F460362

General Info

Members Datasets Scaffolds Average Seq Length
533 454 1066 76

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100122153|Ga0070680_1001221532
Length 76
Sequence MTRSTVFTTNRSQAVRLPKPVALPDNVHQVEIMKIGRSRLITPADQSWDSFFDGPKVSDDFMAEREQPAAEERDGF

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
269 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
276 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
277 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
278 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
279 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
280 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
281 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
282 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
283 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
284 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
285 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
286 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
287 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
288 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
289 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
290 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
291 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
292 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
293 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
294 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
295 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
296 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
297 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
298 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
299 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
300 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
301 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
302 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
303 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
304 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
305 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
306 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
307 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
308 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
309 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
310 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
311 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
312 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
313 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
314 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
315 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
316 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
317 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
318 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
319 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
320 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
321 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
322 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
323 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
324 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
325 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
326 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
327 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
328 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
329 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
330 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
331 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
332 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
333 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
334 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
335 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
336 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
337 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
338 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
339 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
340 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
341 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
342 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
343 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
344 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
345 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
346 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
347 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
348 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
349 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
350 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
351 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
352 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
353 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
354 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
355 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
356 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
357 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
358 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
359 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
360 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
361 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
362 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
363 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
364 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
365 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
366 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
367 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
368 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
369 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
370 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
371 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
