_10012287 Ga0307511_100122874 78
275 3300031251 Ga0265327_10001057 Ga0265327_1000105740 78
276 3300031456 Ga0307513_10000649 Ga0307513_1000064944 78
277 3300031456 Ga0307513_10031552 Ga0307513_100315525 78
278 3300031456 Ga0307513_10050286 Ga0307513_100502866 78
279 3300031548 Ga0307408_101434894 Ga0307408_1014348942 78
280 3300031852 Ga0307410_11518408 Ga0307410_115184081 78
281 3300031901 Ga0307406_10018011 Ga0307406_100180112 78
282 3300032005 Ga0307411_11950826 Ga0307411_119508261 78
283 3300033180 Ga0307510_10003321 Ga0307510_1000332116 78
284 3300035170 Ga0373943_0089776 Ga0373943_0089776_106_348 78
285 3300035171 Ga0373946_0376866 Ga0373946_0376866_420_656 78
286 3300035691 Ga0373931_0425236 Ga0373931_0425236_381_623 78
287 3300037068 Ga0373925_0475872 Ga0373925_0475872_244_480 78
288 3300037312 Ga0395899_0000991 Ga0395899_0000991_25426_25662 78
289 3300037418 Ga0395900_0000002 Ga0395900_0000002_253464_253700 78
290 3300037466 Ga0395898_0013424 Ga0395898_0013424_914_1150 78
291 3300037471 Ga0395905_0353551 Ga0395905_0353551_914_1150 78
292 3300038443 Ga0395901_0000021 Ga0395901_0000021_41194_41430 78
293 3300041512 Ga0451853_0376336 Ga0451853_0376336_26_268 78
294 3300046460 Ga0495638_0149775 Ga0495638_0149775_944_1186 78
295 3300046471 Ga0495650_0149542 Ga0495650_0149542_220_456 78
296 3300046472 Ga0495580_0737783 Ga0495580_0737783_311_547 78
297 3300046506 Ga0495583_0029134 Ga0495583_0029134_2345_2581 78
298 3300046506 Ga0495583_0253466 Ga0495583_0253466_265_501 78
299 3300046507 Ga0495606_0092696 Ga0495606_0092696_1189_1431 78
300 3300046528 Ga0495642_0006049 Ga0495642_0006049_1939_2175 78
301 3300046528 Ga0495642_0149417 Ga0495642_0149417_532_768 78
302 3300046528 Ga0495642_0353393 Ga0495642_0353393_230_466 78
303 3300046530 Ga0495654_0070729 Ga0495654_0070729_520_762 78
304 3300046542 Ga0495597_0071402 Ga0495597_0071402_1228_1470 78
305 3300046542 Ga0495597_0137316 Ga0495597_0137316_479_721 78
306 3300046543 Ga0495645_0655876 Ga0495645_0655876_113_355 78
307 3300046558 Ga0495633_0438718 Ga0495633_0438718_120_356 78
308 3300046616 Ga0495668_0047393 Ga0495668_0047393_390_632 78
309 3300046616 Ga0495668_0098733 Ga0495668_0098733_780_1016 78
310 3300046616 Ga0495668_0303492 Ga0495668_0303492_202_438 78
311 3300046648 Ga0495611_0269497 Ga0495611_0269497_509_745 78
312 3300046660 Ga0495625_0017877 Ga0495625_0017877_4522_4764 78
313 3300046660 Ga0495625_0061106 Ga0495625_0061106_586_822 78
314 3300046660 Ga0495625_0065064 Ga0495625_0065064_841_1080 78
315 3300046660 Ga0495625_0077380 Ga0495625_0077380_405_641 78
316 3300046660 Ga0495625_0495580 Ga0495625_0495580_409_645 78
317 3300046684 Ga0495669_0000014 Ga0495669_0000014_136746_136982 78
318 3300046684 Ga0495669_0000222 Ga0495669_0000222_12547_12786 78
319 3300046684 Ga0495669_0062880 Ga0495669_0062880_1086_1322 78
320 3300046684 Ga0495669_0149432 Ga0495669_0149432_793_1029 78
321 3300046691 Ga0495670_0312747 Ga0495670_0312747_224_460 78
322 3300047318 Ga0495636_0078544 Ga0495636_0078544_554_790 78
323 3300047445 Ga0495677_0017610 Ga0495677_0017610_1722_1961 78
324 3300047445 Ga0495677_0021804 Ga0495677_0021804_1467_1703 78
325 3300047445 Ga0495677_0112364 Ga0495677_0112364_706_942 78
326 3300047470 Ga0495681_0088711 Ga0495681_0088711_626_862 78
327 3300047472 Ga0495686_0035838 Ga0495686_0035838_508_744 78
328 3300047472 Ga0495686_0502693 Ga0495686_0502693_75_311 78
