F460437

General Info

Members Datasets Scaffolds Average Seq Length
533 235 1066 239

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0046426|Ga0395900_0046426_2547_3326
Length 259
Sequence LDVLSLFIVVSFGQMIYIQPMPFYPYSIFPLGDTALIIDFGNRIDKDINENVLRLFYQLKEAAHPFIIDLIPAYSSLAVYYDVCAVHQKKTEDQTAFEAMVEVVEKLWNHEQELSLQPSRLIEIPVCYAAPFATDIQCIAEQKSIAVEEIIHLHTSRTYKVYMIGFLPGFSYMGEVDERIAVPRKPQPQNVQAGAVGIAGTQTGIYPLDSPGGWQIIGRTPLKLFDKEREQPVLLQPGDEIQFYSITEDEFTRYQARRS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
163 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
164 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
210 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
233 2738541278 Niastella sp. CF465 Isolate Unclassified
234 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
235 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 1.31
Rhizosphere 92.87
Stem 0
Stem Tuber 0
Unclassified 23.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0046426 3300037418 Bacteria 4473
2 SwRhRL2b_contig_695697 2162886007 Bacteria 1255
3 JGI24743J22301_10006696 3300001991 Bacteria 1974
4 rootH2_10062486 3300003320 Bacteria 9843
5 rootL2_10233092 3300003322 Bacteria 1640
6 rootH1_10017103 3300003323 Bacteria 28716
7 Ga0065704_10099872 3300005289 Unclassified 2294
8 Ga0065712_10156944 3300005290 Bacteria 1328
9 Ga0065715_10179522 3300005293 Bacteria 1478
10 Ga0065707_10281485 3300005295 Unclassified 1046
11 Ga0070676_10001998 3300005328 Bacteria 10370
12 Ga0070676_10002273 3300005328 Bacteria 9809
13 Ga0070676_10327466 3300005328 Unclassified 1047
14 Ga0070683_100001393 3300005329 Bacteria 18553
15 Ga0070683_100015634 3300005329 Bacteria 6671
16 Ga0070683_100033459 3300005329 Bacteria 4688
17 Ga0070683_100138769 3300005329 Bacteria 2303
18 Ga0070683_100796871 3300005329 Unclassified 906
19 Ga0070690_100019989 3300005330 Bacteria 4076
20 Ga0070690_100146647 3300005330 Bacteria 1606
21 Ga0070690_100158926 3300005330 Bacteria 1547
22 Ga0070670_100079936 3300005331 Unclassified 2810
23 Ga0070670_100083196 3300005331 Unclassified 2750
24 Ga0070670_100086658 3300005331 Bacteria 2691
25 Ga0070670_100105026 3300005331 Unclassified 2433
26 Ga0070670_100170778 3300005331 Unclassified 1886
27 Ga0070670_100434158 3300005331 Bacteria 1162
28 Ga0070670_100499309 3300005331 Bacteria 1082
29 Ga0070677_10016696 3300005333 Unclassified 2617
30 Ga0068869_100001381 3300005334 Bacteria 14366
31 Ga0068869_100021050 3300005334 Bacteria 4483
32 Ga0068869_100030784 3300005334 Bacteria 3770
33 Ga0068869_100044864 3300005334 Unclassified 3180
34 Ga0068869_100097131 3300005334 Bacteria 2224
35 Ga0068869_100227217 3300005334 Bacteria 1482
36 Ga0068869_100258357 3300005334 Bacteria 1394
37 Ga0070666_10024795 3300005335 Bacteria 3910
38 Ga0070666_10031434 3300005335 Unclassified 3505
39 Ga0070666_10102182 3300005335 Unclassified 1977
40 Ga0068868_100003353 3300005338 Bacteria 11144
41 Ga0068868_100004611 3300005338 Bacteria 9667
42 Ga0068868_100131126 3300005338 Bacteria 2051
43 Ga0070660_100431485 3300005339 Bacteria 1092
44 Ga0070689_100038560 3300005340 Unclassified 3656
45 Ga0070689_100088515 3300005340 Bacteria 2437
46 Ga0070689_100247926 3300005340 Bacteria 1469
47 Ga0070687_100185248 3300005343 Bacteria 1250
48 Ga0070661_100000700 3300005344 Bacteria 24597
49 Ga0070661_100007311 3300005344 Bacteria 7617
50 Ga0070661_100092540 3300005344 Bacteria 2240
51 Ga0070661_100133232 3300005344 Bacteria 1868
52 Ga0070661_100309388 3300005344 Unclassified 1231
53 Ga0070661_100393140 3300005344 Unclassified 1095
54 Ga0070668_100008643 3300005347 Bacteria 7561
55 Ga0070668_100029285 3300005347 Bacteria 4181
56 Ga0070668_100225922 3300005347 Bacteria 1546
57 Ga0070668_100677757 3300005347 Bacteria 908
58 Ga0070669_100128148 3300005353 Bacteria 1944
59 Ga0070675_100026344 3300005354 Unclassified 4666
60 Ga0070675_100052656 3300005354 Bacteria 3347
61 Ga0070675_100089545 3300005354 Bacteria 2577
62 Ga0070675_100182146 3300005354 Bacteria 1817
63 Ga0070675_100288401 3300005354 Unclassified 1444
64 Ga0070675_100419633 3300005354 Unclassified 1196
65 Ga0070671_100116167 3300005355 Unclassified 2250
66 Ga0070671_100121336 3300005355 Unclassified 2200
67 Ga0070671_100147311 3300005355 Unclassified 1987
68 Ga0070671_100352705 3300005355 Bacteria 1256
69 Ga0070671_100395060 3300005355 Unclassified 1182
70 Ga0070674_100009129 3300005356 Bacteria 5931
71 Ga0070674_100246822 3300005356 Unclassified 1400
72 Ga0070674_100383687 3300005356 Unclassified 1144
73 Ga0070673_100033475 3300005364 Bacteria 3881
74 Ga0070673_100040116 3300005364 Bacteria 3589
75 Ga0070673_100074409 3300005364 Bacteria 2737
76 Ga0070673_100496818 3300005364 Bacteria 1103
77 Ga0070673_100888592 3300005364 Bacteria 826
78 Ga0070688_100452423 3300005365 Unclassified 960
79 Ga0070659_100009106 3300005366 Bacteria 7281
80 Ga0070659_100009502 3300005366 Bacteria 7145
81 Ga0070659_100244506 3300005366 Unclassified 1486
82 Ga0070667_100024301 3300005367 Bacteria 5033
83 Ga0070667_100454023 3300005367 Unclassified 1171
84 Ga0070667_100768363 3300005367 Bacteria 894
85 Ga0070701_10091243 3300005438 Bacteria 1669
86 Ga0070678_100008731 3300005456 Bacteria 6087