372 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
373 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
374 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
375 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
376 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
377 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
378 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
379 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
380 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
381 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
382 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
383 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
384 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
385 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
386 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
387 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
388 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
389 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
390 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
391 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
392 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
393 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
394 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
395 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
396 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
397 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
398 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
399 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
400 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
401 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
402 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
403 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
404 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
405 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
406 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
407 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
408 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
409 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
410 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
411 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
412 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
413 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
414 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
415 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
416 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
417 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
418 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
419 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
420 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
421 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
422 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
423 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
424 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
425 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
426 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
427 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
428 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
429 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
430 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
431 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
432 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
433 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
434 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
435 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
436 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
437 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
438 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
439 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
440 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
441 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
442 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
443 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
444 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
445 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
446 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
447 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
448 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
449 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
450 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
451 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
452 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
453 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
454 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.67
Metatranscriptomes 0.56
Isolates 33.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 32.08
Rhizoplane 1.69
Rhizosphere 54.22
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100122153 3300005336 Bacteria 2174
2 JGI25152J39213_1001982 3300002773 Bacteria 8097
3 JGI25150J39212_1015534 3300002774 Bacteria 1267
4 JGI25151J46595_10142017 3300003187 Bacteria 584
5 JGI25153J46596_10000693 3300003215 Bacteria 20590
6 JGI25153J46596_10059697 3300003215 Bacteria 1043
7 rootH2_10053930 3300003320 Bacteria 1598
8 rootH1_10059455 3300003323 Bacteria 2739
9 rootH1_10061936 3300003323 Bacteria 3450
10 rootH1_10291225 3300003323 Bacteria 1191
11 Ga0070658_10591984 3300005327 Bacteria 961
12 Ga0070683_100049566 3300005329 Bacteria 3884
13 Ga0070680_100001711 3300005336 Bacteria 16114
14 Ga0070680_100046457 3300005336 Bacteria 3532
15 Ga0070660_100002257 3300005339 Bacteria 13236
16 Ga0070691_10643988 3300005341 Bacteria 630
17 Ga0070687_100123985 3300005343 Bacteria 1482
18 Ga0070661_100040715 3300005344 Bacteria 3391
19 Ga0070692_10069070 3300005345 Bacteria 1879
20 Ga0070659_100368344 3300005366 Bacteria 1208
21 Ga0070709_10523116 3300005434 Unclassified 904