329 3300048904 Ga0496101_1623555 Ga0496101_1623555_132_374 78
330 3300048909 Ga0496106_0451977 Ga0496106_0451977_215_463 78
331 3300048915 Ga0496112_0966166 Ga0496112_0966166_506_742 78
332 3300048918 Ga0496115_0404674 Ga0496115_0404674_797_1036 78
333 3300048924 Ga0496121_0551066 Ga0496121_0551066_109_345 78
334 3300049570 Ga0501033_1206272 Ga0501033_1206272_22_258 78
335 3300049583 Ga0501067_0129971 Ga0501067_0129971_176_427 78
336 3300049770 Ga0501273_096557 Ga0501273_096557_235_477 78
337 3300050490 nmdc:mga03n38_28417_c1 nmdc:mga03n38_28417_c1_1262_1498 78
338 3300050491 nmdc:mga00v17_3414_c1 nmdc:mga00v17_3414_c1_1544_1780 78
339 3300050493 nmdc:mga0k408_24716_c1 nmdc:mga0k408_24716_c1_1652_1888 78
340 3300050493 nmdc:mga0k408_58044_c1 nmdc:mga0k408_58044_c1_1963_2205 78
341 3300050494 nmdc:mga06z11_51432_c1 nmdc:mga06z11_51432_c1_1781_2017 78
342 3300050495 nmdc:mga04h51_5466_c1 nmdc:mga04h51_5466_c1_2463_2699 78
343 3300050496 nmdc:mga07m45_32653_c1 nmdc:mga07m45_32653_c1_2352_2588 78
344 3300050496 nmdc:mga07m45_457877_c1 nmdc:mga07m45_457877_c1_205_441 78
345 3300050511 nmdc:mga08y16_945481_c1 nmdc:mga08y16_945481_c1_504_779 78
346 3300050516 nmdc:mga0sz30_73368_c1 nmdc:mga0sz30_73368_c1_62_298 78
347 3300053078 Ga0495612_0138594 Ga0495612_0138594_544_786 78
348 3300053098 Ga0500650_0284190 Ga0500650_0284190_380_619 78
349 3300053108 Ga0500562_047245 Ga0500562_047245_523_762 78
350 3300053119 Ga0500595_018188 Ga0500595_018188_490_726 78
351 3300053119 Ga0500595_051890 Ga0500595_051890_576_815 78
352 3300053119 Ga0500595_169538 Ga0500595_169538_176_412 78
353 3300053133 Ga0500655_030393 Ga0500655_030393_160_399 78
354 3300053140 Ga0500573_0496584 Ga0500573_0496584_288_524 78
355 3300053156 Ga0500622_0010724 Ga0500622_0010724_2640_2876 78
356 3300053156 Ga0500622_0015383 Ga0500622_0015383_2433_2675 78
357 3300002741 JGI25157J39369_1024890 JGI25157J39369_10248902 79
358 3300003794 Ga0055531_10006083 Ga0055531_100060837 79
359 3300003794 Ga0055531_10100001 Ga0055531_101000011 79
360 3300005262 Ga0065165_1001044 Ga0065165_100104429 79
361 3300005262 Ga0065165_1007051 Ga0065165_10070514 79
362 3300005327 Ga0070658_10053138 Ga0070658_100531384 79
363 3300005327 Ga0070658_10793886 Ga0070658_107938861 79
364 3300005327 Ga0070658_10799549 Ga0070658_107995492 79
365 3300005336 Ga0070680_100038033 Ga0070680_1000380334 79
366 3300005339 Ga0070660_100072343 Ga0070660_1000723431 79
367 3300005339 Ga0070660_100233029 Ga0070660_1002330291 79
368 3300005339 Ga0070660_100283553 Ga0070660_1002835533 79
369 3300005341 Ga0070691_10006066 Ga0070691_100060667 79
370 3300005344 Ga0070661_100864505 Ga0070661_1008645051 79
371 3300005366 Ga0070659_100000194 Ga0070659_10000019450 79
372 3300005366 Ga0070659_100032719 Ga0070659_1000327193 79
373 3300005456 Ga0070678_101424909 Ga0070678_1014249091 79
374 3300005458 Ga0070681_10059209 Ga0070681_100592095 79
375 3300005458 Ga0070681_10059441 Ga0070681_100594414 79
376 3300005530 Ga0070679_100096921 Ga0070679_1000969214 79
377 3300005530 Ga0070679_100211985 Ga0070679_1002119854 79
378 3300005535 Ga0070684_101339394 Ga0070684_1013393941 79
379 3300005539 Ga0068853_100032141 Ga0068853_1000321416 79
380 3300005539 Ga0068853_100048356 Ga0068853_1000483564 79
381 3300005539 Ga0068853_100056100 Ga0068853_1000561003 79
382 3300005539 Ga0068853_100506930 Ga0068853_1005069302 79
383 3300005539 Ga0068853_101171813 Ga0068853_1011718132 79