87 Ga0070678_100068455 3300005456 Bacteria 2646
88 Ga0070678_100184257 3300005456 Bacteria 1712
89 Ga0070662_100023633 3300005457 Bacteria 4224
90 Ga0070662_100030379 3300005457 Bacteria 3780
91 Ga0070662_100064055 3300005457 Bacteria 2691
92 Ga0070662_100100346 3300005457 Bacteria 2190
93 Ga0068867_100027376 3300005459 Bacteria 4096
94 Ga0068867_100094517 3300005459 Unclassified 2273
95 Ga0068867_100103918 3300005459 Unclassified 2173
96 Ga0068867_100104601 3300005459 Unclassified 2167
97 Ga0068867_100600555 3300005459 Bacteria 960
98 Ga0070685_10048199 3300005466 Unclassified 2453
99 Ga0070698_100000850 3300005471 Bacteria 33482
100 Ga0070698_100381596 3300005471 Bacteria 1342
101 Ga0070699_100021187 3300005518 Bacteria 5604
102 Ga0070684_100001259 3300005535 Bacteria 18156
103 Ga0070684_100002311 3300005535 Bacteria 14052
104 Ga0070684_100113239 3300005535 Bacteria 2434
105 Ga0068853_100000395 3300005539 Bacteria 29784
106 Ga0068853_100039985 3300005539 Bacteria 4000
107 Ga0068853_100044279 3300005539 Unclassified 3810
108 Ga0068853_100063444 3300005539 Bacteria 3200
109 Ga0070672_100036166 3300005543 Unclassified 3761
110 Ga0070672_100068671 3300005543 Bacteria 2811
111 Ga0070672_100130185 3300005543 Bacteria 2067
112 Ga0070672_100173565 3300005543 Unclassified 1794
113 Ga0070672_100230475 3300005543 Unclassified 1556
114 Ga0070672_100256269 3300005543 Unclassified 1474
115 Ga0070672_100367570 3300005543 Bacteria 1228
116 Ga0070686_100030901 3300005544 Unclassified 3271
117 Ga0070686_100074613 3300005544 Bacteria 2229
118 Ga0070665_100084739 3300005548 Unclassified 3174
119 Ga0070665_100146658 3300005548 Unclassified 2363
120 Ga0070704_100410221 3300005549 Bacteria 1158
121 Ga0068855_100007582 3300005563 Bacteria 13129
122 Ga0068855_100192462 3300005563 Bacteria 2300
123 Ga0070664_100005564 3300005564 Bacteria 10120
124 Ga0070664_100011076 3300005564 Bacteria 7313
125 Ga0070664_100017550 3300005564 Bacteria 5878
126 Ga0070664_100040027 3300005564 Unclassified 3951
127 Ga0070664_100074704 3300005564 Bacteria 2909
128 Ga0070664_100174531 3300005564 Bacteria 1908
129 Ga0070664_100203799 3300005564 Bacteria 1766
130 Ga0068857_100003941 3300005577 Bacteria 12494
131 Ga0068857_100017630 3300005577 Bacteria 6261
132 Ga0068854_100038467 3300005578 Unclassified 3365
133 Ga0068854_100348360 3300005578 Bacteria 1211
134 Ga0068856_100043579 3300005614 Bacteria 4415
135 Ga0068852_100005703 3300005616 Bacteria 8931
136 Ga0068852_100371922 3300005616 Unclassified 1400
137 Ga0068852_100739999 3300005616 Unclassified 995
138 Ga0068859_100013961 3300005617 Bacteria 8056
139 Ga0068859_100016987 3300005617 Bacteria 7305
140 Ga0068859_100024704 3300005617 Bacteria 6030
141 Ga0068859_100038428 3300005617 Bacteria 4803
142 Ga0068859_100379245 3300005617 Bacteria 1509
143 Ga0068864_100026128 3300005618 Bacteria 4922
144 Ga0068864_100050177 3300005618 Bacteria 3591
145 Ga0068864_100168575 3300005618 Bacteria 1995
146 Ga0068864_100234359 3300005618 Bacteria 1699
147 Ga0068864_100632543 3300005618 Bacteria 1041
148 Ga0068866_10007007 3300005718 Bacteria 4711
149 Ga0068866_10037098 3300005718 Unclassified 2392
150 Ga0068861_100016245 3300005719 Bacteria 5262
151 Ga0068861_100052469 3300005719 Bacteria 3099
152 Ga0068861_100317597 3300005719 Bacteria 1355
153 Ga0068851_10047518 3300005834 Bacteria 2174
154 Ga0068851_10051608 3300005834 Unclassified 2090
155 Ga0068870_10005159 3300005840 Bacteria 5685
156 Ga0068870_10185192 3300005840 Unclassified 1253
157 Ga0068870_10192635 3300005840 Bacteria 1231
158 Ga0068863_100024490 3300005841 Bacteria 5756
159 Ga0068863_100167980 3300005841 Bacteria 2104
160 Ga0068863_100268365 3300005841 Bacteria 1651
161 Ga0068858_100361689 3300005842 Bacteria 1391
162 Ga0068858_100721794 3300005842 Unclassified 970
163 Ga0068860_100053218 3300005843 Bacteria 3850
164 Ga0068860_100396691 3300005843 Bacteria 1364
165 Ga0068860_100476883 3300005843 Bacteria 1243
166 Ga0068862_100692009 3300005844 Bacteria 987
167 Ga0081455_10255076 3300005937 Bacteria 1280
168 Ga0070715_10087163 3300006163 Bacteria 1429
169 Ga0075366_10041904 3300006195 Bacteria 2711
170 Ga0075366_10059432 3300006195 Bacteria 2271
171 Ga0075366_10191246 3300006195 Unclassified 1244
172 Ga0097621_100008757 3300006237 Bacteria 7310
173 Ga0097621_100112122 3300006237 Bacteria 2305
174 Ga0097621_100115982 3300006237 Bacteria 2267
175 Ga0097621_100134164 3300006237 Unclassified 2110
176 Ga0068871_100007800 3300006358 Bacteria 7664
177 Ga0068871_100026146 3300006358 Bacteria 4551
178 Ga0068871_100217493 3300006358 Bacteria 1654
179 Ga0068871_100956514 3300006358 Unclassified 796
180 Ga0075428_100006044 3300006844 Bacteria 13447
181 Ga0075428_100139614 3300006844 Bacteria 2634
182 Ga0075430_100003052 3300006846 Bacteria 14002
183 Ga0075430_100038623 3300006846 Bacteria 4043
184 Ga0075431_100006268 3300006847 Bacteria 11815
185 Ga0075434_100004332 3300006871 Bacteria 12765
186 Ga0075429_100022294 3300006880 Bacteria 5493
187 Ga0075429_100716347 3300006880 Bacteria 876
188 Ga0068865_100016453 3300006881 Unclassified 4733
189 Ga0097620_100013961 3300006931 Bacteria 8056