22 Ga0070714_101160854 3300005435 Bacteria 753
23 Ga0070710_11233701 3300005437 Bacteria 554
24 Ga0070701_10040858 3300005438 Bacteria 2360
25 Ga0070705_100001958 3300005440 Bacteria 10525
26 Ga0070700_100006805 3300005441 Bacteria 6131
27 Ga0070694_100000699 3300005444 Bacteria 18668
28 Ga0070708_100063764 3300005445 Bacteria 3299
29 Ga0070663_100021591 3300005455 Bacteria 4286
30 Ga0070678_101154622 3300005456 Bacteria 717
31 Ga0070681_10056364 3300005458 Bacteria 3911
32 Ga0070681_10096284 3300005458 Bacteria 2908
33 Ga0070681_10222320 3300005458 Bacteria 1803
34 Ga0070706_100057499 3300005467 Bacteria 3589
35 Ga0070706_100295816 3300005467 Unclassified 1511
36 Ga0070707_100288343 3300005468 Bacteria 1595
37 Ga0070707_102047387 3300005468 Unclassified 540
38 Ga0070699_100003406 3300005518 Bacteria 14071
39 Ga0070699_101453010 3300005518 Unclassified 629
40 Ga0070679_100054750 3300005530 Bacteria 3973
41 Ga0070679_100568343 3300005530 Bacteria 1077
42 Ga0070684_100014817 3300005535 Bacteria 6326
43 Ga0070697_100045658 3300005536 Bacteria 3551
44 Ga0070697_100282326 3300005536 Unclassified 1425
45 Ga0068853_100098242 3300005539 Bacteria 2585
46 Ga0070686_100198927 3300005544 Bacteria 1435
47 Ga0070695_100052565 3300005545 Bacteria 2618
48 Ga0070696_100000087 3300005546 Bacteria 45866
49 Ga0070693_100114965 3300005547 Bacteria 1661
50 Ga0070665_101084016 3300005548 Bacteria 812
51 Ga0070704_100006935 3300005549 Bacteria 6715
52 Ga0068855_100020143 3300005563 Bacteria 8010
53 Ga0068855_100775199 3300005563 Bacteria 1021
54 Ga0070664_100305253 3300005564 Bacteria 1439
55 Ga0068857_100002462 3300005577 Bacteria 15130
56 Ga0068857_100003968 3300005577 Bacteria 12457
57 Ga0068854_101042176 3300005578 Bacteria 726
58 Ga0068852_100074336 3300005616 Bacteria 2993
59 Ga0068859_100005753 3300005617 Bacteria 12611
60 Ga0068864_100322596 3300005618 Bacteria 1451
61 Ga0068861_100730520 3300005719 Bacteria 923
62 Ga0068851_10012140 3300005834 Bacteria 4056
63 Ga0068863_100214663 3300005841 Bacteria 1853
64 Ga0068858_101888878 3300005842 Bacteria 590
65 Ga0068860_100003602 3300005843 Bacteria 15912
66 Ga0068862_100002025 3300005844 Bacteria 18350
67 Ga0081455_10090298 3300005937 Bacteria 2484
68 Ga0070717_10360122 3300006028 Bacteria 1302
69 Ga0070717_10621825 3300006028 Bacteria 980
70 Ga0075365_10163860 3300006038 Bacteria 1550
71 Ga0075365_10299310 3300006038 Bacteria 1132
72 Ga0075365_10499099 3300006038 Bacteria 860
73 Ga0075363_100461678 3300006048 Bacteria 751
74 Ga0070715_10237819 3300006163 Bacteria 945
75 Ga0070716_100332481 3300006173 Bacteria 1069
76 Ga0070712_100161326 3300006175 Bacteria 1731
77 Ga0075369_10328192 3300006186 Bacteria 716
78 Ga0075370_10078894 3300006353 Bacteria 1891
79 Ga0075428_100138619 3300006844 Bacteria 2644
80 Ga0075430_100306845 3300006846 Bacteria 1312
81 Ga0075431_100000978 3300006847 Bacteria 25401
82 Ga0075431_100625353 3300006847 Bacteria 1059
83 Ga0075429_100004447 3300006880 Bacteria 12053
84 Ga0075429_100995649 3300006880 Bacteria 733
85 Ga0068865_100321374 3300006881 Bacteria 1245
86 Ga0097620_100005754 3300006931 Bacteria 12611
87 Ga0079104_1020115 3300006946 Bacteria 1847
88 Ga0099794_10489073 3300007265 Bacteria 647
89 Ga0099794_10613332 3300007265 Bacteria 576
90 Ga0099794_10784081 3300007265 Bacteria 510
91 Ga0099795_10043537 3300007788 Bacteria 1607
92 Ga0099795_10404841 3300007788 Bacteria 621
93 Ga0105240_10008497 3300009093 Bacteria 14684
94 Ga0105240_10290684 3300009093 Bacteria 1874
95 Ga0105240_11574682 3300009093 Bacteria 688
96 Ga0111539_10804080 3300009094 Bacteria 1094
97 Ga0105241_12495848 3300009174 Bacteria 517
98 Ga0105237_10008804 3300009545 Bacteria 10884
99 Ga0105237_10012724 3300009545 Bacteria 8853
100 Ga0105237_10036713 3300009545 Bacteria 4958
101 Ga0105238_10005124 3300009551 Bacteria 12953
102 Ga0105238_12508537 3300009551 Bacteria 551
103 Ga0105249_10000473 3300009553 Bacteria 37304
104 Ga0099796_10151770 3300010159 Bacteria 913
105 Ga0099796_10219114 3300010159 Bacteria 779
106 Ga0105239_10028696 3300010375 Bacteria 6119
107 Ga0105246_10098736 3300011119 Bacteria 2122
108 Ga0157370_10033196 3300013104 Bacteria 5032
109 Ga0157370_10135046 3300013104 Bacteria 2300
110 Ga0157369_10016056 3300013105 Bacteria 8423
111 Ga0157369_12007729 3300013105 Bacteria 587
112 Ga0157374_11468517 3300013296 Bacteria 705
113 Ga0157378_13205548 3300013297 Bacteria 508
114 Ga0157372_12875864 3300013307 Bacteria 551
115 Ga0157380_11630173 3300014326 Bacteria 701
116 Ga0157379_11192875 3300014968 Bacteria 732
117 Ga0206356_11145487 3300020070 Bacteria 682
118 Ga0213876_10044325 3300021384 Bacteria 2351
119 Ga0213871_10096424 3300021441 Bacteria 862
120 Ga0207425_1000316 3300025245 Bacteria 34779
121 Ga0209129_1000268 3300025258 Bacteria 51242
122 Ga0209025_1005676 3300025294 Bacteria 10053
123 Ga0209758_1000151 3300025297 Bacteria 162732
124 Ga0209758_1001732 3300025297 Bacteria 24300
125 Ga0207653_10008855 3300025885 Bacteria 3139
126 Ga0207647_10521448 3300025904 Bacteria 661
127 Ga0207699_10351470 3300025906 Bacteria 1041
128 Ga0207643_10111004 3300025908 Bacteria 1616
129 Ga0207705_10051448 3300025909 Bacteria 2965
130 Ga0207684_10049525 3300025910 Bacteria 3563
131 Ga0207684_10113144 3300025910 Bacteria 2323
132 Ga0207707_10002327 3300025912 Bacteria 17115
133 Ga0207707_10020479 3300025912 Bacteria 5776
134 Ga0207707_10246512 3300025912 Bacteria 1552
135 Ga0207695_10426046 3300025913 Bacteria 1211
136 Ga0207695_10753824 3300025913 Bacteria 854
137 Ga0207695_11030118 3300025913 Bacteria 703
138 Ga0207671_10019843 3300025914 Bacteria 5130
139 Ga0207671_10028444 3300025914 Bacteria 4176
140 Ga0207693_10152945 3300025915 Unclassified 1815
141 Ga0207660_10042812 3300025917 Bacteria 3180
142 Ga0207660_10056097 3300025917 Bacteria 2818
143 Ga0207657_10010155 3300025919 Bacteria 9409
144 Ga0207649_10026732 3300025920 Bacteria 3379
145 Ga0207649_11244813 3300025920 Bacteria 588
146 Ga0207652_10010833 3300025921 Bacteria 7347