384 3300005548 Ga0070665_100002063 Ga0070665_10000206320 79
385 3300005548 Ga0070665_100907510 Ga0070665_1009075101 79
386 3300005563 Ga0068855_100042938 Ga0068855_1000429386 79
387 3300005563 Ga0068855_100060640 Ga0068855_1000606406 79
388 3300005563 Ga0068855_100687767 Ga0068855_1006877673 79
389 3300005564 Ga0070664_100219279 Ga0070664_1002192795 79
390 3300005577 Ga0068857_101666256 Ga0068857_1016662561 79
391 3300005614 Ga0068856_102303605 Ga0068856_1023036051 79
392 3300005616 Ga0068852_100642958 Ga0068852_1006429583 79
393 3300005618 Ga0068864_102473513 Ga0068864_1024735132 79
394 3300005719 Ga0068861_101180464 Ga0068861_1011804642 79
395 3300005843 Ga0068860_100590148 Ga0068860_1005901483 79
396 3300005844 Ga0068862_100116994 Ga0068862_1001169944 79
397 3300006038 Ga0075365_11013137 Ga0075365_110131371 79
398 3300006048 Ga0075363_100305763 Ga0075363_1003057632 79
399 3300006048 Ga0075363_100347410 Ga0075363_1003474102 79
400 3300006177 Ga0075362_10094624 Ga0075362_100946242 79
401 3300006178 Ga0075367_10916221 Ga0075367_109162212 79
402 3300006237 Ga0097621_102352995 Ga0097621_1023529952 79
403 3300006844 Ga0075428_100573098 Ga0075428_1005730982 79
404 3300009093 Ga0105240_10145877 Ga0105240_101458773 79
405 3300009093 Ga0105240_10572717 Ga0105240_105727172 79
406 3300009148 Ga0105243_12421989 Ga0105243_124219891 79
407 3300009174 Ga0105241_11187202 Ga0105241_111872022 79
408 3300009551 Ga0105238_10722664 Ga0105238_107226642 79
409 3300009551 Ga0105238_10970347 Ga0105238_109703471 79
410 3300009551 Ga0105238_11753142 Ga0105238_117531422 79
411 3300009551 Ga0105238_11809870 Ga0105238_118098701 79
412 3300009553 Ga0105249_10373222 Ga0105249_103732223 79
413 3300009553 Ga0105249_10680527 Ga0105249_106805273 79
414 3300010375 Ga0105239_10254380 Ga0105239_102543802 79
415 3300010375 Ga0105239_12952528 Ga0105239_129525282 79
416 3300013100 Ga0157373_10000756 Ga0157373_100007567 79
417 3300013100 Ga0157373_10000769 Ga0157373_1000076921 79
418 3300013104 Ga0157370_10288805 Ga0157370_102888052 79
419 3300013104 Ga0157370_10302797 Ga0157370_103027973 79
420 3300013105 Ga0157369_11270304 Ga0157369_112703042 79
421 3300013297 Ga0157378_12447330 Ga0157378_124473302 79
422 3300013306 Ga0163162_10380349 Ga0163162_103803492 79
423 3300013307 Ga0157372_11813750 Ga0157372_118137503 79
424 3300013308 Ga0157375_12088204 Ga0157375_120882042 79
425 3300013308 Ga0157375_13509827 Ga0157375_135098272 79
426 3300014325 Ga0163163_10039963 Ga0163163_100399633 79
427 3300014325 Ga0163163_11706918 Ga0163163_117069182 79
428 3300014969 Ga0157376_11354677 Ga0157376_113546772 79
429 3300014969 Ga0157376_11686266 Ga0157376_116862661 79
430 3300021361 Ga0213872_10005118 Ga0213872_100051188 79
431 3300025250 Ga0209026_1001360 Ga0209026_10013609 79
432 3300025250 Ga0209026_1030874 Ga0209026_10308742 79
433 3300025254 Ga0209148_1031715 Ga0209148_10317153 79
434 3300025272 Ga0209455_1028122 Ga0209455_10281222 79
435 3300025297 Ga0209758_1000852 Ga0209758_100085237 79
436 3300025298 Ga0209050_1000053 Ga0209050_1000053204 79
437 3300025304 Ga0209257_1000289 Ga0209257_100028972 79
438 3300025304 Ga0209257_1003375 Ga0209257_10033754 79
439 3300025909 Ga0207705_10003058 Ga0207705_100030586 79
440 3300025909 Ga0207705_10116372 Ga0207705_101163725 79
441 3300025909 Ga0207705_10319527 Ga0207705_103195272 79
442 3300025909 Ga0207705_10697700 Ga0207705_106977002 79
443 3300025912 Ga0207707_10103685 Ga0207707_101036851 79