190 Ga0097620_100016985 3300006931 Bacteria 7305
191 Ga0097620_100024706 3300006931 Bacteria 6030
192 Ga0097620_100038428 3300006931 Bacteria 4803
193 Ga0097620_100379230 3300006931 Bacteria 1509
194 Ga0105240_10151649 3300009093 Bacteria 2760
195 Ga0111539_10534473 3300009094 Unclassified 1366
196 Ga0111539_11125414 3300009094 Unclassified 912
197 Ga0105247_10000408 3300009101 Bacteria 36396
198 Ga0114129_10114584 3300009147 Bacteria 3717
199 Ga0114129_10208202 3300009147 Bacteria 2646
200 Ga0105243_10278937 3300009148 Bacteria 1504
201 Ga0105243_10503081 3300009148 Unclassified 1148
202 Ga0105241_10052115 3300009174 Unclassified 3123
203 Ga0105241_10086578 3300009174 Bacteria 2464
204 Ga0105241_10169827 3300009174 Bacteria 1800
205 Ga0105241_10345537 3300009174 Bacteria 1290
206 Ga0105242_10025677 3300009176 Bacteria 4664
207 Ga0105242_10036758 3300009176 Bacteria 3930
208 Ga0105242_10125704 3300009176 Bacteria 2207
209 Ga0105242_10187126 3300009176 Bacteria 1830
210 Ga0105248_10057123 3300009177 Unclassified 4380
211 Ga0105248_10414162 3300009177 Bacteria 1517
212 Ga0105237_10125637 3300009545 Bacteria 2559
213 Ga0105249_10004239 3300009553 Bacteria 12401
214 Ga0105249_10014866 3300009553 Bacteria 6884
215 Ga0105249_10041255 3300009553 Bacteria 4195
216 Ga0105249_10628144 3300009553 Bacteria 1130
217 Ga0105249_10917258 3300009553 Bacteria 943
218 Ga0105239_10047696 3300010375 Bacteria 4694
219 Ga0105239_10135830 3300010375 Bacteria 2738
220 Ga0105239_10685135 3300010375 Bacteria 1172
221 Ga0105246_10029461 3300011119 Bacteria 3616
222 Ga0105246_10104692 3300011119 Bacteria 2067
223 Ga0157373_10042809 3300013100 Bacteria 3235
224 Ga0157371_10222372 3300013102 Unclassified 1356
225 Ga0157371_10349727 3300013102 Bacteria 1076
226 Ga0157371_10436637 3300013102 Bacteria 961
227 Ga0157374_10001463 3300013296 Bacteria 19961
228 Ga0157374_10061170 3300013296 Unclassified 3526
229 Ga0157374_10079534 3300013296 Bacteria 3107
230 Ga0157374_10094509 3300013296 Bacteria 2857
231 Ga0157374_10191443 3300013296 Bacteria 2001
232 Ga0157374_10230186 3300013296 Bacteria 1820
233 Ga0157374_10808992 3300013296 Bacteria 953
234 Ga0157378_10044156 3300013297 Bacteria 3957
235 Ga0157378_10221232 3300013297 Bacteria 1800
236 Ga0157378_10623501 3300013297 Bacteria 1092
237 Ga0163162_10009462 3300013306 Bacteria 9474
238 Ga0163162_10042818 3300013306 Unclassified 4533
239 Ga0163162_10057279 3300013306 Bacteria 3925
240 Ga0163162_10370658 3300013306 Bacteria 1565
241 Ga0163162_11305482 3300013306 Unclassified 824
242 Ga0157372_10067733 3300013307 Bacteria 4012
243 Ga0157372_10299740 3300013307 Unclassified 1870
244 Ga0157372_10300404 3300013307 Unclassified 1867
245 Ga0157372_10601863 3300013307 Bacteria 1281
246 Ga0157375_10016593 3300013308 Bacteria 6622
247 Ga0157375_10090861 3300013308 Bacteria 3113
248 Ga0157375_10096531 3300013308 Unclassified 3029
249 Ga0157375_10132746 3300013308 Bacteria 2611
250 Ga0157375_10231120 3300013308 Unclassified 2008
251 Ga0157375_10244191 3300013308 Bacteria 1955
252 Ga0157375_10463541 3300013308 Unclassified 1432
253 Ga0157375_10712308 3300013308 Bacteria 1157
254 Ga0163163_10000343 3300014325 Bacteria 44866
255 Ga0163163_10092101 3300014325 Unclassified 3046
256 Ga0157380_10111403 3300014326 Bacteria 2300
257 Ga0157380_10209689 3300014326 Unclassified 1735
258 Ga0157380_10799217 3300014326 Bacteria 960
259 Ga0157377_10001764 3300014745 Bacteria 9426
260 Ga0157377_10032743 3300014745 Bacteria 2833
261 Ga0157377_10043884 3300014745 Bacteria 2491
262 Ga0157377_10364800 3300014745 Bacteria 973
263 Ga0157379_10038921 3300014968 Unclassified 4242
264 Ga0157379_10087295 3300014968 Unclassified 2797
265 Ga0157379_10256747 3300014968 Bacteria 1587
266 Ga0157379_10580526 3300014968 Unclassified 1045
267 Ga0157376_10140810 3300014969 Unclassified 2164
268 Ga0157376_10174121 3300014969 Bacteria 1962
269 Ga0182005_1073485 3300015265 Bacteria 940
270 Ga0163161_10515625 3300017792 Bacteria 976
271 Ga0209258_110346 3300025242 Bacteria 1215
272 Ga0209646_1005966 3300025246 Bacteria 2078
273 Ga0207656_10025952 3300025321 Bacteria 2384
274 Ga0207656_10138651 3300025321 Bacteria 1145
275 Ga0207656_10164156 3300025321 Unclassified 1058
276 Ga0207642_10027677 3300025899 Unclassified 2323
277 Ga0207710_10003686 3300025900 Bacteria 6791
278 Ga0207688_10018716 3300025901 Bacteria 3766
279 Ga0207680_10143802 3300025903 Bacteria 1584
280 Ga0207680_10149608 3300025903 Unclassified 1555
281 Ga0207647_10000358 3300025904 Bacteria 37132
282 Ga0207647_10153607 3300025904 Unclassified 1345
283 Ga0207647_10230731 3300025904 Bacteria 1065
284 Ga0207645_10000748 3300025907 Bacteria 27039
285 Ga0207645_10018693 3300025907 Bacteria 4551
286 Ga0207645_10068359 3300025907 Unclassified 2272
287 Ga0207645_10162270 3300025907 Unclassified 1462
288 Ga0207643_10003520 3300025908 Bacteria 8423
289 Ga0207643_10016684 3300025908 Bacteria 4005
290 Ga0207654_10129413 3300025911 Bacteria 1596
291 Ga0207671_10548174 3300025914 Bacteria 922
292 Ga0207662_10044009 3300025918 Bacteria 2635
293 Ga0207662_10216932 3300025918 Bacteria 1244
294 Ga0207657_10116534 3300025919 Bacteria 2201