147 Ga0207652_10082378 3300025921 Bacteria 2815
148 Ga0207646_10548595 3300025922 Bacteria 1039
149 Ga0207694_10030055 3300025924 Bacteria 4148
150 Ga0207700_11369703 3300025928 Bacteria 629
151 Ga0207690_10041213 3300025932 Bacteria 3025
152 Ga0207706_10533805 3300025933 Bacteria 1011
153 Ga0207704_10913392 3300025938 Bacteria 739
154 Ga0207661_10087454 3300025944 Bacteria 2588
155 Ga0207679_10252213 3300025945 Bacteria 1501
156 Ga0207667_10070088 3300025949 Bacteria 3649
157 Ga0207712_10000863 3300025961 Bacteria 22110
158 Ga0207640_10937667 3300025981 Bacteria 758
159 Ga0207639_10149095 3300026041 Bacteria 1957
160 Ga0207678_10021752 3300026067 Bacteria 5625
161 Ga0207708_10031642 3300026075 Bacteria 4016
162 Ga0207641_10042871 3300026088 Bacteria 3798
163 Ga0207676_10791612 3300026095 Bacteria 924
164 Ga0207674_10012355 3300026116 Bacteria 9545
165 Ga0207674_10025210 3300026116 Bacteria 6345
166 Ga0207675_100151714 3300026118 Bacteria 2206
167 Ga0207683_10599830 3300026121 Bacteria 1019
168 Ga0207698_10090437 3300026142 Bacteria 2503
169 Ga0209281_1000733 3300027111 Bacteria 32098
170 Ga0209371_1093357 3300027312 Bacteria 505
171 Ga0209179_1033613 3300027512 Bacteria 1061
172 Ga0268265_10003109 3300028380 Bacteria 12109
173 Ga0268264_10007646 3300028381 Bacteria 9007
174 Ga0307517_10000066 3300028786 Bacteria 141370
175 Ga0265328_10014003 3300031239 Bacteria 3164
176 Ga0265331_10003095 3300031250 Bacteria 10905
177 Ga0265327_10003201 3300031251 Bacteria 15954
178 Ga0265316_10008666 3300031344 Bacteria 9417
179 Ga0307513_10152585 3300031456 Bacteria 2216
180 Ga0307516_10353324 3300031730 Bacteria 1135
181 Ga0307416_101962954 3300032002 Bacteria 688
182 Ga0373926_0008027 3300035083 Bacteria 3517
183 Ga0373934_0189480 3300035086 Bacteria 846
184 Ga0373923_0061626 3300035111 Bacteria 1594
185 Ga0373939_0285683 3300035114 Bacteria 653
186 Ga0373945_0145286 3300035116 Bacteria 958
187 Ga0373954_0160607 3300035118 Bacteria 1099
188 Ga0373956_0434876 3300035119 Bacteria 626
189 Ga0373957_0165817 3300035120 Bacteria 911
190 Ga0373943_0067272 3300035170 Bacteria 1806
191 Ga0373946_0122958 3300035171 Bacteria 1186
192 Ga0373955_0153177 3300035172 Bacteria 1357
193 Ga0373924_0005630 3300035410 Bacteria 4441
194 Ga0373931_1268989 3300035691 Unclassified 506
195 Ga0373935_0099858 3300035692 Bacteria 1911
196 Ga0373935_0136228 3300035692 Bacteria 1654
197 Ga0373927_0064372 3300035695 Bacteria 2371
198 Ga0373933_0081494 3300035724 Bacteria 1985
199 Ga0373947_0038350 3300035725 Bacteria 2846
200 Ga0373937_0129262 3300036401 Bacteria 2358
201 Ga0373925_0018790 3300037068 Bacteria 5023
202 Ga0436364_0835534 3300037853 Bacteria 1398
203 Ga0436364_1318325 3300037853 Bacteria 19438
204 Ga0436365_1317422 3300039437 Bacteria 4837
205 Ga0436360_0653321 3300039438 Bacteria 802
206 Ga0436360_1225836 3300039438 Bacteria 699
207 Ga0436361_0391576 3300039447 Bacteria 1195
208 Ga0436361_1050531 3300039447 Bacteria 617
209 Ga0436361_1216813 3300039447 Bacteria 750
210 Ga0451793_1904535 3300041452 Bacteria 1256
211 Ga0451841_0190407 3300041498 Bacteria 651
212 Ga0466966_0366227 3300044684 Bacteria 866
213 Ga0466957_1159603 3300044842 Bacteria 558
214 Ga0466967_0608164 3300045976 Bacteria 1079
215 Ga0495592_0114550 3300046454 Bacteria 1904
216 Ga0495629_0453245 3300046459 Bacteria 868
217 Ga0495651_0001731 3300046462 Bacteria 16853
218 Ga0495580_0093984 3300046472 Bacteria 2086
219 Ga0495580_0922750 3300046472 Bacteria 560
220 Ga0495582_0007753 3300046473 Bacteria 5936
221 Ga0495662_0007117 3300046476 Bacteria 5550
222 Ga0495664_0013018 3300046477 Bacteria 4716
223 Ga0495664_0049134 3300046477 Bacteria 2504
224 Ga0495585_0094478 3300046492 Bacteria 1607
225 Ga0495606_0103849 3300046507 Bacteria 1725
226 Ga0495608_0338144 3300046511 Bacteria 928
227 Ga0495608_0849085 3300046511 Bacteria 537
228 Ga0495618_0088587 3300046514 Bacteria 1979
229 Ga0495628_0041344 3300046516 Bacteria 3680
230 Ga0495628_0490141 3300046516 Bacteria 888
231 Ga0495628_0662660 3300046516 Unclassified 740
232 Ga0495630_0441247 3300046517 Bacteria 997
233 Ga0495644_0257719 3300046523 Bacteria 678
234 Ga0495648_0001884 3300046524 Bacteria 20054
235 Ga0495666_0036661 3300046526 Bacteria 2388
236 Ga0495652_0507361 3300046529 Bacteria 835
237 Ga0495652_0749501 3300046529 Bacteria 653
238 Ga0495652_0981770 3300046529 Bacteria 553
239 Ga0495665_0012584 3300046531 Bacteria 4581
240 Ga0495640_0041418 3300046533 Bacteria 3218
241 Ga0495586_0382299 3300046535 Bacteria 810
242 Ga0495598_0084065 3300046537 Bacteria 1026
243 Ga0495645_0061840 3300046543 Bacteria 2713
244 Ga0495645_0469696 3300046543 Bacteria 791
245 Ga0495667_0313157 3300046559 Bacteria 994
246 Ga0495656_0226253 3300046615 Bacteria 937
247 Ga0495634_0204390 3300046642 Bacteria 1225
248 Ga0495635_0109813 3300046663 Bacteria 1884
249 Ga0495635_0120323 3300046663 Bacteria 1791
250 Ga0495588_0636682 3300046674 Bacteria 558
251 Ga0495657_0184247 3300046675 Bacteria 1279
252 Ga0495599_0232785 3300046678 Bacteria 1124
253 Ga0495623_0010131 3300046679 Bacteria 6101
254 Ga0495646_0208774 3300046680 Bacteria 1060
255 Ga0495647_0060129 3300046681 Bacteria 1497
256 Ga0495658_0024825 3300046683 Bacteria 3198
257 Ga0495613_0575639 3300046689 Bacteria 751
258 Ga0495613_0705629 3300046689 Bacteria 664
259 Ga0495613_1053229 3300046689 Bacteria 521
260 Ga0495624_0065060 3300046690 Bacteria 2278
261 Ga0495581_0099351 3300047315 Bacteria 1690
262 Ga0495674_0012929 3300047319 Bacteria 7860
263 Ga0495674_1225822 3300047319 Bacteria 566
264 Ga0495672_0075700 3300047320 Bacteria 1892
265 Ga0495680_0012760 3300047322 Bacteria 7373
266 Ga0495687_056660 3300047443 Bacteria 1634
267 Ga0495675_0017165 3300047444 Bacteria 4584
268 Ga0495677_0220435 3300047445 Bacteria 739
269 Ga0495684_0007364 3300047471 Bacteria 8531
270 Ga0495593_0042557 3300047673 Bacteria 2437
271 Ga0495602_0027146 3300048088 Bacteria 5511
272 Ga0496101_0260149 3300048904 Bacteria 1353
273 Ga0496102_0002254 3300048905 Bacteria 16517