444 3300025912 Ga0207707_10158906 Ga0207707_101589064 79
445 3300025913 Ga0207695_10006445 Ga0207695_1000644513 79
446 3300025913 Ga0207695_10116653 Ga0207695_101166533 79
447 3300025913 Ga0207695_10398000 Ga0207695_103980001 79
448 3300025917 Ga0207660_10006424 Ga0207660_100064246 79
449 3300025917 Ga0207660_10579556 Ga0207660_105795562 79
450 3300025919 Ga0207657_10023711 Ga0207657_100237113 79
451 3300025919 Ga0207657_10034910 Ga0207657_100349103 79
452 3300025919 Ga0207657_10164152 Ga0207657_101641522 79
453 3300025920 Ga0207649_10314858 Ga0207649_103148582 79
454 3300025921 Ga0207652_10007533 Ga0207652_100075339 79
455 3300025921 Ga0207652_10029023 Ga0207652_100290236 79
456 3300025924 Ga0207694_10129299 Ga0207694_101292993 79
457 3300025924 Ga0207694_10132397 Ga0207694_101323972 79
458 3300025924 Ga0207694_10949787 Ga0207694_109497871 79
459 3300025924 Ga0207694_11001330 Ga0207694_110013302 79
460 3300025924 Ga0207694_11162989 Ga0207694_111629892 79
461 3300025932 Ga0207690_10000142 Ga0207690_1000014240 79
462 3300025932 Ga0207690_10042276 Ga0207690_100422761 79
463 3300025935 Ga0207709_10229421 Ga0207709_102294211 79
464 3300025945 Ga0207679_10126789 Ga0207679_101267894 79
465 3300025949 Ga0207667_10024848 Ga0207667_100248484 79
466 3300025949 Ga0207667_10041397 Ga0207667_100413974 79
467 3300025961 Ga0207712_10553083 Ga0207712_105530832 79
468 3300026041 Ga0207639_10032995 Ga0207639_100329953 79
469 3300026041 Ga0207639_10041338 Ga0207639_100413383 79
470 3300026041 Ga0207639_10116089 Ga0207639_101160894 79
471 3300026041 Ga0207639_11252188 Ga0207639_112521882 79
472 3300026067 Ga0207678_10400338 Ga0207678_104003383 79
473 3300026078 Ga0207702_10490471 Ga0207702_104904712 79
474 3300026078 Ga0207702_10538332 Ga0207702_105383323 79
475 3300026116 Ga0207674_11463402 Ga0207674_114634022 79
476 3300026121 Ga0207683_10343114 Ga0207683_103431143 79
477 3300026142 Ga0207698_10604318 Ga0207698_106043182 79
478 3300028379 Ga0268266_10000003 Ga0268266_100000031353 79
479 3300028379 Ga0268266_10637065 Ga0268266_106370652 79
480 3300028380 Ga0268265_10350263 Ga0268265_103502633 79
481 3300028381 Ga0268264_10768591 Ga0268264_107685912 79
482 3300028381 Ga0268264_11922177 Ga0268264_119221771 79
483 3300028381 Ga0268264_11935062 Ga0268264_119350622 79
484 3300028556 Ga0265337_1024371 Ga0265337_10243713 79
485 3300028786 Ga0307517_10063633 Ga0307517_100636334 79
486 3300031251 Ga0265327_10000442 Ga0265327_1000044217 79
487 3300031456 Ga0307513_10000045 Ga0307513_1000004536 79
488 3300031456 Ga0307513_10280783 Ga0307513_102807832 79
489 3300031456 Ga0307513_10281522 Ga0307513_102815224 79
490 3300031824 Ga0307413_10078837 Ga0307413_100788374 79
491 3300032002 Ga0307416_102100574 Ga0307416_1021005741 79
492 3300032004 Ga0307414_10014394 Ga0307414_100143946 79
493 3300032004 Ga0307414_10170011 Ga0307414_101700113 79
494 3300032004 Ga0307414_10186348 Ga0307414_101863482 79
495 3300032004 Ga0307414_10248688 Ga0307414_102486882 79
496 3300032004 Ga0307414_10292105 Ga0307414_102921051 79
497 3300032004 Ga0307414_10405971 Ga0307414_104059713 79
498 3300032004 Ga0307414_10464012 Ga0307414_104640122 79
499 3300032004 Ga0307414_10562745 Ga0307414_105627451 79
500 3300033180 Ga0307510_10020409 Ga0307510_100204094 79
501 3300035089 Ga0373944_0027524 Ga0373944_0027524_1087_1329 79
502 3300035116 Ga0373945_0270158 Ga0373945_0270158_348_590 79