295 Ga0207649_10001123 3300025920 Bacteria 16235
296 Ga0207649_10029432 3300025920 Unclassified 3243
297 Ga0207649_10085396 3300025920 Unclassified 2054
298 Ga0207649_10153594 3300025920 Bacteria 1588
299 Ga0207649_10277974 3300025920 Bacteria 1216
300 Ga0207681_10015202 3300025923 Bacteria 4799
301 Ga0207681_10044196 3300025923 Bacteria 2985
302 Ga0207681_10057984 3300025923 Bacteria 2649
303 Ga0207650_10095373 3300025925 Unclassified 2280
304 Ga0207650_10433433 3300025925 Bacteria 1092
305 Ga0207659_10009012 3300025926 Bacteria 6222
306 Ga0207659_10059684 3300025926 Unclassified 2743
307 Ga0207659_10061051 3300025926 Unclassified 2716
308 Ga0207659_10096389 3300025926 Unclassified 2220
309 Ga0207659_10668017 3300025926 Bacteria 889
310 Ga0207644_10067295 3300025931 Bacteria 2611
311 Ga0207644_10085031 3300025931 Unclassified 2346
312 Ga0207644_10139061 3300025931 Bacteria 1868
313 Ga0207644_10332368 3300025931 Bacteria 1231
314 Ga0207690_10003439 3300025932 Bacteria 9449
315 Ga0207690_10021010 3300025932 Bacteria 4043
316 Ga0207706_10023769 3300025933 Bacteria 5499
317 Ga0207706_10041996 3300025933 Unclassified 4052
318 Ga0207706_10047636 3300025933 Bacteria 3792
319 Ga0207706_10102504 3300025933 Bacteria 2518
320 Ga0207706_10105060 3300025933 Bacteria 2485
321 Ga0207686_10008363 3300025934 Bacteria 5586
322 Ga0207670_10025416 3300025936 Bacteria 3717
323 Ga0207670_10037891 3300025936 Unclassified 3145
324 Ga0207670_10366263 3300025936 Bacteria 1145
325 Ga0207669_10024891 3300025937 Unclassified 3225
326 Ga0207669_10069936 3300025937 Unclassified 2198
327 Ga0207704_10102975 3300025938 Unclassified 1908
328 Ga0207691_10002072 3300025940 Bacteria 19564
329 Ga0207691_10055044 3300025940 Unclassified 3627
330 Ga0207691_10082070 3300025940 Bacteria 2897
331 Ga0207691_10084065 3300025940 Bacteria 2857
332 Ga0207691_10186178 3300025940 Unclassified 1812
333 Ga0207691_10596634 3300025940 Bacteria 935
334 Ga0207711_10206509 3300025941 Bacteria 1794
335 Ga0207689_10000628 3300025942 Bacteria 33617
336 Ga0207689_10001062 3300025942 Bacteria 26443
337 Ga0207689_10001418 3300025942 Bacteria 22893
338 Ga0207689_10011584 3300025942 Bacteria 7555
339 Ga0207689_10068850 3300025942 Bacteria 2908
340 Ga0207689_10114339 3300025942 Bacteria 2218
341 Ga0207689_10746331 3300025942 Bacteria 826
342 Ga0207661_10001802 3300025944 Bacteria 14637
343 Ga0207661_10154680 3300025944 Bacteria 1985
344 Ga0207661_10348929 3300025944 Bacteria 1335
345 Ga0207679_10000768 3300025945 Bacteria 21047
346 Ga0207679_10008459 3300025945 Bacteria 6553
347 Ga0207679_10028829 3300025945 Bacteria 3858
348 Ga0207679_10038248 3300025945 Bacteria 3417
349 Ga0207679_10163867 3300025945 Bacteria 1823
350 Ga0207667_10008843 3300025949 Bacteria 11920
351 Ga0207651_10054640 3300025960 Unclassified 2738
352 Ga0207651_10104938 3300025960 Bacteria 2106
353 Ga0207651_10260363 3300025960 Bacteria 1424
354 Ga0207651_10837644 3300025960 Unclassified 817
355 Ga0207712_10001226 3300025961 Bacteria 17716
356 Ga0207712_10011611 3300025961 Bacteria 5616
357 Ga0207712_10081451 3300025961 Bacteria 2357
358 Ga0207712_10088962 3300025961 Bacteria 2269
359 Ga0207712_10113822 3300025961 Unclassified 2034
360 Ga0207712_10227441 3300025961 Unclassified 1495
361 Ga0207668_10267838 3300025972 Bacteria 1395
362 Ga0207668_10273020 3300025972 Bacteria 1383
363 Ga0207640_10058074 3300025981 Unclassified 2548
364 Ga0207640_10145138 3300025981 Bacteria 1735
365 Ga0207658_10188079 3300025986 Bacteria 1714
366 Ga0207658_10414819 3300025986 Unclassified 1186
367 Ga0207677_10016754 3300026023 Bacteria 4350
368 Ga0207677_10132415 3300026023 Bacteria 1896
369 Ga0207677_10223760 3300026023 Bacteria 1511
370 Ga0207703_10033475 3300026035 Bacteria 4074
371 Ga0207703_10050397 3300026035 Unclassified 3370
372 Ga0207703_10087622 3300026035 Unclassified 2611
373 Ga0207703_10775643 3300026035 Unclassified 914
374 Ga0207639_10000365 3300026041 Bacteria 31332
375 Ga0207639_10017270 3300026041 Bacteria 5115
376 Ga0207639_10392417 3300026041 Unclassified 1249
377 Ga0207641_10011229 3300026088 Bacteria 7347
378 Ga0207641_10115974 3300026088 Bacteria 2382
379 Ga0207641_10286152 3300026088 Unclassified 1552
380 Ga0207641_10853236 3300026088 Unclassified 903
381 Ga0207648_10000372 3300026089 Bacteria 49262
382 Ga0207648_10002066 3300026089 Bacteria 21890
383 Ga0207648_10025791 3300026089 Bacteria 5231
384 Ga0207648_10093426 3300026089 Unclassified 2630
385 Ga0207648_10109044 3300026089 Bacteria 2430
386 Ga0207648_10163357 3300026089 Bacteria 1967
387 Ga0207648_10358848 3300026089 Bacteria 1315
388 Ga0207648_10600649 3300026089 Bacteria 1014
389 Ga0207676_10009647 3300026095 Bacteria 6869
390 Ga0207676_10024603 3300026095 Bacteria 4458
391 Ga0207676_10046670 3300026095 Bacteria 3353
392 Ga0207676_10069042 3300026095 Bacteria 2829
393 Ga0207676_10087429 3300026095 Bacteria 2549
394 Ga0207676_10219177 3300026095 Bacteria 1693
395 Ga0207676_10358972 3300026095 Bacteria 1350
396 Ga0207676_10446017 3300026095 Bacteria 1219
397 Ga0207674_10005900 3300026116 Bacteria 14502
398 Ga0207674_10018901 3300026116 Bacteria 7472
399 Ga0207674_10060652 3300026116 Bacteria 3824