274 Ga0496103_0673983 3300048906 Bacteria 656
275 Ga0496105_0443655 3300048908 Bacteria 1025
276 Ga0496106_0003151 3300048909 Bacteria 12308
277 Ga0496107_0024127 3300048910 Bacteria 4301
278 Ga0496108_1069987 3300048911 Bacteria 686
279 Ga0496117_0583739 3300048920 Bacteria 526
280 Ga0496119_0005654 3300048922 Bacteria 11866
281 Ga0496119_0016932 3300048922 Bacteria 5515
282 Ga0496120_0156473 3300048923 Bacteria 1140
283 Ga0496122_0013936 3300048925 Bacteria 7817
284 Ga0496122_0224008 3300048925 Bacteria 1076
285 Ga0496123_0008738 3300048926 Bacteria 9249
286 Ga0496123_0383629 3300048926 Bacteria 644
287 Ga0496125_0002094 3300048928 Bacteria 26844
288 Ga0496126_0015330 3300048929 Bacteria 7712
289 Ga0496126_1057978 3300048929 Unclassified 605
290 Ga0496126_1256690 3300048929 Bacteria 541
291 Ga0501033_0654275 3300049570 Bacteria 718
292 Ga0501036_1640337 3300049572 Bacteria 519
293 Ga0501038_0546184 3300049574 Bacteria 882
294 Ga0501039_0138999 3300049575 Bacteria 1907
295 Ga0501039_0487703 3300049575 Bacteria 968
296 Ga0501040_0035398 3300049576 Bacteria 3386
297 Ga0501041_0750860 3300049577 Bacteria 625
298 Ga0501042_0448521 3300049578 Bacteria 936
299 Ga0501043_0680232 3300049579 Bacteria 753
300 Ga0501043_1302783 3300049579 Bacteria 507
301 Ga0501046_1122102 3300049580 Bacteria 543
302 Ga0501070_0683991 3300049586 Bacteria 812
303 Ga0501071_0627110 3300049587 Bacteria 827
304 Ga0501071_1582535 3300049587 Unclassified 506
305 Ga0501073_0157918 3300049589 Bacteria 1571
306 Ga0501073_1142759 3300049589 Bacteria 535
307 Ga0501074_0130254 3300049590 Bacteria 1800
308 Ga0501075_0211347 3300049591 Bacteria 1480
309 Ga0501075_0835577 3300049591 Bacteria 701
310 Ga0501079_0389225 3300049741 Bacteria 1093
311 Ga0501080_0356917 3300049742 Bacteria 1319
312 Ga0501080_1020834 3300049742 Bacteria 717
313 Ga0501081_0729155 3300049743 Bacteria 745
314 Ga0501083_0536298 3300049744 Bacteria 762
315 Ga0501044_0413480 3300049823 Bacteria 1260
316 Ga0501045_1051156 3300049824 Bacteria 596
317 nmdc:mga03n38_407085_c1 3300050490 Bacteria 750
318 nmdc:mga03n38_906327_c1 3300050490 Unclassified 518
319 nmdc:mga00v17_397765_c1 3300050491 Bacteria 895
320 nmdc:mga0yw44_138118_c1 3300050492 Bacteria 1582
321 nmdc:mga0yw44_580795_c1 3300050492 Bacteria 761
322 nmdc:mga07m45_182509_c1 3300050496 Bacteria 1220
323 nmdc:mga07m45_566644_c1 3300050496 Bacteria 656
324 nmdc:mga05p37_687516_c1 3300050507 Bacteria 1139
325 nmdc:mga09592_1383397_c1 3300050508 Bacteria 576
326 nmdc:mga09592_14608_c1 3300050508 Bacteria 6409
327 nmdc:mga0qj67_282886_c1 3300050509 Bacteria 1344
328 nmdc:mga06r32_12652_c1 3300050510 Bacteria 7625
329 nmdc:mga06r32_272029_c1 3300050510 Bacteria 1681
330 Ga0495601_0010631 3300053077 Bacteria 5486
331 Ga0495601_0064061 3300053077 Bacteria 2337
332 Ga0495601_0151303 3300053077 Bacteria 1515
333 Ga0495612_0011195 3300053078 Bacteria 3620
334 Ga0495612_0211507 3300053078 Unclassified 857
335 Ga0495595_0402746 3300053084 Bacteria 693
336 Ga0495619_0446723 3300053085 Bacteria 891
337 Ga0500643_037504 3300053087 Bacteria 1443
338 Ga0500651_0008440 3300053093 Bacteria 6063
339 Ga0500650_0333171 3300053098 Bacteria 666
340 Ga0500594_0091889 3300053118 Bacteria 922
341 Ga0500642_0018228 3300053130 Bacteria 2711
342 Ga0500577_0347888 3300053142 Bacteria 648
343 Ga0500588_0031644 3300053146 Bacteria 1528
344 Ga0500622_0074252 3300053156 Bacteria 1713
345 Ga0500611_125366 3300053727 Bacteria 688
346 Ga0500609_046076 3300053731 Bacteria 604
347 Ga0501084_1575047 3300054114 Bacteria 549
348 Ga0587090_003579 3300059510 Bacteria 1817
349 Ga0587072_010703 3300059643 Bacteria 1486
350 Ga0501082_0617404 3300060353 Bacteria 949
351 Ga0501082_0804220 3300060353 Bacteria 822
352 Ga0530510_0056311 3300061734 Bacteria 2840
353 Ga0530510_1235804 3300061734 Unclassified 573
354 2510307463 2510065057 Bacteria 6649661
355 2511502778 2511231052 Bacteria 6974333
356 2513584000 2513237086 Bacteria 7265287
357 2513617081 2513237091 Bacteria 6900273
358 2513882159 2513237140 Bacteria 7076289
359 2513905463 2513237143 Bacteria 6664116
360 2515610513 2515154107 Bacteria 6795637
361 2516894148 2516653046 Bacteria 6989037
362 2551674653 2551306084 Bacteria 8942552
363 2551684513 2551306085 Bacteria 7347181
364 2551692203 2551306086 Bacteria 6843938
365 2551702556 2551306087 Bacteria 7351905
366 2551713949 2551306089 Bacteria 7162724
367 2551719726 2551306090 Bacteria 7953713
368 2551725332 2551306091 Bacteria 7086830
369 2551731659 2551306092 Bacteria 6992595
370 2551745890 2551306093 Bacteria 7064773
371 2599420838 2599185170 Bacteria 7295545
372 2599602586 2599185210 Bacteria 5624189
373 2839997423 2839993093 Bacteria 5512535
374 2855826867 2855825444 Bacteria 6785811
375 2855842263 2855839649 Bacteria 7135830
376 2858803078 2858800743 Bacteria 6603254
377 2885415127 2885409591 Bacteria 9235467
378 2899796618 2899792073 Bacteria 4926588
379 2904582003 2904578770 Bacteria 5302906
380 2915993157 2915986958 Bacteria 6739310
381 2915996965 2915993759 Bacteria 7016183
382 2916004552 2916000859 Bacteria 6865702
383 2916011572 2916007675 Bacteria 6898660
384 2916020883 2916014648 Bacteria 6946486
385 2916025756 2916021584 Bacteria 6854472
386 2916030450 2916028427 Bacteria 6748433
387 2916038529 2916035215 Bacteria 6755766
388 2916048052 2916041962 Bacteria 6820487
389 2916049913 2916048683 Bacteria 6543552
390 2916057422 2916055098 Bacteria 6758838
391 2916073097 2916068649 Bacteria 6943657
392 2916079963 2916076590 Bacteria 6596108
393 2919123219 2919119836 Bacteria 5208557
394 2921201601 2921201388 Bacteria 6926299
395 2921214642 2921208531 Bacteria 6745326
396 2921244164 2921237296 Bacteria 6876710
397 2921248138 2921244191 Bacteria 6568419
398 2921257483 2921257292 Bacteria 6808382
399 2921267452 2921263974 Bacteria 6864552
400 2921285520 2921282425 Bacteria 6826397
401 2921292653 2921289301 Bacteria 7316391
402 2921300295 2921296804 Bacteria 7176999
403 2924145489 2924144063 Bacteria 6883928
404 2924156461 2924150972 Bacteria 7169444