503 3300035170 Ga0373943_0285502 Ga0373943_0285502_587_829 79
504 3300035725 Ga0373947_0409026 Ga0373947_0409026_399_641 79
505 3300037068 Ga0373925_0000199 Ga0373925_0000199_37310_37552 79
506 3300037471 Ga0395905_0992285 Ga0395905_0992285_72_311 79
507 3300038443 Ga0395901_1439020 Ga0395901_1439020_158_421 79
508 3300039447 Ga0436361_0030985 Ga0436361_0030985_16405_16644 79
509 3300041451 Ga0451791_1146831 Ga0451791_1146831_207_449 79
510 3300041452 Ga0451793_0618349 Ga0451793_0618349_60_302 79
511 3300041459 Ga0451800_1434722 Ga0451800_1434722_179_418 79
512 3300041511 Ga0451855_1752724 Ga0451855_1752724_175_414 79
513 3300044684 Ga0466966_0493769 Ga0466966_0493769_407_655 79
514 3300044693 Ga0466961_0090099 Ga0466961_0090099_1171_1419 79
515 3300046531 Ga0495665_0344269 Ga0495665_0344269_93_335 79
516 3300046542 Ga0495597_0238523 Ga0495597_0238523_344_586 79
517 3300046616 Ga0495668_0040226 Ga0495668_0040226_672_914 79
518 3300046660 Ga0495625_0152098 Ga0495625_0152098_291_533 79
519 3300047320 Ga0495672_0420897 Ga0495672_0420897_303_545 79
520 3300047472 Ga0495686_0037836 Ga0495686_0037836_2087_2329 79
521 3300047472 Ga0495686_0138920 Ga0495686_0138920_908_1150 79
522 3300047472 Ga0495686_0332668 Ga0495686_0332668_62_301 79
523 3300048903 Ga0496100_0629196 Ga0496100_0629196_112_354 79
524 3300048918 Ga0496115_0036869 Ga0496115_0036869_576_818 79
525 3300048918 Ga0496115_0037132 Ga0496115_0037132_3034_3276 79
526 3300048918 Ga0496115_0104288 Ga0496115_0104288_882_1121 79
527 3300050489 nmdc:mga03683_140170_c1 nmdc:mga03683_140170_c1_57_296 79
528 3300050490 nmdc:mga03n38_297937_c1 nmdc:mga03n38_297937_c1_227_466 79
529 3300053096 Ga0500641_0109535 Ga0500641_0109535_874_1113 79
530 3300053130 Ga0500642_0169671 Ga0500642_0169671_171_410 79
531 3300053140 Ga0500573_0334719 Ga0500573_0334719_391_630 79
532 3300053730 Ga0500645_006258 Ga0500645_006258_1875_2117 79
533 3300053732 Ga0500656_014429 Ga0500656_014429_540_782 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pxp-assembly1.cif.gz_A crystal structure of a pas and dna binding domain containing protein (caur_2278) from chloroflexus aurantiacus j-10-fl at 2.30 a resolution 0.9474 16 56
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9274 8 60
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.924 8 60
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9219 5 66
2cro-assembly1.cif.gz_A structure of phage 434 cro protein at 2.35 angstroms resolution 0.9214 6 59
ID Description Score Start End Superfamily
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.931 6 59 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9274 8 60 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.924 8 60 1.10.260.40
1b0nA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9198 8 61 1.10.260.40
1perR00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9146 8 59 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7X6U6X3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.99 3 66 GO:0003677
AF-A0A848QUX9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9895 3 66 GO:0003677
AF-A0A7Z0BWH4-F1-model_v4 Putative transcriptional regulator 0.9886 3 66 GO:0003677
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9859 3 65 GO:0003677
AF-A0A0N1B190-F1-model_v4 Cro/Cl family transcriptional regulator 0.9846 3 66 GO:0003677

Feature Viewer

pLDDT pTM Quality
80.63 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map