400 Ga0207674_10110778 3300026116 Unclassified 2720
401 Ga0207674_10549100 3300026116 Bacteria 1116
402 Ga0207675_100005048 3300026118 Bacteria 12708
403 Ga0207675_100019278 3300026118 Bacteria 6363
404 Ga0207675_100038027 3300026118 Unclassified 4491
405 Ga0207675_100073698 3300026118 Bacteria 3194
406 Ga0207675_100129619 3300026118 Unclassified 2391
407 Ga0207675_100257042 3300026118 Unclassified 1692
408 Ga0207675_100369912 3300026118 Bacteria 1408
409 Ga0207675_100700771 3300026118 Unclassified 1021
410 Ga0207683_10001617 3300026121 Bacteria 20205
411 Ga0207683_10020692 3300026121 Bacteria 5629
412 Ga0207683_10457081 3300026121 Bacteria 1177
413 Ga0207698_10008087 3300026142 Bacteria 6632
414 Ga0207698_10515604 3300026142 Unclassified 1166
415 Ga0268266_10076916 3300028379 Unclassified 2901
416 Ga0268266_10182107 3300028379 Bacteria 1913
417 Ga0268265_10106006 3300028380 Bacteria 2282
418 Ga0268264_10039936 3300028381 Bacteria 3877
419 Ga0268264_10059527 3300028381 Bacteria 3200
420 Ga0268264_10126506 3300028381 Unclassified 2259
421 Ga0268264_10434563 3300028381 Unclassified 1268
422 Ga0268264_10775482 3300028381 Bacteria 957
423 Ga0307408_100072423 3300031548 Bacteria 2551
424 Ga0307413_10890413 3300031824 Bacteria 755
425 Ga0307410_10125596 3300031852 Bacteria 1878
426 Ga0307407_10000015 3300031903 Bacteria 143258
427 Ga0307412_10357260 3300031911 Bacteria 1175
428 Ga0307412_10366404 3300031911 Unclassified 1162
429 Ga0307409_100063064 3300031995 Bacteria 2905
430 Ga0307409_100096643 3300031995 Bacteria 2438
431 Ga0307409_100217534 3300031995 Bacteria 1722
432 Ga0307409_100304142 3300031995 Bacteria 1485
433 Ga0307416_100000025 3300032002 Bacteria 178154
434 Ga0307416_100484601 3300032002 Unclassified 1297
435 Ga0307414_10030769 3300032004 Bacteria 3511
436 Ga0307411_10042295 3300032005 Bacteria 2906
437 Ga0373925_0098701 3300037068 Bacteria 2242
438 Ga0395899_0058514 3300037312 Bacteria 2842
439 Ga0395898_0710399 3300037466 Bacteria 947
440 Ga0395905_0003070 3300037471 Bacteria 18074
441 Ga0395905_0366471 3300037471 Unclassified 1334
442 Ga0395901_0184561 3300038443 Unclassified 2188
443 Ga0400483_117562 3300039062 Bacteria 5354
444 Ga0439436_0061158 3300041404 Bacteria 1054
445 Ga0451795_0537227 3300041456 Bacteria 1030
446 Ga0451802_1474618 3300041460 Bacteria 1198
447 Ga0451802_1485821 3300041460 Bacteria 2010
448 Ga0451853_1980307 3300041512 Bacteria 1063
449 Ga0439449_0078116 3300042007 Bacteria 1220
450 Ga0439457_001854 3300042014 Bacteria 6236
451 Ga0451577_0064013 3300042876 Bacteria 3280
452 Ga0451577_0413685 3300042876 Bacteria 1224
453 Ga0466969_0000033 3300044656 Bacteria 82227
454 Ga0466972_0000091 3300044658 Bacteria 81829
455 Ga0466972_0177125 3300044658 Unclassified 1000
456 Ga0453683_0263933 3300044673 Bacteria 1099
457 Ga0466966_0000170 3300044684 Bacteria 42809
458 Ga0466961_0147229 3300044693 Bacteria 1472
459 Ga0453684_0020010 3300044712 Bacteria 10139
460 Ga0453684_0457413 3300044712 Bacteria 1420
461 Ga0466957_0003977 3300044842 Bacteria 8171
462 Ga0466957_0087354 3300044842 Bacteria 1950
463 Ga0466959_0000089 3300045049 Bacteria 57482
464 Ga0451576_0143177 3300045051 Bacteria 2493
465 Ga0495650_0032493 3300046471 Bacteria 2333
466 Ga0495664_0128775 3300046477 Bacteria 1532
467 Ga0495628_0292934 3300046516 Bacteria 1206
468 Ga0495632_0116727 3300046519 Bacteria 1249
469 Ga0495632_0152043 3300046519 Bacteria 1070
470 Ga0495586_0097871 3300046535 Bacteria 1626
471 Ga0495645_0146378 3300046543 Bacteria 1645
472 Ga0495667_0255973 3300046559 Unclassified 1114
473 Ga0495668_0008352 3300046616 Bacteria 6481
474 Ga0495635_0042216 3300046663 Bacteria 3150
475 Ga0495588_0114353 3300046674 Bacteria 1422
476 Ga0495646_0193469 3300046680 Bacteria 1111
477 Ga0495600_0083908 3300046809 Bacteria 2079
478 Ga0495604_0348945 3300047317 Bacteria 984
479 Ga0495636_0071239 3300047318 Bacteria 1484
480 Ga0495672_0012491 3300047320 Bacteria 5924
481 Ga0495672_0022694 3300047320 Bacteria 4075
482 Ga0495675_0085726 3300047444 Bacteria 1980
483 Ga0495675_0200910 3300047444 Bacteria 1213
484 Ga0496108_0176619 3300048911 Bacteria 1849
485 Ga0496110_0049203 3300048913 Unclassified 3697
486 Ga0496111_0363127 3300048914 Bacteria 1072
487 Ga0496112_0403227 3300048915 Bacteria 1307
488 Ga0501034_0374204 3300049571 Bacteria 1350
489 Ga0501037_0388596 3300049573 Bacteria 958
490 Ga0501047_0019608 3300049581 Bacteria 6490
491 Ga0501047_0041584 3300049581 Bacteria 4441
492 Ga0501048_0435444 3300049582 Bacteria 938
493 Ga0501202_030343 3300049652 Unclassified 1124
494 Ga0501249_010713 3300049679 Bacteria 1920
495 Ga0501257_029533 3300049686 Bacteria 1318
496 Ga0501259_038630 3300049688 Unclassified 930
497 Ga0501221_048929 3300049704 Unclassified 947
498 Ga0501225_0000624 3300049705 Bacteria 11028
499 Ga0501225_0020500 3300049705 Unclassified 1827
500 Ga0501245_020842 3300049708 Bacteria 1025
501 Ga0501266_011101 3300049763 Bacteria 1151
502 Ga0501035_0476416 3300049822 Bacteria 1030
503 Ga0501044_0079334 3300049823 Bacteria 3326
504 nmdc:mga0k408_43315_c1 3300050493 Bacteria 2593
505 nmdc:mga0k408_467909_c1 3300050493 Unclassified 748