405 2924160051 2924158325 Bacteria 7188855
406 2924166707 2924165586 Bacteria 7260590
407 2924175733 2924172951 Bacteria 6749356
408 2924182454 2924179722 Bacteria 6843264
409 2924187337 2924186466 Bacteria 6876637
410 2924197231 2924193448 Bacteria 6955718
411 2924201696 2924200457 Bacteria 6757188
412 2924213568 2924207177 Bacteria 6917007
413 2924216126 2924214083 Bacteria 7080103
414 2924228192 2924221636 Bacteria 7113495
415 2924233590 2924228884 Bacteria 6633132
416 2933022479 2933016740 Bacteria 6355406
417 2935880103 2935873716 Bacteria 9632195
418 2937008329 2937002841 Bacteria 6934057
419 2937011009 2937009748 Bacteria 6746052
420 2937018343 2937016420 Bacteria 6782579
421 2937025827 2937023124 Bacteria 6815156
422 2937043659 2937042894 Bacteria 6741576
423 2937052140 2937049772 Bacteria 6757901
424 2937059011 2937056579 Bacteria 7107896
425 2937067025 2937063883 Bacteria 7199456
426 2937074639 2937071275 Bacteria 6984483
427 2937093041 2937091812 Bacteria 6979387
428 2937102947 2937098957 Bacteria 7249374
429 2937110773 2937106411 Bacteria 6947143
430 2937114988 2937113482 Bacteria 6505872
431 2937121376 2937119839 Bacteria 6597547
432 2937129568 2937126314 Bacteria 6771275
433 2957385902 2957382221 Bacteria 6737050
434 2957390006 2957388812 Bacteria 6778072
435 2957397349 2957395598 Bacteria 6822399
436 2957404717 2957402308 Bacteria 6741770
437 2957409185 2957408893 Bacteria 6558585
438 2957416847 2957415311 Bacteria 6991633
439 2957424120 2957422303 Bacteria 7172205
440 2957434254 2957430029 Bacteria 7022557
441 2957449379 2957443900 Bacteria 6869977
442 2957452386 2957450854 Bacteria 6765715
443 2957461568 2957457609 Bacteria 6967680
444 2957467290 2957464669 Bacteria 6568877
445 2957473663 2957471148 Bacteria 6797643
446 2957480264 2957478035 Bacteria 6756658
447 2957487947 2957484790 Bacteria 6703082
448 2957495072 2957491536 Bacteria 6695180
449 2957499433 2957498199 Bacteria 7126688
450 2957511906 2957505466 Bacteria 7253085
451 2960590805 2960584000 Bacteria 6864594
452 2960600444 2960597568 Bacteria 6550735
453 2960608601 2960603979 Bacteria 6898737
454 2960612919 2960610863 Bacteria 6691244
455 2960623377 2960617483 Bacteria 6727748
456 2960629371 2960624210 Bacteria 6875384
457 2960641110 2960637947 Bacteria 7296468
458 2960651246 2960645483 Bacteria 7211087
459 2960654198 2960652885 Bacteria 7083688
460 2960664393 2960660292 Bacteria 7041660
461 2960669881 2960667422 Bacteria 6763020
462 2960680134 2960674078 Bacteria 6609048
463 2960689617 2960687367 Bacteria 6535474
464 2964609110 2964607997 Bacteria 7101408
465 2964619047 2964615318 Bacteria 6809089
466 2964624035 2964621998 Bacteria 6834995
467 2964631022 2964628898 Bacteria 7083044
468 2964637055 2964636051 Bacteria 7091832
469 2964644801 2964643177 Bacteria 6820887
470 2964651482 2964649959 Bacteria 6675118
471 2964663039 2964656573 Bacteria 7100150
472 2964666495 2964663802 Bacteria 7019362
473 2964677368 2964670856 Bacteria 6851364
474 2964680742 2964678106 Bacteria 6792020
475 2964687135 2964685014 Bacteria 6839111
476 2964696306 2964691889 Bacteria 6802758
477 2964701509 2964698721 Bacteria 6765331
478 2964708532 2964705432 Bacteria 7114648
479 2964718556 2964712639 Bacteria 6695970
480 2964722632 2964719344 Bacteria 7286602
481 2967670765 2967664464 Bacteria 6948836
482 2967674825 2967671571 Bacteria 7021409
483 2967684144 2967678726 Bacteria 7264382
484 2967696375 2967693043 Bacteria 6804451
485 2967706340 2967699805 Bacteria 6854538
486 2967710475 2967706974 Bacteria 7186053
487 2967719882 2967714385 Bacteria 7000047
488 2967722996 2967721400 Bacteria 7073753
489 2967735218 2967735183 Bacteria 6827012
490 2967744978 2967742019 Bacteria 6794534
491 2967752492 2967748971 Bacteria 6733771
492 2967760145 2967755722 Bacteria 6814706
493 2967764115 2967762386 Bacteria 6923502
494 2967770605 2967769361 Bacteria 6587838
495 2967778245 2967775926 Bacteria 6738189
496 2970021630 2970019648 Bacteria 7072033
497 2970036813 2970033650 Bacteria 7118744
498 2970042424 2970040964 Bacteria 6731123
499 2970051440 2970047711 Bacteria 7088379
500 2970056132 2970054988 Bacteria 6611507
501 2970065525 2970061556 Bacteria 7099761
502 2970072344 2970068827 Bacteria 7123112
503 2970080146 2970076120 Bacteria 6697332
504 2970083169 2970082768 Bacteria 6183754
505 2970089228 2970088815 Bacteria 6933825
506 2970098006 2970095765 Bacteria 6936963
507 2970103718 2970102677 Bacteria 6812532
508 2970112063 2970109326 Bacteria 6863976
509 2970121180 2970116247 Bacteria 6501857
510 2970130053 2970129317 Bacteria 6806560
511 2970141144 2970136068 Bacteria 7207982
512 2970151476 2970149975 Bacteria 6779706
513 2970158859 2970156795 Bacteria 7168044
514 2970167085 2970164137 Bacteria 6861252
515 2970173550 2970170962 Bacteria 6876229
516 2970181387 2970177841 Bacteria 6768001
517 2970185440 2970184632 Bacteria 7054431
518 2970195364 2970191845 Bacteria 7032787
519 2977521208 2977516862 Bacteria 6940108
520 2977526560 2977523885 Bacteria 6960446
521 2977542273 2977537788 Bacteria 6929320
522 2977552292 2977551784 Bacteria 7125765
523 2977560139 2977558990 Bacteria 6863948
524 2977569743 2977565890 Bacteria 6901543
525 2977574930 2977572785 Bacteria 6763888
526 2977579916 2977579622 Bacteria 6772100
527 2989354216 2989349275 Bacteria 6349068
528 3005417302 3005416602 Bacteria 7064308
529 648736004 648276728 Bacteria 6968865
530 8003994776 8003992118 Bacteria 7266902
531 8005320450 8005314921 Bacteria 7072929
532 8005684337 8005682033 Bacteria 6726518
533 8006966990 8006964411 Bacteria 8966052
534 Ga0070680_100122153
535 JGI25152J39213_1001982
536 JGI25150J39212_1015534
537 JGI25151J46595_10142017
538 JGI25153J46596_10000693
539 JGI25153J46596_10059697
540 rootH2_10053930
541 rootH1_10059455
542 rootH1_10061936
543 rootH1_10291225
544 Ga0070658_10591984
545 Ga0070683_100049566
546 Ga0070680_100001711
547 Ga0070680_100046457
548 Ga0070660_100002257
549 Ga0070691_10643988
550 Ga0070687_100123985