506 nmdc:mga05p37_305976_c1 3300050507 Bacteria 1886
507 nmdc:mga05p37_9961_c1 3300050507 Bacteria 11286
508 nmdc:mga09592_204881_c1 3300050508 Bacteria 1709
509 nmdc:mga09592_80226_c1 3300050508 Bacteria 2779
510 nmdc:mga0qj67_20468_c1 3300050509 Bacteria 5065
511 nmdc:mga0qj67_57913_c1 3300050509 Bacteria 3072
512 nmdc:mga08y16_886490_c1 3300050511 Bacteria 879
513 nmdc:mga08x19_277287_c1 3300050514 Bacteria 1161
514 Ga0495601_0067766 3300053077 Unclassified 2274
515 Ga0500578_0000029 3300053086 Bacteria 140078
516 Ga0500578_0060068 3300053086 Bacteria 2429
517 Ga0500644_0184552 3300053088 Bacteria 855
518 Ga0500646_0022448 3300053090 Bacteria 1688
519 Ga0500583_0000002 3300053092 Bacteria 232826
520 Ga0500583_0000356 3300053092 Bacteria 15053
521 Ga0500651_0136373 3300053093 Bacteria 1482
522 Ga0500554_018911 3300053102 Bacteria 1869
523 Ga0500618_044481 3300053125 Bacteria 1014
524 Ga0500642_0122180 3300053130 Bacteria 1218
525 Ga0500568_0000532 3300053139 Bacteria 28130
526 Ga0500589_007446 3300053147 Bacteria 4476
527 Ga0500616_0040923 3300053153 Bacteria 2490
528 Ga0500636_0049990 3300053177 Bacteria 2459
529 Ga0500636_0054910 3300053177 Bacteria 2335
530 Ga0500611_011049 3300053727 Bacteria 1481
531 2738728314 2738541278 Bacteria 9755573
532 2977232806 2977232053 Bacteria 5485925
533 8057478117 8057473075 Bacteria 5892720
534 Ga0395900_0046426
535 SwRhRL2b_contig_695697
536 JGI24743J22301_10006696
537 rootH2_10062486
538 rootL2_10233092
539 rootH1_10017103
540 Ga0065704_10099872
541 Ga0065712_10156944
542 Ga0065715_10179522
543 Ga0065707_10281485
544 Ga0070676_10001998
545 Ga0070676_10002273
546 Ga0070676_10327466
547 Ga0070683_100001393
548 Ga0070683_100015634
549 Ga0070683_100033459
550 Ga0070683_100138769
551 Ga0070683_100796871
552 Ga0070690_100019989
553 Ga0070690_100146647
554 Ga0070690_100158926
555 Ga0070670_100079936
556 Ga0070670_100083196
557 Ga0070670_100086658
558 Ga0070670_100105026
559 Ga0070670_100170778
560 Ga0070670_100434158
561 Ga0070670_100499309
562 Ga0070677_10016696
563 Ga0068869_100001381
564 Ga0068869_100021050
565 Ga0068869_100030784
566 Ga0068869_100044864
567 Ga0068869_100097131
568 Ga0068869_100227217
569 Ga0068869_100258357
570 Ga0070666_10024795
571 Ga0070666_10031434
572 Ga0070666_10102182
573 Ga0068868_100003353
574 Ga0068868_100004611
575 Ga0068868_100131126
576 Ga0070660_100431485
577 Ga0070689_100038560
578 Ga0070689_100088515
579 Ga0070689_100247926
580 Ga0070687_100185248
581 Ga0070661_100000700
582 Ga0070661_100007311
583 Ga0070661_100092540
584 Ga0070661_100133232
585 Ga0070661_100309388
586 Ga0070661_100393140
587 Ga0070668_100008643
588 Ga0070668_100029285
589 Ga0070668_100225922
590 Ga0070668_100677757
591 Ga0070669_100128148
592 Ga0070675_100026344
593 Ga0070675_100052656
594 Ga0070675_100089545
595 Ga0070675_100182146
596 Ga0070675_100288401
597 Ga0070675_100419633
598 Ga0070671_100116167
599 Ga0070671_100121336
600 Ga0070671_100147311
601 Ga0070671_100352705
602 Ga0070671_100395060
603 Ga0070674_100009129
604 Ga0070674_100246822
605 Ga0070674_100383687
606 Ga0070673_100033475
607 Ga0070673_100040116
608 Ga0070673_100074409
609 Ga0070673_100496818
610 Ga0070673_100888592
611 Ga0070688_100452423
612 Ga0070659_100009106
613 Ga0070659_100009502
614 Ga0070659_100244506
615 Ga0070667_100024301
616 Ga0070667_100454023
617 Ga0070667_100768363
618 Ga0070701_10091243
619 Ga0070678_100008731
620 Ga0070678_100068455
621 Ga0070678_100184257
622 Ga0070662_100023633
623 Ga0070662_100030379
624 Ga0070662_100064055
625 Ga0070662_100100346
626 Ga0068867_100027376
627 Ga0068867_100094517
628 Ga0068867_100103918
629 Ga0068867_100104601
630 Ga0068867_100600555
631 Ga0070685_10048199
632 Ga0070698_100000850
633 Ga0070698_100381596
634 Ga0070699_100021187
635 Ga0070684_100001259
636 Ga0070684_100002311
637 Ga0070684_100113239
638 Ga0068853_100000395
639 Ga0068853_100039985
640 Ga0068853_100044279
641 Ga0068853_100063444
642 Ga0070672_100036166
643 Ga0070672_100068671
644 Ga0070672_100130185
645 Ga0070672_100173565
646 Ga0070672_100230475
647 Ga0070672_100256269
648 Ga0070672_100367570
649 Ga0070686_100030901
650 Ga0070686_100074613
651 Ga0070665_100084739
652 Ga0070665_100146658
653 Ga0070704_100410221
654 Ga0068855_100007582
655 Ga0068855_100192462
656 Ga0070664_100005564
657 Ga0070664_100011076
658 Ga0070664_100017550
659 Ga0070664_100040027
660 Ga0070664_100074704
661 Ga0070664_100174531
662 Ga0070664_100203799
663 Ga0068857_100003941
664 Ga0068857_100017630
665 Ga0068854_100038467
666 Ga0068854_100348360
667 Ga0068856_100043579
668 Ga0068852_100005703
669 Ga0068852_100371922
670 Ga0068852_100739999
671 Ga0068859_100013961
672 Ga0068859_100016987
673 Ga0068859_100024704
674 Ga0068859_100038428
675 Ga0068859_100379245
676 Ga0068864_100026128
677 Ga0068864_100050177
678 Ga0068864_100168575
679 Ga0068864_100234359
680 Ga0068864_100632543
681 Ga0068866_10007007
682 Ga0068866_10037098
683 Ga0068861_100016245
684 Ga0068861_100052469
685 Ga0068861_100317597
686 Ga0068851_10047518
687 Ga0068851_10051608
688 Ga0068870_10005159
689 Ga0068870_10185192
690 Ga0068870_10192635
691 Ga0068863_100024490
692 Ga0068863_100167980
693 Ga0068863_100268365
694 Ga0068858_100361689
695 Ga0068858_100721794
696 Ga0068860_100053218
697 Ga0068860_100396691
698 Ga0068860_100476883
699 Ga0068862_100692009
700 Ga0081455_10255076
701 Ga0070715_10087163
702 Ga0075366_10041904
703 Ga0075366_10059432
704 Ga0075366_10191246
705 Ga0097621_100008757
706 Ga0097621_100112122
707 Ga0097621_100115982
708 Ga0097621_100134164
709 Ga0068871_100007800
710 Ga0068871_100026146
711 Ga0068871_100217493
712 Ga0068871_100956514
713 Ga0075428_100006044
714 Ga0075428_100139614
715 Ga0075430_100003052
716 Ga0075430_100038623
717 Ga0075431_100006268
718 Ga0075434_100004332
719 Ga0075429_100022294
720 Ga0075429_100716347
721 Ga0068865_100016453
722 Ga0097620_100013961
723 Ga0097620_100016985
724 Ga0097620_100024706
725 Ga0097620_100038428
726 Ga0097620_100379230
727 Ga0105240_10151649
728 Ga0111539_10534473
729 Ga0111539_11125414
730 Ga0105247_10000408
731 Ga0114129_10114584
732 Ga0114129_10208202
733 Ga0105243_10278937
734 Ga0105243_10503081
735 Ga0105241_10052115
736 Ga0105241_10086578
737 Ga0105241_10169827
738 Ga0105241_10345537
739 Ga0105242_10025677
740 Ga0105242_10036758
741 Ga0105242_10125704
742 Ga0105242_10187126
743 Ga0105248_10057123
744 Ga0105248_10414162
745 Ga0105237_10125637
746 Ga0105249_10004239
747 Ga0105249_10014866
748 Ga0105249_10041255
749 Ga0105249_10628144
750 Ga0105249_10917258
751 Ga0105239_10047696
752 Ga0105239_10135830
753 Ga0105239_10685135
754 Ga0105246_10029461
755 Ga0105246_10104692
756 Ga0157373_10042809
757 Ga0157371_10222372
758 Ga0157371_10349727
759 Ga0157371_10436637
760 Ga0157374_10001463
761 Ga0157374_10061170
762 Ga0157374_10079534
763 Ga0157374_10094509
764 Ga0157374_10191443
765 Ga0157374_10230186
766 Ga0157374_10808992
767 Ga0157378_10044156
768 Ga0157378_10221232
769 Ga0157378_10623501
770 Ga0163162_10009462
771 Ga0163162_10042818
772 Ga0163162_10057279
773 Ga0163162_10370658
774 Ga0163162_11305482
775 Ga0157372_10067733
776 Ga0157372_10299740
777 Ga0157372_10300404
778 Ga0157372_10601863
779 Ga0157375_10016593
780 Ga0157375_10090861
781 Ga0157375_10096531
782 Ga0157375_10132746
783 Ga0157375_10231120
784 Ga0157375_10244191
785 Ga0157375_10463541
786 Ga0157375_10712308
787 Ga0163163_10000343
788 Ga0163163_10092101
789 Ga0157380_10111403
790 Ga0157380_10209689
791 Ga0157380_10799217
792 Ga0157377_10001764
793 Ga0157377_10032743
794 Ga0157377_10043884
795 Ga0157377_10364800
796 Ga0157379_10038921
797 Ga0157379_10087295
798 Ga0157379_10256747
799 Ga0157379_10580526
800 Ga0157376_10140810
801 Ga0157376_10174121
802 Ga0182005_1073485
803 Ga0163161_10515625
804 Ga0209258_110346
805 Ga0209646_1005966
806 Ga0207656_10025952
807 Ga0207656_10138651
808 Ga0207656_10164156
809 Ga0207642_10027677
810 Ga0207710_10003686
811 Ga0207688_10018716
812 Ga0207680_10143802
813 Ga0207680_10149608
814 Ga0207647_10000358
815 Ga0207647_10153607
816 Ga0207647_10230731
817 Ga0207645_10000748
818 Ga0207645_10018693
819 Ga0207645_10068359
820 Ga0207645_10162270
821 Ga0207643_10003520
822 Ga0207643_10016684
823 Ga0207654_10129413
824 Ga0207671_10548174
825 Ga0207662_10044009
826 Ga0207662_10216932
827 Ga0207657_10116534
828 Ga0207649_10001123
829 Ga0207649_10029432
830 Ga0207649_10085396
831 Ga0207649_10153594
832 Ga0207649_10277974
833 Ga0207681_10015202
834 Ga0207681_10044196
835 Ga0207681_10057984
836 Ga0207650_10095373
837 Ga0207650_10433433
838 Ga0207659_10009012
839 Ga0207659_10059684
840 Ga0207659_10061051
841 Ga0207659_10096389
842 Ga0207659_10668017
843 Ga0207644_10067295
844 Ga0207644_10085031
845 Ga0207644_10139061
846 Ga0207644_10332368
847 Ga0207690_10003439
848 Ga0207690_10021010
849 Ga0207706_10023769
850 Ga0207706_10041996
851 Ga0207706_10047636
852 Ga0207706_10102504
853 Ga0207706_10105060
854 Ga0207686_10008363
855 Ga0207670_10025416
856 Ga0207670_10037891
857 Ga0207670_10366263
858 Ga0207669_10024891
859 Ga0207669_10069936
860 Ga0207704_10102975
861 Ga0207691_10002072
862 Ga0207691_10055044
863 Ga0207691_10082070
864 Ga0207691_10084065
865 Ga0207691_10186178
866 Ga0207691_10596634
867 Ga0207711_10206509
868 Ga0207689_10000628
869 Ga0207689_10001062
870 Ga0207689_10001418
871 Ga0207689_10011584
872 Ga0207689_10068850
873 Ga0207689_10114339
874 Ga0207689_10746331
875 Ga0207661_10001802
876 Ga0207661_10154680
877 Ga0207661_10348929
878 Ga0207679_10000768
879 Ga0207679_10008459
880 Ga0207679_10028829
881 Ga0207679_10038248
882 Ga0207679_10163867
883 Ga0207667_10008843
884 Ga0207651_10054640
885 Ga0207651_10104938
886 Ga0207651_10260363
887 Ga0207651_10837644
888 Ga0207712_10001226
889 Ga0207712_10011611
890 Ga0207712_10081451
891 Ga0207712_10088962
892 Ga0207712_10113822
893 Ga0207712_10227441
894 Ga0207668_10267838
895 Ga0207668_10273020
896 Ga0207640_10058074
897 Ga0207640_10145138
898 Ga0207658_10188079
899 Ga0207658_10414819
900 Ga0207677_10016754
901 Ga0207677_10132415
902 Ga0207677_10223760
903 Ga0207703_10033475
904 Ga0207703_10050397
905 Ga0207703_10087622
906 Ga0207703_10775643
907 Ga0207639_10000365
908 Ga0207639_10017270
909 Ga0207639_10392417
910 Ga0207641_10011229
911 Ga0207641_10115974
912 Ga0207641_10286152
913 Ga0207641_10853236
914 Ga0207648_10000372
915 Ga0207648_10002066