551 Ga0070661_100040715
552 Ga0070692_10069070
553 Ga0070659_100368344
554 Ga0070709_10523116
555 Ga0070714_101160854
556 Ga0070710_11233701
557 Ga0070701_10040858
558 Ga0070705_100001958
559 Ga0070700_100006805
560 Ga0070694_100000699
561 Ga0070708_100063764
562 Ga0070663_100021591
563 Ga0070678_101154622
564 Ga0070681_10056364
565 Ga0070681_10096284
566 Ga0070681_10222320
567 Ga0070706_100057499
568 Ga0070706_100295816
569 Ga0070707_100288343
570 Ga0070707_102047387
571 Ga0070699_100003406
572 Ga0070699_101453010
573 Ga0070679_100054750
574 Ga0070679_100568343
575 Ga0070684_100014817
576 Ga0070697_100045658
577 Ga0070697_100282326
578 Ga0068853_100098242
579 Ga0070686_100198927
580 Ga0070695_100052565
581 Ga0070696_100000087
582 Ga0070693_100114965
583 Ga0070665_101084016
584 Ga0070704_100006935
585 Ga0068855_100020143
586 Ga0068855_100775199
587 Ga0070664_100305253
588 Ga0068857_100002462
589 Ga0068857_100003968
590 Ga0068854_101042176
591 Ga0068852_100074336
592 Ga0068859_100005753
593 Ga0068864_100322596
594 Ga0068861_100730520
595 Ga0068851_10012140
596 Ga0068863_100214663
597 Ga0068858_101888878
598 Ga0068860_100003602
599 Ga0068862_100002025
600 Ga0081455_10090298
601 Ga0070717_10360122
602 Ga0070717_10621825
603 Ga0075365_10163860
604 Ga0075365_10299310
605 Ga0075365_10499099
606 Ga0075363_100461678
607 Ga0070715_10237819
608 Ga0070716_100332481
609 Ga0070712_100161326
610 Ga0075369_10328192
611 Ga0075370_10078894
612 Ga0075428_100138619
613 Ga0075430_100306845
614 Ga0075431_100000978
615 Ga0075431_100625353
616 Ga0075429_100004447
617 Ga0075429_100995649
618 Ga0068865_100321374
619 Ga0097620_100005754
620 Ga0079104_1020115
621 Ga0099794_10489073
622 Ga0099794_10613332
623 Ga0099794_10784081
624 Ga0099795_10043537
625 Ga0099795_10404841
626 Ga0105240_10008497
627 Ga0105240_10290684
628 Ga0105240_11574682
629 Ga0111539_10804080
630 Ga0105241_12495848
631 Ga0105237_10008804
632 Ga0105237_10012724
633 Ga0105237_10036713
634 Ga0105238_10005124
635 Ga0105238_12508537
636 Ga0105249_10000473
637 Ga0099796_10151770
638 Ga0099796_10219114
639 Ga0105239_10028696
640 Ga0105246_10098736
641 Ga0157370_10033196
642 Ga0157370_10135046
643 Ga0157369_10016056
644 Ga0157369_12007729
645 Ga0157374_11468517
646 Ga0157378_13205548
647 Ga0157372_12875864
648 Ga0157380_11630173
649 Ga0157379_11192875
650 Ga0206356_11145487
651 Ga0213876_10044325
652 Ga0213871_10096424
653 Ga0207425_1000316
654 Ga0209129_1000268
655 Ga0209025_1005676
656 Ga0209758_1000151
657 Ga0209758_1001732
658 Ga0207653_10008855
659 Ga0207647_10521448
660 Ga0207699_10351470
661 Ga0207643_10111004
662 Ga0207705_10051448
663 Ga0207684_10049525
664 Ga0207684_10113144
665 Ga0207707_10002327
666 Ga0207707_10020479
667 Ga0207707_10246512
668 Ga0207695_10426046
669 Ga0207695_10753824
670 Ga0207695_11030118
671 Ga0207671_10019843
672 Ga0207671_10028444
673 Ga0207693_10152945
674 Ga0207660_10042812
675 Ga0207660_10056097
676 Ga0207657_10010155
677 Ga0207649_10026732
678 Ga0207649_11244813
679 Ga0207652_10010833
680 Ga0207652_10082378
681 Ga0207646_10548595
682 Ga0207694_10030055
683 Ga0207700_11369703
684 Ga0207690_10041213
685 Ga0207706_10533805
686 Ga0207704_10913392
687 Ga0207661_10087454
688 Ga0207679_10252213
689 Ga0207667_10070088
690 Ga0207712_10000863
691 Ga0207640_10937667
692 Ga0207639_10149095
693 Ga0207678_10021752
694 Ga0207708_10031642
695 Ga0207641_10042871
696 Ga0207676_10791612
697 Ga0207674_10012355
698 Ga0207674_10025210
699 Ga0207675_100151714
700 Ga0207683_10599830
701 Ga0207698_10090437
702 Ga0209281_1000733
703 Ga0209371_1093357
704 Ga0209179_1033613
705 Ga0268265_10003109
706 Ga0268264_10007646
707 Ga0307517_10000066
708 Ga0265328_10014003
709 Ga0265331_10003095
710 Ga0265327_10003201
711 Ga0265316_10008666
712 Ga0307513_10152585
713 Ga0307516_10353324
714 Ga0307416_101962954
715 Ga0373926_0008027
716 Ga0373934_0189480
717 Ga0373923_0061626
718 Ga0373939_0285683
719 Ga0373945_0145286
720 Ga0373954_0160607
721 Ga0373956_0434876
722 Ga0373957_0165817
723 Ga0373943_0067272
724 Ga0373946_0122958
725 Ga0373955_0153177
726 Ga0373924_0005630
727 Ga0373931_1268989
728 Ga0373935_0099858
729 Ga0373935_0136228
730 Ga0373927_0064372
731 Ga0373933_0081494
732 Ga0373947_0038350
733 Ga0373937_0129262
734 Ga0373925_0018790
735 Ga0436364_0835534
736 Ga0436364_1318325
737 Ga0436365_1317422
738 Ga0436360_0653321
739 Ga0436360_1225836
740 Ga0436361_0391576
741 Ga0436361_1050531
742 Ga0436361_1216813
743 Ga0451793_1904535
744 Ga0451841_0190407
745 Ga0466966_0366227
746 Ga0466957_1159603
747 Ga0466967_0608164
748 Ga0495592_0114550
749 Ga0495629_0453245
750 Ga0495651_0001731
751 Ga0495580_0093984
752 Ga0495580_0922750
753 Ga0495582_0007753
754 Ga0495662_0007117
755 Ga0495664_0013018
756 Ga0495664_0049134
757 Ga0495585_0094478
758 Ga0495606_0103849
759 Ga0495608_0338144
760 Ga0495608_0849085
761 Ga0495618_0088587
762 Ga0495628_0041344
763 Ga0495628_0490141
764 Ga0495628_0662660
765 Ga0495630_0441247
766 Ga0495644_0257719
767 Ga0495648_0001884
768 Ga0495666_0036661
769 Ga0495652_0507361
770 Ga0495652_0749501
771 Ga0495652_0981770
772 Ga0495665_0012584
773 Ga0495640_0041418
774 Ga0495586_0382299
775 Ga0495598_0084065
776 Ga0495645_0061840
777 Ga0495645_0469696
778 Ga0495667_0313157
779 Ga0495656_0226253
780 Ga0495634_0204390
781 Ga0495635_0109813
782 Ga0495635_0120323
783 Ga0495588_0636682
784 Ga0495657_0184247
785 Ga0495599_0232785
786 Ga0495623_0010131
787 Ga0495646_0208774
788 Ga0495647_0060129
789 Ga0495658_0024825
790 Ga0495613_0575639
791 Ga0495613_0705629
792 Ga0495613_1053229
793 Ga0495624_0065060
794 Ga0495581_0099351
795 Ga0495674_0012929
796 Ga0495674_1225822
797 Ga0495672_0075700
798 Ga0495680_0012760
799 Ga0495687_056660
800 Ga0495675_0017165
801 Ga0495677_0220435
802 Ga0495684_0007364
803 Ga0495593_0042557
804 Ga0495602_0027146
805 Ga0496101_0260149
806 Ga0496102_0002254
807 Ga0496103_0673983
808 Ga0496105_0443655
809 Ga0496106_0003151
810 Ga0496107_0024127
811 Ga0496108_1069987
812 Ga0496117_0583739
813 Ga0496119_0005654
814 Ga0496119_0016932
815 Ga0496120_0156473
816 Ga0496122_0013936
817 Ga0496122_0224008
818 Ga0496123_0008738
819 Ga0496123_0383629
820 Ga0496125_0002094
821 Ga0496126_0015330
822 Ga0496126_1057978
823 Ga0496126_1256690
824 Ga0501033_0654275
825 Ga0501036_1640337
826 Ga0501038_0546184
827 Ga0501039_0138999
828 Ga0501039_0487703
829 Ga0501040_0035398
830 Ga0501041_0750860
831 Ga0501042_0448521
832 Ga0501043_0680232
833 Ga0501043_1302783
834 Ga0501046_1122102
835 Ga0501070_0683991
836 Ga0501071_0627110
837 Ga0501071_1582535
838 Ga0501073_0157918
839 Ga0501073_1142759
840 Ga0501074_0130254
841 Ga0501075_0211347
842 Ga0501075_0835577
843 Ga0501079_0389225
844 Ga0501080_0356917
845 Ga0501080_1020834
846 Ga0501081_0729155
847 Ga0501083_0536298
848 Ga0501044_0413480
849 Ga0501045_1051156
850 nmdc:mga03n38_407085_c1
851 nmdc:mga03n38_906327_c1
852 nmdc:mga00v17_397765_c1
853 nmdc:mga0yw44_138118_c1
854 nmdc:mga0yw44_580795_c1
855 nmdc:mga07m45_182509_c1
856 nmdc:mga07m45_566644_c1
857 nmdc:mga05p37_687516_c1
858 nmdc:mga09592_1383397_c1
859 nmdc:mga09592_14608_c1
860 nmdc:mga0qj67_282886_c1
861 nmdc:mga06r32_12652_c1
862 nmdc:mga06r32_272029_c1
863 Ga0495601_0010631
864 Ga0495601_0064061
865 Ga0495601_0151303
866 Ga0495612_0011195
867 Ga0495612_0211507
868 Ga0495595_0402746
869 Ga0495619_0446723
870 Ga0500643_037504
871 Ga0500651_0008440
872 Ga0500650_0333171
873 Ga0500594_0091889
874 Ga0500642_0018228
875 Ga0500577_0347888
876 Ga0500588_0031644
877 Ga0500622_0074252
878 Ga0500611_125366
879 Ga0500609_046076
880 Ga0501084_1575047
881 Ga0587090_003579
882 Ga0587072_010703
883 Ga0501082_0617404
884 Ga0501082_0804220
885 Ga0530510_0056311
886 Ga0530510_1235804
887 2510307463
888 2511502778
889 2513584000
890 2513617081
891 2513882159
892 2513905463
893 2515610513
894 2516894148
895 2551674653
896 2551684513
897 2551692203
898 2551702556
899 2551713949
900 2551719726
901 2551725332
902 2551731659
903 2551745890
904 2599420838
905 2599602586
906 2839997423
907 2855826867
908 2855842263
909 2858803078
910 2885415127
911 2899796618
912 2904582003
913 2915993157
914 2915996965
915 2916004552
916 2916011572
917 2916020883
918 2916025756
919 2916030450
920 2916038529
921 2916048052
922 2916049913
923 2916057422
924 2916073097
925 2916079963
926 2919123219
927 2921201601
928 2921214642
929 2921244164
930 2921248138
931 2921257483
932 2921267452
933 2921285520
934 2921292653
935 2921300295
936 2924145489
937 2924156461
938 2924160051
939 2924166707
940 2924175733
941 2924182454
942 2924187337
943 2924197231
944 2924201696
945 2924213568
946 2924216126
947 2924228192
948 2924233590
949 2933022479
950 2935880103
951 2937008329
952 2937011009
953 2937018343
954 2937025827
955 2937043659
956 2937052140
957 2937059011
958 2937067025
959 2937074639
960 2937093041
961 2937102947
962 2937110773
963 2937114988
964 2937121376
965 2937129568
966 2957385902
967 2957390006
968 2957397349
969 2957404717
970 2957409185
971 2957416847
972 2957424120
973 2957434254
974 2957449379
975 2957452386
976 2957461568
977 2957467290
978 2957473663
979 2957480264
980 2957487947
981 2957495072
982 2957499433
983 2957511906
984 2960590805
985 2960600444
986 2960608601
987 2960612919
988 2960623377
989 2960629371
990 2960641110
991 2960651246
992 2960654198
993 2960664393
994 2960669881
995 2960680134
996 2960689617
997 2964609110
998 2964619047
999 2964624035
1000 2964631022
1001 2964637055
1002 2964644801
1003 2964651482
1004 2964663039
1005 2964666495
1006 2964677368
1007 2964680742
1008 2964687135
1009 2964696306
1010 2964701509
1011 2964708532
1012 2964718556
1013 2964722632
1014 2967670765
1015 2967674825
1016 2967684144
1017 2967696375
1018 2967706340
1019 2967710475
1020 2967719882
1021 2967722996
1022 2967735218
1023 2967744978
1024 2967752492
1025 2967760145
1026 2967764115
1027 2967770605
1028 2967778245
1029 2970021630
1030 2970036813
1031 2970042424
1032 2970051440
1033 2970056132
1034 2970065525
1035 2970072344
1036 2970080146
1037 2970083169
1038 2970089228
1039 2970098006
1040 2970103718
1041 2970112063
1042 2970121180
1043 2970130053
1044 2970141144
1045 2970151476
1046 2970158859
1047 2970167085
1048 2970173550
1049 2970181387
1050 2970185440
1051 2970195364
1052 2977521208
1053 2977526560
1054 2977542273
1055 2977552292
1056 2977560139
1057 2977569743
1058 2977574930
1059 2977579916
1060 2989354216
1061 3005417302
1062 648736004
1063 8003994776
1064 8005320450
1065 8005684337
1066 8006966990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sfv-assembly1.cif.gz_B crystal structure of the gdp-bound rab1a s25n mutant in complex with the coiled-coil domain of lida from legionella pneumophila 0.6035 30 54
4h5y-assembly1.cif.gz_A high-resolution crystal structure of legionella pneumophila lida (60-594) 0.5843 30 54
2yg4-assembly1.cif.gz_A structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine 0.5044 4 25
3tnd-assembly1.cif.gz_B crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.4602 3 69
3tnd-assembly1.cif.gz_F crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.4533 3 69
ID Description Score Start End Superfamily
af_Q8LI48_99_242_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.7591 3 17 3.30.710.10
af_Q0D7H0_18_116_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.6236 4 17 3.10.20.90
af_P10423_30_345_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.6219 3 17 3.40.630.10
3tnfB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.6085 30 52 3.30.450.390
3sfvB01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.6035 30 54 3.30.450.390
ID Description Score Start End GO Terms
AF-A0A2W5U7Q9-F1-model_v4 AbrB/MazE/SpoVT family DNA-binding domain-containing protein 0.4624 15 69 GO:0003677
AF-A0A0X7A2V2-F1-model_v4 Antitoxin VapB 0.4522 21 77
AF-A0A351Q2R2-F1-model_v4 AbrB/MazE/SpoVT family DNA-binding domain-containing protein 0.4479 1 70 GO:0003677
AF-A0A0X7A2V2-F1-model_v4 Antitoxin VapB 0.4479 21 77
AF-A0A1R3WLH7-F1-model_v4 deleted 0.4453 1 52

Map