916 Ga0207648_10025791
917 Ga0207648_10093426
918 Ga0207648_10109044
919 Ga0207648_10163357
920 Ga0207648_10358848
921 Ga0207648_10600649
922 Ga0207676_10009647
923 Ga0207676_10024603
924 Ga0207676_10046670
925 Ga0207676_10069042
926 Ga0207676_10087429
927 Ga0207676_10219177
928 Ga0207676_10358972
929 Ga0207676_10446017
930 Ga0207674_10005900
931 Ga0207674_10018901
932 Ga0207674_10060652
933 Ga0207674_10110778
934 Ga0207674_10549100
935 Ga0207675_100005048
936 Ga0207675_100019278
937 Ga0207675_100038027
938 Ga0207675_100073698
939 Ga0207675_100129619
940 Ga0207675_100257042
941 Ga0207675_100369912
942 Ga0207675_100700771
943 Ga0207683_10001617
944 Ga0207683_10020692
945 Ga0207683_10457081
946 Ga0207698_10008087
947 Ga0207698_10515604
948 Ga0268266_10076916
949 Ga0268266_10182107
950 Ga0268265_10106006
951 Ga0268264_10039936
952 Ga0268264_10059527
953 Ga0268264_10126506
954 Ga0268264_10434563
955 Ga0268264_10775482
956 Ga0307408_100072423
957 Ga0307413_10890413
958 Ga0307410_10125596
959 Ga0307407_10000015
960 Ga0307412_10357260
961 Ga0307412_10366404
962 Ga0307409_100063064
963 Ga0307409_100096643
964 Ga0307409_100217534
965 Ga0307409_100304142
966 Ga0307416_100000025
967 Ga0307416_100484601
968 Ga0307414_10030769
969 Ga0307411_10042295
970 Ga0373925_0098701
971 Ga0395899_0058514
972 Ga0395898_0710399
973 Ga0395905_0003070
974 Ga0395905_0366471
975 Ga0395901_0184561
976 Ga0400483_117562
977 Ga0439436_0061158
978 Ga0451795_0537227
979 Ga0451802_1474618
980 Ga0451802_1485821
981 Ga0451853_1980307
982 Ga0439449_0078116
983 Ga0439457_001854
984 Ga0451577_0064013
985 Ga0451577_0413685
986 Ga0466969_0000033
987 Ga0466972_0000091
988 Ga0466972_0177125
989 Ga0453683_0263933
990 Ga0466966_0000170
991 Ga0466961_0147229
992 Ga0453684_0020010
993 Ga0453684_0457413
994 Ga0466957_0003977
995 Ga0466957_0087354
996 Ga0466959_0000089
997 Ga0451576_0143177
998 Ga0495650_0032493
999 Ga0495664_0128775
1000 Ga0495628_0292934
1001 Ga0495632_0116727
1002 Ga0495632_0152043
1003 Ga0495586_0097871
1004 Ga0495645_0146378
1005 Ga0495667_0255973
1006 Ga0495668_0008352
1007 Ga0495635_0042216
1008 Ga0495588_0114353
1009 Ga0495646_0193469
1010 Ga0495600_0083908
1011 Ga0495604_0348945
1012 Ga0495636_0071239
1013 Ga0495672_0012491
1014 Ga0495672_0022694
1015 Ga0495675_0085726
1016 Ga0495675_0200910
1017 Ga0496108_0176619
1018 Ga0496110_0049203
1019 Ga0496111_0363127
1020 Ga0496112_0403227
1021 Ga0501034_0374204
1022 Ga0501037_0388596
1023 Ga0501047_0019608
1024 Ga0501047_0041584
1025 Ga0501048_0435444
1026 Ga0501202_030343
1027 Ga0501249_010713
1028 Ga0501257_029533
1029 Ga0501259_038630
1030 Ga0501221_048929
1031 Ga0501225_0000624
1032 Ga0501225_0020500
1033 Ga0501245_020842
1034 Ga0501266_011101
1035 Ga0501035_0476416
1036 Ga0501044_0079334
1037 nmdc:mga0k408_43315_c1
1038 nmdc:mga0k408_467909_c1
1039 nmdc:mga05p37_305976_c1
1040 nmdc:mga05p37_9961_c1
1041 nmdc:mga09592_204881_c1
1042 nmdc:mga09592_80226_c1
1043 nmdc:mga0qj67_20468_c1
1044 nmdc:mga0qj67_57913_c1
1045 nmdc:mga08y16_886490_c1
1046 nmdc:mga08x19_277287_c1
1047 Ga0495601_0067766
1048 Ga0500578_0000029
1049 Ga0500578_0060068
1050 Ga0500644_0184552
1051 Ga0500646_0022448
1052 Ga0500583_0000002
1053 Ga0500583_0000356
1054 Ga0500651_0136373
1055 Ga0500554_018911
1056 Ga0500618_044481
1057 Ga0500642_0122180
1058 Ga0500568_0000532
1059 Ga0500589_007446
1060 Ga0500616_0040923
1061 Ga0500636_0049990
1062 Ga0500636_0054910
1063 Ga0500611_011049
1064 2738728314
1065 2977232806
1066 8057478117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02682

CT_C_D

Carboxyltransferase domain, subdomain C and D

26

235

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zp2-assembly2.cif.gz_B c-terminal domain of kipi from bacillus subtilis 0.9529 99 227
2zp2-assembly1.cif.gz_A c-terminal domain of kipi from bacillus subtilis 0.9463 99 227
3opf-assembly3.cif.gz_C crystal structure of ttha0988 in space group p212121 0.9369 14 227
3oep-assembly1.cif.gz_A crystal structure of ttha0988 in space group p43212 0.9362 14 227
3opf-assembly1.cif.gz_A crystal structure of ttha0988 in space group p212121 0.9315 14 227
ID Description Score Start End Superfamily
3oreA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9643 99 227 2.40.100.10
3mmlD02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9526 97 226 2.40.100.10
2zp2A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9463 99 227 2.40.100.10
af_Q2G095_94_231_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9437 101 227 2.40.100.10
3mmlD02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9165 97 226 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A537R1W4-F1-model_v4 5-oxoprolinase subunit PxpB (EC 3.5.2.9) 0.9935 102 227 GO:0005524
GO:0017168
AF-A0A2V6H9H9-F1-model_v4 Kinase inhibitor 0.9934 101 227 GO:0005524
GO:0016787
AF-A0A2V5VZF5-F1-model_v4 Carboxyltransferase domain-containing protein 0.9929 124 227 GO:0005524
GO:0016787
AF-A0A0H2KLL0-F1-model_v4 Carboxyltransferase domain-containing protein 0.9916 136 227 GO:0005524
GO:0016787
AF-A0A5S4F1K3-F1-model_v4 Carboxyltransferase domain-containing protein 0.9915 139 225 GO:0005524
GO:0016740
GO:0016787

Map